Search Results

Search found 9228 results on 370 pages for 'hg import'.

Page 169/370 | < Previous Page | 165 166 167 168 169 170 171 172 173 174 175 176  | Next Page >

  • Hadoop in a RESTful Java Web Application - Conflicting URI templates

    - by user1231583
    I have a small Java Web Application in which I am using Jersey 1.12 and the Hadoop 1.0.0 JAR file (hadoop-core-1.0.0.jar). When I deploy my application to my JBoss 5.0 server, the log file records the following error: SEVERE: Conflicting URI templates. The URI template / for root resource class org.apache.hadoop.hdfs.server.namenode.web.resources.NamenodeWebHdfsMethods and the URI template / transform to the same regular expression (/.*)? To make sure my code is not the problem, I have created a fresh web application that contains nothing but the Jersey and Hadoop JAR files along with a small stub. My web.xml is as follows: <?xml version="1.0" encoding="UTF-8"?> <web-app version="2.5" xmlns="http://java.sun.com/xml/ns/javaee" xmlns:xsi="http://www.w3.org/2001/XMLSchema-instance" xsi:schemaLocation="http://java.sun.com/xml/ns/javaee http://java.sun.com/xml/ns/javaee/web-app_2_5.xsd"> <servlet> <servlet-name>ServletAdaptor</servlet-name> <servlet-class>com.sun.jersey.spi.container.servlet.ServletContainer</servlet- class> <load-on-startup>1</load-on-startup> </servlet> <servlet-mapping> <servlet-name>ServletAdaptor</servlet-name> <url-pattern>/mytest/*</url-pattern> </servlet-mapping> <session-config> <session-timeout> 30 </session-timeout> </session-config> <welcome-file-list> <welcome-file>index.jsp</welcome-file> </welcome-file-list> </web-app> My simple RESTful stub is as follows: import javax.ws.rs.core.Context; import javax.ws.rs.core.UriInfo; import javax.ws.rs.Path; @Path("/mytest") public class MyRest { @Context private UriInfo context; public MyRest() { } } In my regular application, when I remove the Hadoop JAR files (and the code that is using Hadoop), everything works as I would expect. The deployment is successful and the remaining RESTful services work. I have also tried the Hadoop 1.0.1 JAR files and have had the same problems with the conflicting URL template in the NamenodeWebHdfsMethods class. Any suggestions or tips in solving this problem would be greatly appreciated.

    Read the article

  • keyDown works but i get beeps

    - by Oscar
    I just got my keydown method to work. But i get system beep everytime i press key. i have no idea whats wrong. Googled for hours and all people say is that if you have your keyDown method you should also implement the acceptsFirstResponder. did that to and it still doesn't work. #import <Cocoa/Cocoa.h> #import "PaddleView.h" #import "BallView.h" @interface GameController : NSView { PaddleView *leftPaddle; PaddleView *rightPaddle; BallView * ball; CGPoint ballVelocity; int gameState; int player1Score; int player2Score; } @property (retain) IBOutlet PaddleView *leftPaddle; @property (retain) IBOutlet PaddleView *rightPaddle; @property (retain) IBOutlet BallView *ball; - (void)reset:(BOOL)newGame; @end #import "GameController.h" #define GameStateRunning 1 #define GameStatePause 2 #define BallSpeedX 0.2 #define BallSpeedY 0.3 #define CompMoveSpeed 15 #define ScoreToWin 5 @implementation GameController @synthesize leftPaddle, rightPaddle, ball; - (id)initWithCoder:(NSCoder *)aDecoder { self = [super initWithCoder:aDecoder]; if(self) { gameState = GameStatePause; ballVelocity = CGPointMake(BallSpeedX, BallSpeedY); [NSTimer scheduledTimerWithTimeInterval:0.001 target:self selector:@selector(gameLoop) userInfo:nil repeats:YES]; } return self; } - (void)gameLoop { if(gameState == GameStateRunning) { [ball setFrameOrigin:CGPointMake(ball.frame.origin.x + ballVelocity.x, ball.frame.origin.y + ballVelocity.y)]; if(ball.frame.origin.x + 15 > self.frame.size.width || ball.frame.origin.x < 0) { ballVelocity.x =- ballVelocity.x; } if(ball.frame.origin.y + 35 > self.frame.size.height || ball.frame.origin.y < 0) { ballVelocity.y =- ballVelocity.y; } } if(CGRectIntersectsRect(ball.frame, leftPaddle.frame)) { if(ball.frame.origin.x > leftPaddle.frame.origin.x) { ballVelocity.x =- ballVelocity.x; } } if(CGRectIntersectsRect(ball.frame, rightPaddle.frame)) { if(ball.frame.origin.x +15 > rightPaddle.frame.origin.x) { ballVelocity.x =- ballVelocity.x; } } if(ball.frame.origin.x <= self.frame.size.width / 2) { if(ball.frame.origin.y < leftPaddle.frame.origin.y + 75 && leftPaddle.frame.origin.y > 0) { [leftPaddle setFrameOrigin:CGPointMake(leftPaddle.frame.origin.x, leftPaddle.frame.origin.y - CompMoveSpeed)]; } if(ball.frame.origin.y > leftPaddle.frame.origin.y +75 && leftPaddle.frame.origin.y < 700 - leftPaddle.frame.size.height ) { [leftPaddle setFrameOrigin:CGPointMake(leftPaddle.frame.origin.x, leftPaddle.frame.origin.y + CompMoveSpeed)]; } } if(ball.frame.origin.x <= 0) { player2Score++; [self reset:(player2Score >= ScoreToWin)]; } if(ball.frame.origin.x + 15 > self.frame.size.width) { player1Score++; [self reset:(player1Score >= ScoreToWin)]; } } - (void)reset:(BOOL)newGame { gameState = GameStatePause; [ball setFrameOrigin:CGPointMake((self.frame.size.width + 7.5) / 2, (self.frame.size.height + 7.5)/2)]; if(newGame) { if(player1Score > player2Score) { NSLog(@"Player 1 Wins!"); } else { NSLog(@"Player 2 Wins!"); } player1Score = 0; player2Score = 0; } else { NSLog(@"Press key to serve"); } NSLog(@"Player 1: %d",player1Score); NSLog(@"Player 2: %d",player2Score); } - (void)moveRightPaddleUp { if(rightPaddle.frame.origin.y < 700 - rightPaddle.frame.size.height) { [rightPaddle setFrameOrigin:CGPointMake(rightPaddle.frame.origin.x, rightPaddle.frame.origin.y + 20)]; } } - (void)moveRightPaddleDown { if(rightPaddle.frame.origin.y > 0) { [rightPaddle setFrameOrigin:CGPointMake(rightPaddle.frame.origin.x, rightPaddle.frame.origin.y - 20)]; } } - (BOOL)acceptsFirstResponder { return YES; } - (void)keyDown:(NSEvent *)theEvent { if ([theEvent modifierFlags] & NSNumericPadKeyMask) { NSString *theArrow = [theEvent charactersIgnoringModifiers]; unichar keyChar = 0; if ( [theArrow length] == 0 ) { return; // reject dead keys } if ( [theArrow length] == 1 ) { keyChar = [theArrow characterAtIndex:0]; if ( keyChar == NSLeftArrowFunctionKey ) { gameState = GameStateRunning; } if ( keyChar == NSRightArrowFunctionKey ) { } if ( keyChar == NSUpArrowFunctionKey ) { [self moveRightPaddleUp]; } if ( keyChar == NSDownArrowFunctionKey ) { [self moveRightPaddleDown]; } [super keyDown:theEvent]; } } else { [super keyDown:theEvent]; } } - (void)drawRect:(NSRect)dirtyRect { } - (void)dealloc { [ball release]; [rightPaddle release]; [leftPaddle release]; [super dealloc]; } @end

    Read the article

  • Can't run jUnit with Eclipse

    - by KimKha
    I use new Eclipse. Create demo test with jUnit (I added default jUnit library built-in Eclipse). Then I write this code: import junit.framework.*; import org.junit.Test; public class SimpleTest extends TestCase { public SimpleTest(String name) { super(name); } public final void main(String method){ } @Test public final void testSimpleTest() { int answer = 2; assertEquals((1+1), answer); } } But it doesn't run. In the Debug tab: org.eclipse.jdt.internal.junit.runner.RemoteTestRunner at localhost:52754 Thread [main] (Suspended (exception ClassNotFoundException)) URLClassLoader$1.run() line: not available [local variables unavailable] AccessController.doPrivileged(PrivilegedExceptionAction<T>, AccessControlContext) line: not available [native method] Launcher$AppClassLoader(URLClassLoader).findClass(String) line: not available Launcher$AppClassLoader(ClassLoader).loadClass(String, boolean) line: not available Launcher$AppClassLoader.loadClass(String, boolean) line: not available Launcher$AppClassLoader(ClassLoader).loadClass(String) line: not available How can I solve this?

    Read the article

  • Avoiding nesting two for loops

    - by chavanak
    Hi, Please have a look at the code below: import string from collections import defaultdict first_complex=open( "residue_a_chain_a_b_backup.txt", "r" ) first_complex_lines=first_complex.readlines() first_complex_lines=map( string.strip, first_complex_lines ) first_complex.close() second_complex=open( "residue_a_chain_a_c_backup.txt", "r" ) second_complex_lines=second_complex.readlines() second_complex_lines=map( string.strip, second_complex_lines ) second_complex.close() list_1=[] list_2=[] for x in first_complex_lines: if x[0]!="d": list_1.append( x ) for y in second_complex_lines: if y[0]!="d": list_2.append( y ) j=0 list_3=[] list_4=[] for a in list_1: pass for b in list_2: pass if a==b: list_3.append( a ) kvmap=defaultdict( int ) for k in list_3: kvmap[k]+=1 print kvmap Normally I use izip or izip_longest to club two for loops, but this time the length of the files are different. I don't want a None entry. If I use the above method, the run time becomes incremental and useless. How am I supposed to get the two for loops going? Cheers, Chavanak

    Read the article

  • How to draw the "trail" in a maze solving application

    - by snow-spur
    Hello i have designed a maze and i want to draw a path between the cells as the 'person' moves from one cell to the next. So each time i move the cell a line is drawn Also i am using the graphics module The graphics module is an object oriented library Im importing from graphics import* from maze import* my circle which is my cell center = Point(15, 15) c = Circle(center, 12) c.setFill('blue') c.setOutline('yellow') c.draw(win) p1 = Point(c.getCenter().getX(), c.getCenter().getY()) this is my loop if mazez.blockedCount(cloc)> 2: mazez.addDecoration(cloc, "grey") mazez[cloc].deadend = True c.move(-25, 0) p2 = Point(getX(), getY()) line = graphics.Line(p1, p2) cloc.col = cloc.col - 1 Now it says getX not defined every time i press a key is this because of p2???

    Read the article

  • Importing a spreadsheet into an asp.net program and listing the worksheets

    - by Bob Avallone
    I have to import the contents of a spreadsheet in my asp.net project. The code behind is c#. I figured out how to locate the spreadsheet on the user's computer and how to import the data from a given worksheet into a datable. The problem is I may not know the name of the worksheet ahead of time. I want to present the user with a list of available worksheets and have them pick one. That is the piece I don't know how to do. Thanks in advance. Bob Avallone

    Read the article

  • java timer on current instance

    - by hspim
    import java.util.Scanner; import java.util.Timer; import java.util.TimerTask; public class Boggle { Board board; Player player; Timer timer; boolean active; static Scanner in = new Scanner(System.in); public Boggle() { board = new Board(4); timer = new Timer(); } public void newGame() { System.out.println("Please enter your name: "); String line = in.nextLine(); player = new Player(line); active = true; board.shuffle(); System.out.println(board); timer.schedule(new timesUP(), 20000); while(active) { String temp = in.nextLine(); player.addGuess(temp); } } public void endGame() { active = false; int score = Scoring.calculate(player, board); System.out.println(score); } class timesUP extends TimerTask { public void run() { endGame(); } } public static void main(String[] args) { Boggle boggle = new Boggle(); boggle.newGame(); } } I have the above class which should perform a loop for a given length of time and afterwards invoke an instance method. Essentially I need the loop in newGame() to run for a minute or so before endGame() is invoked on the current instance. However, using the Timer class I'm not sure how I would invoke the method I need on the current instance since I can't pass any parameters to the timertasks run method? Is there an easy way to do this or am I going about this the wrong way? (note: this is a console project only, no GUI) ========== code edited I've changed the code to the above following the recommendations, and it works almost as I expect however the thread still doesnt seem to end properly. I was the while loop would die and control would eventually come back to the main method. Any ideas?

    Read the article

  • Event handling for keyboard strokes

    - by david
    Hey, I'm trying to get familiar with the whole keyboard event detection thing. Here's my sample code. <fx:Script> <![CDATA[ import flash.events.KeyboardEvent; import mx.controls.Alert; private function init():void{ addEventListener(KeyboardEvent.KEY_DOWN,reportKeyDown); } private function reportKeyDown(event:KeyboardEvent):void { Alert.show("a key was pressed"); } ]]> </fx:Script> As you can see, I'm at stage 0 of playing around with it, but it won't work. Anyone has any idea what I should be doing instead? Thanks

    Read the article

  • SQLAlchemy automatically converts str to unicode on commit

    - by Victor Stanciu
    Hello, When inserting an object into a database with SQLAlchemy, all it's properties that correspond to String() columns are automatically transformed from <type 'str'> to <type 'unicode'>. Is there a way to prevent this behavior? Here is the code: from sqlalchemy import create_engine, Table, Column, Integer, String, MetaData from sqlalchemy.orm import mapper, sessionmaker engine = create_engine('sqlite:///:memory:', echo=False) metadata = MetaData() table = Table('projects', metadata, Column('id', Integer, primary_key=True), Column('name', String(50)) ) class Project(object): def __init__(self, name): self.name = name mapper(Project, table) metadata.create_all(engine) session = sessionmaker(bind=engine)() project = Project("Lorem ipsum") print(type(project.name)) session.add(project) session.commit() print(type(project.name)) And here is the output: <type 'str'> <type 'unicode'> I know I should probably just work with unicode, but this would involve digging through some third-party code and I don't have the Python skills for that yet :)

    Read the article

  • one variable and multiple controllers..

    - by Simon
    I'm working on a web application, using the CAKEPHP framework. Herefor i need to request one variable on multiple pages (all pages have different controllers). it is oubvious that i get a error on several pages, since the variable isn't declared in all the different controllers. Is there a workaround for this? i've already tried the app:: import to import a controller in another controller, but this doens't seem to work (still get a undefined variable error). Thnx for your cooperation! Regards, Simon

    Read the article

  • Python Imaging: YCbCr problems

    - by daver
    Hi, I'm doing some image processing in Python using PIL, I need to extract the luminance layer from a series of images, and do some processing on that using numpy, then put the edited luminance layer back into the image and save it. The problem is, I can't seem to get any meaningful representation of my Image in a YCbCr format, or at least I don't understand what PIL is giving me in YCbCr. PIL documentation claims YCbCr format gives three channels, but when I grab the data out of the image using np.asarray, I get 4 channels. Ok, so I figure one must be alpha. Here is some code I'm using to test this process: import Image as im import numpy as np pengIm = im.open("Data\\Test\\Penguins.bmp") yIm = pengIm.convert("YCbCr") testIm = np.asarray(yIm) grey = testIm[:,:,0] grey = grey.astype('uint8') greyIm = im.fromarray(grey, "L") greyIm.save("Data\\Test\\grey.bmp") I'm expecting a greyscale version of my image, but what I get is this jumbled up mess: http://i.imgur.com/zlhIh.png Can anybody explain to me where I'm going wrong? The same code in matlab works exactly as I expect.

    Read the article

  • Why is the destructor called when the CPython garbage collector is disabled?

    - by Frederik
    I'm trying to understand the internals of the CPython garbage collector, specifically when the destructor is called. So far, the behavior is intuitive, but the following case trips me up: Disable the GC. Create an object, then remove a reference to it. The object is destroyed and the __del__ method is called. I thought this would only happen if the garbage collector was enabled. Can someone explain why this happens? Is there a way to defer calling the destructor? import gc import unittest _destroyed = False class MyClass(object): def __del__(self): global _destroyed _destroyed = True class GarbageCollectionTest(unittest.TestCase): def testExplicitGarbageCollection(self): gc.disable() ref = MyClass() ref = None # The next test fails. # The object is automatically destroyed even with the collector turned off. self.assertFalse(_destroyed) gc.collect() self.assertTrue(_destroyed) if __name__=='__main__': unittest.main() Disclaimer: this code is not meant for production -- I've already noted that this is very implementation-specific and does not work on Jython.

    Read the article

  • read subprocess stdout line by line

    - by Caspin
    My python script uses subprocess to call a linux utility that is very noisy. I want to store all of the output to a log file, but only show some of it to the user. I thought the following would work, but the output does show up in my application until the utility has produced a significant amount of output. #fake_utility.py, just generates lots of output over time import time i = 0 while True: print hex(i)*512 i += 1 time.sleep(0.5) #filters output import subprocess proc = subprocess.Popen(['python','fake_utility.py'],stdout.subprocess.PIPE) for line in proc.stdout: #the real code does filtering here print "test:", line.rstrip() The behavior I really want is for the filter script to print each line as it is received from the subprocess. Sorta like what tee does but with python code. What am I missing? Is this even possible?

    Read the article

  • How to properly close a process with NppExec?

    - by Sam the Great
    I'm not sure what's going on here, but the following code continues running even after I end the process in the NppExec console with Ctrl-C (during the execution of the while loop). I restarted my computer to stop the Ctrl key sends. However, if I run the script in Window's cmd prompt, Ctrl-C ends the script just fine. import time import win32com.client shell = win32com.client.Dispatch("WScript.Shell") time.sleep(2) while True: shell.SendKeys('^') # Ctrl key time.sleep(0.5) The NppExec run command I used was: cmd /C python -u "$(FULL_CURRENT_PATH)" Let me know if there is any more information I can provide. Thanks.

    Read the article

  • Problem evaluating NULL in an IIF statement (Access)

    - by Mohgeroth
    Item in the recordset rstImportData("Flat Size") is = Null With that, given the following statement: IIF(IsNull(rstImportData("Flat Size")), Null, cstr(rstImportData("Flat Size"))) Result: Throws error 94: Invalid use of Null If I change the statement by removing the type conversion upon a false comparison: IIF(IsNull(rstImportData("Flat Size")), Null, 0) Result: Null It returns Null as it should have the first time. It appears that I cannot do a type conversion in an IIF if the value passed in should ever be null even if it passes an IIF test, it still attempts to evaluate it at both the true and false answer. The only reason I'm using IIF like this is because I have a 25 line comparison to compare data from an Import against a matching record in a database to see if I need to append the prior to history. Any thoughts? The way data is imported there will be null dates and where the spreadsheet import is in a string format I must convert either side to the other to compare the values properly but if either side is null this exception occurs :(

    Read the article

  • In an ASP.NET MVC site, where would the JQuery code go?

    - by Maxim Z.
    I'm just getting started with ASP.NET MVC. I'm going to be using JQuery on the website I'm making, but I'm not really sure about one thing: where would JQuery code be placed? This concerns two things: Where do I import the JQuery JavaScript file? (I've been thinking that the Master page would be a good place to do this; am I right, or do I have to import it in each view?) Should all my JQuery code be referenced from the Master page (i.e., I store my code that uses JQuery in a separate .js file and reference it in a <script> tag)? Thanks in advance.

    Read the article

  • Gui problem after rewriting to MVC

    - by trevor_nise
    I'm practicing MVC style programming. I have a Mastermind game in a single file, working with no problems (maybe apart of the fact that "Check" button is invisible at start). http://paste.pocoo.org/show/226726/ But when I've rewritten it to model, view, controller files - when I click on empty Pin (that should be updated, and repainted with new color) - noting happens. Can anybody see any problems here ? I've tried placing repaint() in different places, but it simply does not work at all :/ Main : public class Main { public static void main(String[] args){ Model model = new Model(); View view = new View("Mastermind", 400, 590, model); Controller controller = new Controller(model, view); view.setVisible(true); } } Model : import java.util.Random; public class Model{ static final int LINE = 5, SCORE = 10, OPTIONS = 20; Pin pins[][] = new Pin[21][LINE]; int combination[] = new int[LINE]; int curPin = 0; int turn = 1; Random generator = new Random(); int repaintPin; boolean pinsRepaint=false; int pinsToRepaint; boolean isUpdate = true, isPlaying = true, isRowFull = false; static final int HIT_X[] = {270,290,310,290,310}, HIT_Y[] = {506,496,496,516,516}; public Model(){ for ( int i=0; i < SCORE; i++ ){ for ( int j = 0; j < LINE; j++ ){ pins[i][j] = new Pin(20,0); pins[i][j].setPosition(j*50+30,510-i*50); pins[i+SCORE][j] = new Pin(8,0); pins[i+SCORE][j].setPosition(HIT_X[j],HIT_Y[j]-i*50); } } for ( int i=0; i < LINE; i++ ){ pins[OPTIONS][i] = new Pin( 20, i+2 ); pins[OPTIONS][i].setPosition( 370,i * 50 + 56); } } void fillHole(int color) { pins[turn-1][curPin].setColor(color+1); pinsRepaint = true; pinsToRepaint = turn; curPin = (curPin+1) % LINE; if (curPin == 0){ isRowFull = true; } pinsRepaint = false; pinsToRepaint = 0; } void check() { int junkPins[] = new int[LINE], junkCode[] = new int[LINE]; int pinCount = 0, pico = 0; for ( int i = 0; i < LINE; i++ ) { junkPins[i] = pins[turn-1][i].getColor(); junkCode[i] = combination[i]; } for ( int i = 0; i < LINE; i++ ){ if (junkPins[i]==junkCode[i]) { pins[turn+SCORE][pinCount].setColor(1); pinCount++; pico++; junkPins[i] = 98; junkCode[i] = 99; } } for ( int i = 0; i < LINE; i++ ){ for ( int j = 0; j < LINE; j++ ) if (junkPins[i]==junkCode[j]) { pins[turn+SCORE][pinCount].setColor(2); pinCount++; junkPins[i] = 98; junkCode[j] = 99; j = LINE; } } pinsRepaint = true; pinsToRepaint = turn + SCORE; pinsRepaint = false; pinsToRepaint=0; if ( pico == LINE ){ isPlaying = false; } else if ( turn >= 10 ){ isPlaying = false; } else{ curPin = 0; isRowFull = false; turn++; } } void combination() { for ( int i = 0; i < LINE; i++ ){ combination[i] = generator.nextInt(6) + 1; } } } class Pin{ private int color, X, Y, radius; public Pin(){ X = 0; Y = 0; radius = 0; color = 0; } public Pin( int r,int c ){ X = 0; Y = 0; radius = r; color = c; } public int getX(){ return X; } public int getY(){ return Y; } public int getRadius(){ return radius; } public void setRadius(int r){ radius = r; } public void setPosition( int x,int y ){ this.X = x ; this.Y = y ; } public void setColor( int c ){ color = c; } public int getColor() { return color; } } View: import java.awt.*; import javax.swing.*; public class View extends Frame{ Model model; JButton checkAnswer; private JPanel button; private static final Color COLORS[] = {Color.black, Color.white, Color.red, Color.yellow, Color.green, Color.blue, new Color(7, 254, 250)}; public View(String name, int w, int h, Model m){ model = m; setTitle( name ); setSize( w,h ); setResizable( false ); this.setLayout(new BorderLayout()); button = new JPanel(); button.setSize( new Dimension(400, 100)); button.setVisible(true); checkAnswer = new JButton("Check"); checkAnswer.setSize( new Dimension(200, 30)); button.add( checkAnswer ); this.add( button, BorderLayout.SOUTH); button.setVisible(true); } @Override public void paint( Graphics g ) { g.setColor( new Color(238, 238, 238)); g.fillRect( 0,0,400,590); for ( int i=0; i < model.pins.length; i++ ) { paintPins(model.pins[i][0],g); paintPins(model.pins[i][1],g); paintPins(model.pins[i][2],g); paintPins(model.pins[i][3],g); paintPins(model.pins[i][4],g); } } @Override public void update( Graphics g ) { if ( model.isUpdate ) { paint(g); } else { model.isUpdate = true; paintPins(model.pins[model.repaintPin-1][0],g); paintPins(model.pins[model.repaintPin-1][1],g); paintPins(model.pins[model.repaintPin-1][2],g); paintPins(model.pins[model.repaintPin-1][3],g); paintPins(model.pins[model.repaintPin-1][4],g); } } void repaintPins( int pin ) { model.repaintPin = pin; model.isUpdate = false; repaint(); } public void paintPins(Pin p, Graphics g ){ int X = p.getX(); int Y = p.getY(); int color = p.getColor(); int radius = p.getRadius(); int x = X-radius; int y = Y-radius; if (color > 0){ g.setColor( COLORS[color]); g.fillOval( x,y,2*radius,2*radius ); } else{ g.setColor( new Color(238, 238, 238) ); g.drawOval( x,y,2*radius-1,2*radius-1 ); } g.setColor( Color.black ); g.drawOval( x,y,2*radius,2*radius ); } } Controller: import java.awt.*; import java.awt.event.*; public class Controller implements MouseListener, ActionListener { private Model model; private View view; public Controller(Model m, View v){ model = m; view = v; view.addWindowListener( new WindowAdapter(){ public void windowClosing(WindowEvent e){ System.exit(0); } }); view.addMouseListener(this); view.checkAnswer.addActionListener(this); model.combination(); } public void actionPerformed( ActionEvent e ) { if(e.getSource() == view.checkAnswer){ if(model.isRowFull){ model.check(); } } } public void mousePressed(MouseEvent e) { Point mouse = new Point(); mouse = e.getPoint(); if (model.isPlaying){ if (mouse.x > 350) { int button = 1 + (int)((mouse.y - 32) / 50); if ((button >= 1) && (button <= 5)){ model.fillHole(button); if(model.pinsRepaint){ view.repaintPins( model.pinsToRepaint ); } } } } } public void mouseClicked(MouseEvent e) {} public void mouseReleased(MouseEvent e){} public void mouseEntered(MouseEvent e) {} public void mouseExited(MouseEvent e) {} }

    Read the article

  • java.util.zip - ZipInputStream v.s. ZipFile

    - by lucho
    Hello, community! I have some general questions regarding the java.util.zip library. What we basically do is an import and an export of many small components. Previously these components were imported and exported using a single big file, e.g.: <component-type-a id="1"/> <component-type-a id="2"/> <component-type-a id="N"/> <component-type-b id="1"/> <component-type-b id="2"/> <component-type-b id="N"/> Please note that the order of the components during import is relevant. Now every component should occupy its own file which should be externally versioned, QA-ed, bla, bla. We decided that the output of our export should be a zip file (with all these files in) and the input of our import should be a similar zip file. We do not want to explode the zip in our system. We do not want opening separate streams for each of the small files. My current questions: Q1. May the ZipInputStream guarantee that the zip entries (the little files) will be read in the same order in which they were inserted by our export that uses ZipOutputStream? I assume reading is something like: ZipInputStream zis = new ZipInputStream(new BufferedInputStream(fis)); ZipEntry entry; while((entry = zis.getNextEntry()) != null) { //read from zis until available } I know that the central zip directory is put at the end of the zip file but nevertheless the file entries inside have sequential order. I also know that relying on the order is an ugly idea but I just want to have all the facts in mind. Q2. If I use ZipFile (which I prefer) what is the performance impact of calling getInputStream() hundreds of times? Will it be much slower than the ZipInputStream solution? The zip is opened only once and ZipFile is backed by RandomAccessFile - is this correct? I assume reading is something like: ZipFile zipfile = new ZipFile(argv[0]); Enumeration e = zipfile.entries();//TODO: assure the order of the entries while(e.hasMoreElements()) { entry = (ZipEntry) e.nextElement(); is = zipfile.getInputStream(entry)); } Q3. Are the input streams retrieved from the same ZipFile thread safe (e.g. may I read different entries in different threads simultaneously)? Any performance penalties? Thanks for your answers!

    Read the article

  • Converting IPv4 or IPv6 address to a long for comparisons

    - by Justin Akehurst
    In order to check if an IPv4 or IPv6 address is within a certain range, I've got code that takes an IPv4 address, turns that into a long, then does that same conversion on the upper/lower bound of the subnet, then checks to see if the long is between those values. I'd like to be able to do the same thing for IPv6, but saw nothing in the Python 2.6 standard libraries to allow me to do this, so I wrote this up: import socket, struct from array import array def ip_address_to_long(address): ip_as_long = None try: ip_as_long = socket.ntohl(struct.unpack('L', socket.inet_pton(socket.AF_INET, address))[0]) except socket.error: # try IPv6 try: addr = array('L', struct.unpack('!4L', socket.inet_pton(socket.AF_INET6, address))) addr.reverse() ip_as_long = sum(addr[i] << (i * 32) for i in range(len(addr))) except socket.error as se: raise ValueError('Invalid address') except Exception as e: print str(e) return ip_as_long My question is: Is there a simpler way to do this that I am missing? Is there a standard library call that can do this for me?

    Read the article

  • How to use pom.xml/Maven to initialize a local thoughtsite (App Engine sample) project in Eclipse?

    - by ovr
    This sample app ("thoughtsite") for App Engine contains a pom.xml in its trunk: http://code.google.com/p/thoughtsite/source/browse/#svn/trunk But I don't know what command to run in Maven to set up the project locally. (The README doesn't mention anything about Maven.) I tried to just import the project code directly into Eclipse but it doesn't look like it's in an appropriate format for a direct import. So I assume I need to do something with Maven to get it set up correctly. I haven't really used Maven before so I'm not sure what command I would need to run to set everything up. The pom.xml seems like it downloads a bunch of dependencies for the project like the Spring jar files which I don't see anywhere else in the svn repository.

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • How do I use timezones with a datetime object in python?

    - by jidar
    How do I properly represent a different timezone in my timezone? The below example only works because I know that EDT is one hour ahead of me, so I can uncomment the subtraction of myTimeZone() import datetime, re from datetime import tzinfo class myTimeZone(tzinfo): """docstring for myTimeZone""" def utfoffset(self, dt): return timedelta(hours=1) def myDateHandler(aDateString): """u'Sat, 6 Sep 2008 21:16:33 EDT'""" _my_date_pattern = re.compile(r'\w+\,\s+(\d+)\s+(\w+)\s+(\d+)\s+(\d+)\:(\d+)\:(\d+)') day, month, year, hour, minute, second = _my_date_pattern.search(aDateString).groups() month = [ 'JAN', 'FEB', 'MAR', 'APR', 'MAY', 'JUN', 'JUL', 'AUG', 'SEP', 'OCT', 'NOV', 'DEC' ].index(month.upper()) + 1 dt = datetime.datetime( int(year), int(month), int(day), int(hour), int(minute), int(second) ) # dt = dt - datetime.timedelta(hours=1) # dt = dt - dt.tzinfo.utfoffset(myTimeZone()) return (dt.year, dt.month, dt.day, dt.hour, dt.minute, dt.second, 0, 0, 0) def main(): print myDateHandler("Sat, 6 Sep 2008 21:16:33 EDT") if __name__ == '__main__': main()

    Read the article

  • Haskell Ord instance with a Set

    - by mvid
    I have some code that I would like to use to append an edge to a Node data structure: import Data.Set (Set) import qualified Data.Set as Set data Node = Vertex String (Set Node) deriving Show addEdge :: Node -> Node -> Node addEdge (Vertex name neighbors) destination | Set.null neighbors = Vertex name (Set.singleton destination) | otherwise = Vertex name (Set.insert destination neighbors) However when I try to compile I get this error: No instance for (Ord Node) arising from a use of `Set.insert' As far as I can tell, Set.insert expects nothing but a value and a set to insert it into. What is this Ord?

    Read the article

  • GWT combobox not displaying correctly

    - by James
    Hi, I am using GWT with GWT-EXT running in glassfish. I create 2 combo boxes as follows: import com.extjs.gxt.ui.client.widget.form.ComboBox; import com.extjs.gxt.ui.client.widget.form.SimpleComboBox; this.contentPanel = new ContentPanel(); this.contentPanel.setFrame(true); this.contentPanel.setSize((int)(Window.getClientWidth()*0.95), 600); this.contentPanel.setLayout(new FitLayout()); initWidget(this.contentPanel); SimpleComboBox<String> combo = new SimpleComboBox<String>(); combo.setEmptyText("Select a topic..."); combo.add("String1"); combo.add("String2"); this.contentPanel.add(combo); ComboBox combo1 = new ComboBox(); combo1.setEmptyText("Select a topic..."); ListStore topics = new ListStore(); topics.add("String3"); topics.add("String4"); combo.setStore(topics); this.contentPanel.add(combo1); When these are loaded in the browser (IE 8.0, Firefox 3.6.6 or Chrome 10.0) the combo boxes are shown but don't have the pull down arrow. They look like a text field with the "Select a topic..." text. When you select the text it disappears and if you type a character and then delete it the options are shown (i.e. pull down is invoked) however, there is still no pull down arrow. Does anyone know what the issue might be? Or how I can investigate further? Is it possible to see the actual HTML the browser is getting, when I View Page Source I only get the landing page HTML. As an additional I also have a import com.google.gwt.user.client.ui.Grid that does not render correctly. It is in table format but has no grid lines or header bar etc. Cheers, James

    Read the article

  • setting url in yaml file for google app engin (page not found) problem

    - by mswallace
    I am new to python and I am super excited to learn. I am building my first app on app engin and I am not totally understanding why my yaml file is not resolving to the url that I set up. here is the code handlers: - url: .* script: main.py - url: /letmein/.* script: letmein.py so if I go to http://localhost:8080/letmein/ I get a link is brooken or page not found error. here is the python code that I have in letmein.py from google.appengine.ext import webapp from google.appengine.ext.webapp import util class LetMeInHandler(webapp.RequestHandler): def get(self): self.response.out.write('letmein!') def main(): application = webapp.WSGIApplication([('/letmein/', LetMeInHandler)], debug=True) util.run_wsgi_app(application) if __name__ == '__main__': main() thanks in advance for the help!

    Read the article

< Previous Page | 165 166 167 168 169 170 171 172 173 174 175 176  | Next Page >