Search Results

Search found 18092 results on 724 pages for 'matt long'.

Page 17/724 | < Previous Page | 13 14 15 16 17 18 19 20 21 22 23 24  | Next Page >

• Huge excel sheet taking too long to update links or calculate formulae

  - by user7231

  I have Excel sheet with 5000 rows and columns till AY (size 12MB). Except for the first 6 columns, rest contain either vlookups or formulae. All the vlookups are in separate Excel sheet. I have changed the Excel setting to manually update the links and calculate formulae. Now everytime I try to update the links, either the Excel sheet hangs or it takes something like 15 minutes. Any ideas on how I can get it done quickly.

  Read the article

• Windows Phone 7 Emulator is very long to load

  - by Frederick Marcoux

  I have the Windows Phone 7.1 SDK on my computer with Visual Studio 2010 Ultimate. I have developped an application but when I want to start it in emulator, it takes about 2 hours to load it, and it's just the O/S! The application isn't started! Is there a way to view the Task Managerof Windows Phone to know why it doesn't load? Specs: Intel Core 2 Duo 3.0Ghz VT-x 2GB of DDR2 RAM (800Mhz) Windows 7 Professionnal SP1 64-bit

  Read the article

• Tape vs SSDs backups regarding long-term storage reliability

  - by user66131

  My question is very specifically about solid state drives, not regular hard drives. I would like to put in place a grandfather-father-son backup scheme, with the SSDs being used for the grandfather and father portions, and the yearly grandfather would be locked in a safe offsite for maybe 5-10 years. Can I expect that after this period of time the data would be preserved as well as it would be on a tape?

  Read the article

• Moving folders take long in windows 7

  - by acidzombie24

  What can i do to fix this? maybe drop permission properties? maybe not. I have a large folder with 100k files. I moved it into my archive folder and its taking forever to move. Why is that? I know on XP it takes <1sec but not on windows 7. I am sure its a permission thing, is there a way i can disable it and make it faster?

  Read the article

• HP Laptop recognizes hard drive just long enough to install windows

  - by Joe

  I have an HP laptop, DV6500 (CTO). It refused to boot one day, so I ran some diagnostics (a friend lent me "Hirens Boot Disk", "UBCD" and "PC DR 6"). Everything passed, except for the hdd. I replaced the HDD with a used drive of unknown condition. Installed windows with no problems. Installed the wireless driver, tried to reboot ... no luck. So I went to Best Buy, bought a brand new Western Digital 320gb HDD. Put it in the machine, installed windows (vista home premium). Installed the wired networking driver. Tried to reboot. No luck. Put the first hdd back in the machine, reinstalled windows. Started to install some drivers, went to reboot, and the machine won't come back to life. Put the second hdd in the machine, rinse wash and repeat. I've replaced the memory, even though it passed diagnostics. Problem exists with both brand new memory, and old memory. The BIOS recognizes the hard drive. The computer freezes directly after the bios splash screen, and there is no hard drive activity light. I've tried two linux live distros (gentoo and ubuntu). Neither would run on this laptop, but will on a different HP laptop. UBCD and Hirens Boot Disk both ran, as did PC Doctor 6 which refuses to test anything (gets stuck at "enumerating hard disks"). Is there anything else I can try?

  Read the article

• Dir and Findstr commands taking a long time to complete in Batch File

  - by user2405934

  dir %DRIVE_NAME%: /S /C /A-D /Q /T:C | findstr ".zip$ .doc$ .xls$ .xpt$ .cpt$ .cpo$ .xlsx$ .pdf$ .dat$ .txt$ .docx$ .csv$" >> file.info I am using above command to list all information in file, as below: 03/27/2013 01:02 PM 86,280 uusr\fr02 h123_frf67_rk_20140327.txt 03/27/2013 01:02 PM 5,513 usr\fr02 h123_frf67_rk_20140328.txt %DRIVE_NAME%: is mapped drive. Folders will be the same; not more than 100 folders and their sub-folders, and there will only be 2 or 3 files at time in any one of the folders. Now the issues is that for one folder it works perfect, but for 80 to 90 folders it is taking too much time. I think it's because of findstr and the different extensions used. Is there any way to make it faster?

  Read the article

• How long does it take for a server to get 'off greylisting'

  - by Michael

  Hi all, I asked a question regarding email delays a few months ago, and I think I found a workaround. I changed our email from "[email protected]" to "[email protected]", and it seems to work instantly again. After reading some articles, I believe this could be due to some form of greylisting, though some servers might call it something else -- if a server like yahoo or gmail receive email from a server that it is not used to receiving email from, then sometimes the delay occurs. But a name such as yahoo, gmail, which requires a user to sign up manually -- this delay can be avoided. My question is this: does anyone know more about this issue -- especially since it would be nice to send an email from our own site, instead of needing to use a whitelisted server? Thanks!

  Read the article

• Network folder image thumbnails taking long time to load

  - by Steve

  Our internal network folder can take up to 5 seconds to generate a thumbnail for each photo in a network folder. Usually, only 10% of thumbnails actually display; the rest are default jpg icons. A thumbs.db file already exists inside this folder, so presumably the thumbnails have been generated before. Why do they have to be generated again? The PC is Win7 64-bit. The server is Windows 2003 Server SP2.

  Read the article

• Web server freezing or taking too long to load page sometimes

  - by Samer

  This is happens once in a while, but sometimes when I try to load a web page from my server it just freezes there for a minute trying to load it. I'm not sure what's causing the issue, or have been able to recreate it. My guess is that one of the softwares I listed below is freezing or something. What are some techniques I can use to troubleshoot the situation? Specs: nginx php-fpm php5.5 freebsd 9.1

  Read the article

• Squid closing the connection on long HTTP GET requests

  - by Rhys

  When running a database query on a specific external site we use, Squid seems to cut off the connection after a consistent period of time (just over a minute). The query is submitted through a standard web form is that uses GET to query their database. Firefox 3 just displays a blank page. Internet Explorer throws a 'Page Cannot Be Displayed' error (tested in v6 and v8). When we perform the same query on the same machine, but bypass the Squid proxy, it works fine. The query takes about two and a half minutes to complete. There are a few timeout settings in Squid, but I honestly don't know what one to be looking at. Any possible solutions would be much appreciated. Cheers

  Read the article

• sed or grep or awk to match very very long lines

  - by yael

  more file param1=" 1,deerfntjefnerjfntrjgntrjnvgrvgrtbvggfrjbntr*rfr4fv*frfftrjgtrignmtignmtyightygjn 2,3,4,5,6,7,8, rfcmckmfdkckemdio8u548384omxc,mor0ckofcmineucfhcbdjcnedjcnywedpeodl40fcrcmkedmrikmckffmcrffmrfrifmtrifmrifvysdfn" need to match the content of $param1 in the file but its not work for example sed -n "/$param1/p" file or any grep $param1 file etc... any other solutions? maybe with perl?

  Read the article

• Windows 7 extremely long startup

  - by Tyler

  Windows 7 before it even gets to login. On the "starting windows" splash screen takes no less than 15 minutes to finish more like 25 minutes most times. During this time the hard drive activity led indicator is blinking maybe once every 20 seconds. When I finally get to the desktop everything runs normally. I have unplugged all peripherals with same result. Ideas? It's 32bit. 4gig memory. Fast CPU which I can't recall off the top of my head.

  Read the article

• It takes a long time until windows xp recognize I connected USB diks

  - by Pavol G

  Hello IT guys, I have a problem with my new USB disk. When I connect it to my laptop with Windows XP SP2 it takes about 4-5min until Windows recognized it and show it as a new disk. I can also see (disk's LED is blinking) that something is scaning the disk when I connect it, when this is done Windows imediately recognize it. Also when I'm copying data to this disk the speed is about 3.5MB/sec. It's connected using USB2.0. I tried to check for spyware (using spybot), also run windows in safe mode. But still have the same problems. Do you have any idea what could help to solve this problem? On Windows Vista (another laptop) everything is ok, disk loads in about 15sec and speed is about 20-30MB/sec. Thanks a lot for every advice!

  Read the article

• How long would this file transfer take?

  - by CT

  I have 12 hours to backup 2 TB of data. I would like to backup to a network share to a computer using consumer WD 2TB Black 7200rpm hard drives. Gigabit Ethernet. What other variables would I need to consider to see if this is feasible? How would I set up this calculation?

  Read the article

• Windows takes a very long time to shut down even in safe mode

  - by user1526247

  On Windows 7 the computer freezes for about 5 minutes once it gets to "Shutting down...". I can't remember when it started happening. I just lived with it for a while. The first thing I tried was a full scan using Microsoft Security Essentials. This did not solve the problem. I then went into msconfig and turned off everything I could get away with in the startup and services tabs. This did not solve the problem. I then uninstalled every program on this computer save the most basic programs. This did not solve the problem (did not uninstall drivers or catalyst). I then went through and turned off every single service and did a reboot. This did not solve the problem. I then booted into safe mode and just tried shutting it down. The problem even happens in safe mode. I have tried examining the event logs but with no success. They just say things like "blah blah has entered the stopped state" with no real clues about what program is causing me all this grief. *it may be worth noting that Ubuntu is installed on the same computer and the ubuntu boot loader is the one being used.

  Read the article

• "ssh root@server" hangs indefinitely long

  - by Thibaut

  Hi, Sometimes my ssh client will take forever to login. This happens when the server is not responding (overloaded, killed processed, ...). My automated scripts will then fail because the ssh process will never exit. Is there a ssh configuration value to set a timeout in order to fail if ssh can't login after a predefined number of seconds? I know there are knobs on the server side, but I have to set this on the client side as the sshd process is not responding, or responding incorrectly. Thanks!

  Read the article

• Long term system health monitor

  - by user30336

  As an experienced user, I sometimes notice that things are not going well with my computer. For example, my backup drive recently started cycling up and down, so I guessed it was probably dying, and replaced it. I detected this with my ears. Windows did not seem to notice or care. There ought to be software that monitors overall system health by keeping track of things like this, so that unusual events or increasing error rates will not be shrugged off. Among other things: disk errors that are recovered, corrupt network packets (at above the baseline expected rate) and crashes of trusted programs are early warnings. Is there any software that tries to use this kind of monitoring to warn of impending trouble?

  Read the article

• Determine the State given a Lat/Long using Google API in android

  - by user244190

  Is there a way to determine the State in which a given Lat/Long resides using the Google Api in Android? thx

  Read the article

• Packing a long binary integer in Ruby

  - by user1056142

  I'm trying to send a very long binary integer over UDP (on the order of 200 bits). When I try to use Array's pack method, it complains the string I'm trying to convert is too large. Am I going about this the wrong way? ruby-1.8.7-p352 :003 > [0b1101001010101101111010100101010011010101010110010101010101010010010101001010101010101011101010101010101111010101010101010101].pack('i') RangeError: bignum too big to convert into `unsigned long' from (irb):3:in `pack' from (irb):3 This number is supposed to represent a DNS query packet (this is for a homework assignment; we're not allowed to use any DNS libraries).

  Read the article

• retreving long text (CLOB) using CFQuery

  - by CFUser

  I am using CFQuery to retrieve the CLOB field from Oracle DB. If the CLOB filed contains the Data less than ~ 8000, then I can see retrieved the value ( the o/p), however If the value in CLOB field size is more than 8000 chars, then its not retrieving the value. in <cfdump> i can see the query retrieved as 'empty String' though the value exists in Oracle DB. I am using the Oracle Driver in CFadim console enabled 'Enable long text retrieval (CLOB).' and 'Enable binary large object retrieval (BLOB). ' set 'Long Text Buffer (chr)' and 'Blob Buffer(bytes) ' values to 6400000 any suggestions to retrieve the full text?

  Read the article

• ASP.NET Lifecycle and long process

  - by user204588

  Hello, I know we need a better solution but we need to get this done this way for right now. We have a long import process that's fired when you click start import button on a aspx web page. It takes a long time..sometimes several hours. I changed the timeout and that's fine but I keep getting a connection server reset error after about an hour. I'm thinking it's the asp.net lifecycle and I'd like to know if there are settings in IIS I can change to make this lifecycle last longer.

  Read the article

• PHP: why uniqid returned value is only 13 digits long

  - by Marco Demaio

  uniqid() function returns a 13 digits long hexadecimal number. According to the spec in php.net site, the function uses microtime to generate the unique value. But microtime returns numbers in string format as the following one: "0.70352700 12689396875" which are basically the microseconds and the seconds elapsed since 1970. This is a 9+11 digits decimal number. Converting a 20 decimal number into hex would result in a 16 digits hexadecimal NOT a 13 digits one. I also thought to take out the "0." part that seem to never change, and the last two digits of the microsec part that seem to remain always "00". Doing this the decimal number would be only 9+11-3 digits long, but still a decimal number of 17 digits when converted into hex would result in 14 digits hexadecimal number NOT 13. You probably think I'm crazy in asking such a thing, but I'm concerned about using uniqid, unique values are important to be unique, a duplicated value could screw up an entire application.

  Read the article

• Need an ASP.NET MVC long running process with user feedback

  - by Jason

  I've been trying to create a controller in my project for delivering what could turn out to be quite complex reports. As a result they can take a relatively long time and a progress bar would certainly help users to know that things are progressing. The report will be kicked off via an AJAX request, with the idea being that periodic JSON requests will get the status and update the progress bar. I've been experimenting with the AsyncController as that seems to be a nice way of running long processes without tying up resources, but it doesn't appear to give me any way of checking on the progress (and seems to block further JSON requests and I haven't discovered why yet). After that I've tried resorting to storing progress in a static variable on the controller and reading the status from that - but to be honest that all seems a bit hacky! All suggestions gratefully accepted!

  Read the article

• WPF: isolated storage file path too long

  - by user342961

  Hi, I'm deploying my WPF app with ClickOnce. When developing locally in Visual Studio, I store files in the isolated storage by calling IsolatedStorageFile.GetUserStoreForDomain(). This works just fine and the generated path is C:\Users\Frederik\AppData\Local\IsolatedStorage\phqduaro.crw\hux3pljr.cnx\StrongName.kkulk3wafjkvclxpwvxmpvslqqwckuh0\Publisher.ui0lr4tpq53mz2v2c0uqx21xze0w22gq\Files\FilerefData\-581750116 (189 chars) But when I deploy my app with ClickOnce, the generated path becomes too long, resulting in a DirectoryNotFoundException when creating the isolated storage directory. The generated path with ClickOnce is: C:\Users\Frederik\AppData\Local\Apps\2.0\Data\OQ0LNXJT.R5V\8539ABHC.ODN\exqu..tion_e07264ceafd7486e_0001.0000_b8f01b38216164a0\Data\StrongName.wy0cojdd3mpvq45404l3gxdklugoanvi\Publisher.ui0lr4tpq53mz2v2c0uqx21xze0w22gq\Files\FilerefData\-581750116 (247 chars) When I browse the folders all but the last directory of the path exists. Then when trying to create a folder at this location windows tells me I can't create a directory because the resulting path name will be too long. How can I shorten the path generated by the IsolatedStorage?

  Read the article

• Prefilling large volumes of body text in GMAIL compose getting a Request URI too long error

  - by Ali

  Hi guys this is a followup from the question: http://stackoverflow.com/questions/2583928/prefilling-gmail-compose-screen-with-html-text Where I was building a google apps application - I can call a gmail compose message page from my application using the url: https://mail.google.com/a/domain/?view=cm&fs=1&tf=1&source=mailto&to=WHOEVER%40COMPANY.COM&su=SUBJECTHERE&cc=WHOEVER%40COMPANY.COM&bcc=WHOEVER%40COMPANY.COM&body=PREPOPULATEDBODY However when I try to pass in the body parameter a very long line of text eg as a reply message body I get this error from GMAIL stating the REQUEST URI is too long. Is there a better way to do this as in a way to fillin the text body box of gmail compose section. Or some way to open the page and have it prefilled with javascript some how...

  Read the article

< Previous Page | 13 14 15 16 17 18 19 20 21 22 23 24  | Next Page >