Search Results

Search found 13757 results on 551 pages for 'decimal format'.

Page 166/551 | < Previous Page | 162 163 164 165 166 167 168 169 170 171 172 173  | Next Page >

• API for accessing PHP documentation?

  - by Chad Johnson

  I'm done some Googling, and I've found nothing. I'm scoping out writing a plugin for an editor I use, and I am wondering whether there is a way I can access the PHP documentation via an API? For instance, I'd like to get raw access to the information (besides the comments) located here: http://php.net/file_exists. php.net seemingly uses MediaWiki which provides an API. The tutorial provides the example URL, http://en.wikipedia.org/w/api.php?action=login&format=xml. This does not work for php.net, however (http://php.net/w/api.php?action=login&format=xml). I'm just looking for a little information on how to interface with the PHP documentation.

  Read the article

• How to send a Timestamp field to Oracle stored proc. from Java despite the DB config?

  - by Alfabravo

  I'm making a request from a java webapp to an Oracle' stored procedure which happens to have a Timestamp IN parameter. In the testing environment, it works sending: SimpleDateFormat dateFormat = new SimpleDateFormat("dd-MMM-yyyy hh:mm:ss a"); input.setTimestampField(dateFormat.format(new Date())); But in the production environment, it raises an exception ORA-01830: date format picture ends before converting entire input string. I know the testing environment should be a replica of the production site, but it is not in my hands to set them properly. And I need to send the Timestamp field despite the way they setup the database. Any ideas? Thanks in advance.

  Read the article

• Forcing IE8 Standards Mode with FEATURE_BROWSER_EMULATION

  - by earls

  I'm doing this: http://blogs.msdn.com/b/ie/archive/2009/03/10/more-ie8-extensibility-improvements.aspx But it's not working. I have "iexplore.exe" set to 8888 (decimal mode) under MACHINE, but it's still coming up documentMode = 5. I thought 8888 was suppose to force IE8 Standards Mode whether you have a doctype or not. What is going on?

  Read the article

• Parse a text file into multiple text file

  - by Vijay Kumar Singh

  I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

  Read the article

• Use boost date_time to parse and create HTTP-dates

  - by John Price

  I'm writing a kind of HTTP proxy, so I need to be able to do 3 things: Parse an HTTP-date given any of the 3 formats specified in RFC 2616, sec 3.3, Convert a file date-time to an HTTP-date string, and Output the date to a string. For reference, theses are examples of the date-times I need to parse. I will output only the first format: Sun, 06 Nov 1994 08:49:37 GMT ; RFC 822, updated by RFC 1123 Sunday, 06-Nov-94 08:49:37 GMT ; RFC 850, obsoleted by RFC 1036 Sun Nov 6 08:49:37 1994 ; ANSI C's asctime() format I'm pretty sure Boost date_time can do all of this, but I'm having some trouble with number 1. Does anyone already have code to do this? Perhaps I'm not using google proficiently, but I can't find an example of how to do this with boost anywhere. Thanks for any help!

  Read the article

• Subversion pre-commit hook to clean XML from WebDAV autocommit client

  - by rjmunro

  I know that it isn't normally safe to modify a commit from a pre-commit hook in Subversion because SVN clients will not see the version that has been committed, and will cache the wrong thing, but I'd like to clean the code from a versioning-naïve WebDAV client that won't keep a local cached copy. The idea is that when I look at the repository with an SVN client, the diffs are clean. The client, by the way is MS Word, using 2003 XML format files. We're already using this format in a WebDAV system, but we'd like to add a versioning capability for expert users. Everywhere I look for documentation on how to modify the code in a pre-commit hook, I get the answer "Don't do this", not the answer "Here's how to do this, but it's reccomeded you don't", so I can't even easily try it to see if it's going to cause me problems.

  Read the article

• rails, rest, render different action with responds to

  - by Sam

  Maybe my logic is not restful or know if this is how you would do it but this is what I am trying to do. I'm getting a category inside a category controller and then once I get that category I want to return to an index page in a different controller but keep that @category and the Category.busineses. Before rest I would have just done this: render :controller = "businesses" and it would have rendered the view of the index action in that controller. now in my respond_to block I have this format.html {redirect_to(business_path)} # index.html.erb format.xml { render :xml => @businesses } but of course with a render it looses the instance variable and starts with a new action. So what I want to do is render the action instead of redirecting to that action. is this possible?

  Read the article

• When is ¦ not equal to ¦?

  - by Trey Jackson

  Background. I'm working with netlists, and in general, people specify different hierarchies by using /. However, it's not illegal to actually use a / as a part of an instance name. For example, X1/X2/X3/X4 might refer to instance X4 inside another instance named X1/X2/X3. Or it might refer an instance named X3/X4 inside an instance named X2 inside an instance named X1. Got it? There's really no "regular" character that cannot be used as a part of an instance name, so you resort to a non-printable one, or ... perhaps one outside of the standard 0..127 ASCII chars. I thought I'd try (decimal) 166, because for me it shows up as the pipe: ¦. So... I've got some C++ code which constructs the path name using ¦ as the hierarchical separator, so the path above looks like X1¦X2/X3¦X4. Now the GUI is written in Tcl/Tk, and to properly translate this into human readable terms I need to do something like the following: set path [getPathFromC++] ;# returns X1¦X2/X3¦X4 set humanreadable [join [split $path ¦] /] Basically, replace the ¦ with / (I could also accomplish this with [string map]). Now, the problem is, the ¦ in the string I get from C++ doesn't match the ¦ I can create in Tcl. i.e. This fails: set path [getPathFromC++] ;# returns X1¦X2/X3¦X4 string match $path [format X1%cX2/X3%cX4 166 166] Visually, the two strings look identical, but string match fails. I even tried using scan to see if I'd mixed up the bit values. But set path [getPathFromC++] ;# returns X1¦X2/X3¦X4 set path2 [format X1%cX2/X3%cX4 166 166] for {set i 0} {$i < [string length $path]} {incr i} { set p [string range $path $i $i] set p2 [string range $path2 $i $i] scan %c $p c scan %c $p2 c2 puts [list $p $c :::: $p2 $c2 equal? [string equal $c $c2]] } Produces output which looks like everything should match, except the [string equal] fails for the ¦ characters with a print line: ¦ 166 :::: ¦ 166 equal? 0 For what it's worth, the character in C++ is defined as: const char SEPARATOR = 166; Any ideas why a character outside the regular ASCII range would fail like this? When I changed the separator to (decimal) 28 (^\), things worked fine. I just don't want to get bit by a similar problem on a different platform. (I'm currently using Redhat Linux).

  Read the article

• Default value of a type

  - by viky

  For any given type i want to know its default value. In C#, there is a keyword called default for doing this like object obj = default(Decimal); but I have an instance of Type (called myType) and if I say this, object obj = default(myType); it doesn't work Is there any good way of doing this? I know that a huge switch block will work but thats not a good choice.

  Read the article

• How does the iPhone SDK Core Data system store date types to sqlite?

  - by Andrew Arrow

  I used core data to do this: NSManagedObjectContext *m = [self managedObjectContext]; Foo *f = (Foo *)[NSEntityDescription insertNewObjectForEntityForName:@"Foo" inManagedObjectContext:m]; f.created_at = [NSDate date]; [m insertObject:f]; NSError *error; [m save:&error]; Where the created_at field is defined as type "Date" in the xcdatamodel. When I export the sql from the sqlite database it created, created_at is defined as type "timestamp" and the values look like: 290902422.72624 Nine digits before the . and then some fraction. What is this format? It's not epoch time and it's not julianday format. Epoch would be: 1269280338.81213 julianday would be: 2455278.236746875 (notice only 7 digits before the . not 9 like I have) How can I convert a number like 290902422.72624 to epoch time? Thanks!

  Read the article

• Creating avatar from uploaded image

  - by mamu

  We are using asp.net with .net 4.0 We want to allow users to upload any image and we want to create tiny avatar for uploaded image? What is the best way to convert uploaded images for avatar? We want to keep the same height width ratio if we can convert gif, bmp, jpg, png to one standard format it would be greate. Which could be the best format to convert it to? i think converting gif would be best option. am i correct? any open source option i can look at

  Read the article

• Microsoft Word Document Controls not accepting carriage returns

  - by Scott

  So, I have a Microsoft Word 2007 Document with several Plain Text Format (I have tried Rich Text Format as well) controls which accept input via XML. For carriage returns, I had the string being passed through XML containing "\r\n" when I wanted a carriage return, but the word document ignored that and just kept wrapping things on the same line. I also tried replacing the \r\n with System.Environment.NewLine in my C# mapper, but that just put in \r\n anyway, which still didn't work. Note also that on the control itself I have set it to "Allow Carriage Returns (Multiple Paragrpahs)" in the control properties. This is the XML for the listMapper <Field id="32" name="32" fieldType="SimpleText"> <DataSelector path="/Data/DB/DebtProduct"> <InputField fieldType="" path="/Data/DB/Client/strClientFirm" link="" type=""/> <InputField fieldType="" path="strClientRefDebt" link="" type=""/> </DataSelector> <DataMapper formatString="{0} Account Number: {1}" name="SimpleListMapper" type=""> <MapperData> </MapperData> </DataMapper> </Field> Note that this is the listMapper C# where I actually map the list (notice where I try and append the system.environment.newline) namespace DocEngine.Core.DataMappers { public class CSimpleListMapper:CBaseDataMapper { public override void Fill(DocEngine.Core.Interfaces.Document.IControl control, CDataSelector dataSelector) { if (control != null && dataSelector != null) { ISimpleTextControl textControl = (ISimpleTextControl)control; IContent content = textControl.CreateContent(); CInputFieldCollection fileds = dataSelector.Read(Context); StringBuilder builder = new StringBuilder(); if (fileds != null) { foreach (List<string> lst in fileds) { if (CanMap(lst) == false) continue; if (builder.Length > 0 && lst[0].Length > 0) builder.Append(Environment.NewLine); if (string.IsNullOrEmpty(FormatString)) builder.Append(lst[0]); else builder.Append(string.Format(FormatString, lst.ToArray())); } content.Value = builder.ToString(); textControl.Content = content; applyRules(control, null); } } } } } Does anybody have any clue at all how I can get MS Word 2007 (docx) to quit ignoring my newline characters??

  Read the article

• Power error handling inside of sql function

  - by user172062

  I have a power function call inside of a sql function. What is the correct way to handle overflow and underflow conditions since I cannot use a Try Catch inside of a function. I am also trying to avoid modifying the ARITHABORT, ANSI_WARNINGS, and ARITHIGNORE settings in the calling code. GO CREATE FUNCTION TestPow() RETURNS DECIMAL(30, 14) AS BEGIN DECLARE @result FLOAT SET @result = POWER(10.0, 300) RETURN @result END GO SELECT dbo.TestPow()

  Read the article

• How to determine if a .NET Type is a custom struct?

  - by SztupY

  Hi! How to write a simple method, that checks whether a concrete type is a custom struct (created with public struct { };) or not. Checking Type.IsValueType is not enough, because it is also true to int, long, etc, and adding a check to !IsPrimitiveType won't exclude decimal, DateTime and maybe some other value types. I know that most of the built in value types are actually "structs", but I only want to check for "custom structs" These questions are mostly the same but without the answer I need: #1 #2 #3

  Read the article

• Is it possible to convert Gregorian to Hijri date in Vb ?

  - by ahmed

  Hi, I have a table in sql where the date format is stored in Hijri. Now I am working on a vb.net application where I have to let the user update that dateField. So is it possible that if I place a datepicker(which is in Gregorian) and user selects the date and its converts into Hijri date before updating. I mean when the user selects the date and clicks the save button the date should be updated in hijri format in the sql . For now , the user is entering the date manually on a tms AdvEdit. Is there any code available to accomplish this task. Thanking you all in advance for your time and consideration.

  Read the article

• Are there any modern platforms with non-IEEE C/C++ float formats?

  - by Patrick Niedzielski

  Hi all, I am writing a video game, Humm and Strumm, which requires a network component in its game engine. I can deal with differences in endianness easily, but I have hit a wall in attempting to deal with possible float memory formats. I know that modern computers have all a standard integer format, but I have heard that they may not all use the IEEE standard for floating-point integers. Is this true? While certainly I could just output it as a character string into each packet, I would still have to convert to a "well-known format" of each client, regardless of the platform. The standard printf() and atod() would be inadequate. Please note, because this game is a Free/Open Source Software program that will run on GNU/Linux, *BSD, and Microsoft Windows, I cannot use any proprietary solutions, nor any single-platform solutions. Cheers, Patrick

  Read the article

• ruby on rails adding new route

  - by ohana

  i have an RoR application Log, which similar to the book store app, my logs_controller has all default action: index, show, update, create, delete.. now i need to add new action :toCSV, i defined it in logs_controller, and add new route in the config/routes as: map.resources :logs, :collection = { :toCSV = :get }. from irb, i checked the routes and see the new routes added already: rs = ActionController::Routing::Routes puts rs.routes GET /logs/toCSV(.:format)? {:controller="logs", :action="toCSV"} then ran ‘rake routes’ command in shell, it returned: toCSV_logs GET /logs/toCSV(.:format) {:controller="logs", :action="toCSV"} everything seems working. finally in my views code, i added the following: link_to 'Export to CSV', toCSV_logs_path when access it in the brower 'http://localhost:3000/logs/toCSV', it complained: Couldn't find Log with ID=toCSV i checked in script/server, and saw this one: ActiveRecord::RecordNotFound (Couldn't find Log with ID=toCSV): app/controllers/logs_controller.rb:290:in `show' seems when i click that link, it direct it to the action 'show' instead of 'toCSV', thus it took 'toCSV' as an id...anyone know why would this happen? and to fix it? Thanks...

  Read the article

• Rss Feed for HD Video for youtube channel?

  - by Praveen Chandrasekaran

  Suggest me to how to get the HD video url for the youtube channel uploads as a RSS Feed. its to play on android phones. the formats should be Format File Type H.263 3GPP (.3gp) and MPEG-4 (.mp4) H.264 AVC 3GPP (.3gp) and MPEG-4 (.mp4) MPEG-4 SP 3GPP (.3gp) if i use this link: http://gdata.youtube.com/feeds/api/users/youtube/uploads i get only the 3gpp format media-content tag? i want high definition mp4 video link. resolution must be 320X480.How can i? Any Idea?

  Read the article

• Interview Question 101 - Binary Number Interpretation

  - by waves

  Pretend you're at an interview. The interviewer asks: What is the decimal value of this binary number? 10110101 What is the first thing you responsed with?

  Read the article

• Formatting when copying SQL data and pasting in Excel

  - by Mary-Chan

  I want to copy a sql result set and paste it in Excel. But the data I paste in to the spreadsheet doesn't want to recognize Excel formatting. So if I change a column to currency, it doesn't do anything. But...if I double click on a cell, THEN it applies the currency format. But only to that cell. How can I make it automatically recognize the Excel format? I must be something I'm missing. Hopefully somebody can help. :-)

  Read the article

• Rss Feed for youtube channel?

  - by Praveen Chandrasekaran

  Suggest me to how to get the HD video url for the youtube channel uploads as a RSS Feed. its to play on android phones. the formats should be Format File Type H.263 3GPP (.3gp) and MPEG-4 (.mp4) H.264 AVC 3GPP (.3gp) and MPEG-4 (.mp4) MPEG-4 SP 3GPP (.3gp) if i use this link: http://gdata.youtube.com/feeds/api/users/youtube/uploads i get only the 3gpp format media-content tag? i want high definition mp4 video link. resolution must be 320X480.How can i? Any Idea?

  Read the article

• Symfony2 Entity to array

  - by Adriano Pedro

  I'm trying to migrate my flat php project to Symfony2, but its coming to be very hard. For instance, I have a table of Products specification that have several specifications and are distinguishables by its "cat" attribute in that Extraspecs DB table. Therefore I've created a Entity for that table and want to make an array of just the specifications with "cat" = 0... I supose the code is this one.. right? $typeavailable = $this->getDoctrine() ->getRepository('LabsCatalogBundle:ProductExtraspecsSpecs') ->findBy(array('cat' => '0')); Now how can i put this in an array to work with a form like this?: form = $this ->createFormBuilder($product) ->add('specs', 'choice', array('choices' => $typeavailableArray), 'multiple' => true) Thank you in advance :) # Thank you all.. But now I've came across with another problem.. In fact i'm building a form from an existing object: $form = $this ->createFormBuilder($product) ->add('name', 'text') ->add('genspec', 'choice', array('choices' => array('0' => 'None', '1' => 'General', '2' => 'Specific'))) ->add('isReg', 'choice', array('choices' => array('0' => 'Material', '1' => 'Reagent', '2' => 'Antibody', '3' => 'Growth Factors', '4' => 'Rodents', '5' => 'Lagomorphs'))) So.. in that case my current value is named "extraspecs", so i've added this like: ->add('extraspecs', 'entity', array( 'label' => 'desc', 'empty_value' => ' --- ', 'class' => 'LabsCatalogBundle:ProductExtraspecsSpecs', 'property' => 'specsid', 'query_builder' => function(EntityRepository $er) { return $er ->createQueryBuilder('e'); But "extraspecs" come from a relationship of oneToMany where every product has several extraspecs... Here is the ORM: Labs\CatalogBundle\Entity\Product: type: entity table: orders__regmat id: id: type: integer generator: { strategy: AUTO } fields: name: type: string length: 100 catnumber: type: string scale: 100 brand: type: integer scale: 10 company: type: integer scale: 10 size: type: decimal scale: 10 units: type: integer scale: 10 price: type: decimal scale: 10 reqcert: type: integer scale: 1 isReg: type: integer scale: 1 genspec: type: integer scale: 1 oneToMany: extraspecs: targetEntity: ProductExtraspecs mappedBy: product Labs\CatalogBundle\Entity\ProductExtraspecs: type: entity table: orders__regmat__extraspecs fields: extraspecid: id: true type: integer unsigned: false nullable: false generator: strategy: IDENTITY regmatid: type: integer scale: 11 spec: type: integer scale: 11 attrib: type: string length: 20 value: type: string length: 200 lifecycleCallbacks: { } manyToOne: product: targetEntity: Product inversedBy: extraspecs joinColumn: name: regmatid referencedColumnName: id HOw should I do this? Thank you!!!

  Read the article

• How can I get the associated ref path for a git SHA?

  - by andreb

  Hi, I want to be able to pass anything to a git command (maybe its a SHA, maybe it's just something like "origin/master" or "devel/epxerimental" etc.) and git tells me the ref path of the branch that the passed something lives in, e.g. <git_command> 0dc27819b8e9 => output: refs/heads/master <git_command> xyz/test => output: refs/remotes/xyz/master ... I've been looking at git show or git log or git rev-parse and apart from --pretty=format:%d I couldn't find anything. (--pretty=format:%d output is quite strange with lotsa free space and empty lines and sometimes more than one ref paths are on one line bunched together). There has to be a better way? Thanks for reading. Andre

  Read the article

• Replicating Java's DecimalFormat in C#

  - by Frank Krueger

  I am trying to replicate a subset of Java's DecimalFormat class. Below is what I've come up with. Does this look right to everyone? public class DecimalFormat : NumberFormat { int _maximumFractionDigits; int _minimumFractionDigits; string _format; void RebuildFormat () { _format = "{0:0."; _format += new string ('0', _minimumFractionDigits); if (_maximumFractionDigits > _minimumFractionDigits) { _format += new string ('#', _maximumFractionDigits - _minimumFractionDigits); } _format += "}"; } public override string format (object value) { return string.Format (_format, value); } public override void setMaximumFractionDigits (int n) { _maximumFractionDigits = n; RebuildFormat (); } public override void setMinimumFractionDigits (int n) { _minimumFractionDigits = n; RebuildFormat (); } public override void setGroupingUsed (bool g) { } public static NumberFormat getInstance () { return new DecimalFormat (); } }

  Read the article

• Can't get Sum() working in Northwind example

  - by Vince

  Hi, The following code is generating a runtime error and I have no idea why. from o in Orders group o by o.Employee into employeeOrders select new { employeeOrders.Key.EmployeeID, employeeOrders.Key.FirstName, Orders = from eord in employeeOrders orderby eord.OrderID select new { eord.OrderID, eord.OrderDate, OrderTotal=eord.OrderDetails.Sum (od => od.UnitPrice) } } The error is Member access 'System.Decimal UnitPrice' of 'LINQPad.User.OrderDetails' not legal on type 'LINQPad.User.Orders I've also tried this in VS2010 with a standard drag and drop data context and same thing. Thanks in advance

  Read the article

< Previous Page | 162 163 164 165 166 167 168 169 170 171 172 173  | Next Page >