Search Results

Search found 22671 results on 907 pages for 'multiple choice'.

Page 171/907 | < Previous Page | 167 168 169 170 171 172 173 174 175 176 177 178  | Next Page >

• NoMethodError Rails multiple file uploads

  - by Danny McClelland

  Hi Everyone, I am working on getting multiple file uploads working for an model in my application, I have included the code below: delivers_controller.rb # POST /delivers def create @deliver = Deliver.new(params[:deliver]) process_file_uploads(@deliver) if @deliver.save flash[:notice] = 'Task was successfully created.' redirect_to(@deliver) else render :action => "new" end end protected def process_file_uploads(deliver) i = 0 while params[:attachment]['file_'+i.to_s] != "" && !params[:attachment]['file_'+i.to_s].nil? deliver.assets.build(:data => params[:attachment]['file_'+i.to_s]) i += 1 end end deliver.rb has_many :assets, :as => :attachable, :dependent => :destroy validate :validate_attachments Max_Attachments = 5 Max_Attachment_Size = 5.megabyte def validate_attachments errors.add_to_base("Too many attachments - maximum is #{Max_Attachments}") if assets.length > Max_Attachments assets.each {|a| errors.add_to_base("#{a.name} is over #{Max_Attachment_Size/1.megabyte}MB") if a.file_size > Max_Attachment_Size} end assets_controller.rb class AssetsController < ApplicationController def show asset = Asset.find(params[:id]) # do security check here send_file asset.data.path, :type => asset.data_content_type end def destroy asset = Asset.find(params[:id]) @asset_id = asset.id.to_s @allowed = Deliver::Max_Attachments - asset.attachable.assets.count asset.destroy end end asset.rb class Asset < ActiveRecord::Base has_attached_file :data, belongs_to :attachable, :polymorphic => true def url(*args) data.url(*args) end def name data_file_name end def content_type data_content_type end def file_size data_file_size end end Whenever I create a new deliver item and try to attach any files I get the following error: NoMethodError in DeliversController#create You have a nil object when you didn't expect it! You might have expected an instance of ActiveRecord::Base. The error occurred while evaluating nil.[] /Users/danny/Dropbox/SVN/railsapps/macandco/surveymanager/trunk/app/controllers/delivers_controller.rb:60:in `process_file_uploads' /Users/danny/Dropbox/SVN/railsapps/macandco/surveymanager/trunk/app/controllers/delivers_controller.rb:46:in `create' new.html.erb (Deliver view) <% content_for :header do -%> Deliver Repositories <% end -%> <% form_for(@deliver, :html => { :multipart => true }) do |f| %> <%= f.error_messages %> <p> <%= f.label :caseref %><br /> <%= f.text_field :caseref %> </p> <p> <%= f.label :casesubject %><br /> <%= f.text_area :casesubject %> </p> <p> <%= f.label :description %><br /> <%= f.text_area :description %> </p> <p>Pending Attachments: (Max of <%= Deliver::Max_Attachments %> each under <%= Deliver::Max_Attachment_Size/1.megabyte%>MB) <% if @deliver.assets.count >= Deliver::Max_Attachments %> <input id="newfile_data" type="file" disabled /> <% else %> <input id="newfile_data" type="file" /> <% end %> <div id="attachment_list"><ul id="pending_files"></ul></div> </p> <p> <%= f.submit 'Create' %> </p> <% end %> <%= link_to 'Back', delivers_path %> Show.html.erb (Delivers view) <% content_for :header do -%> Deliver Repositories <% end -%> <p> <b>Title:</b> <%=h @deliver.caseref %> </p> <p> <b>Body:</b> <%=h @deliver.casesubject %> </p> <p><b>Attached Files:</b><div id="attachment_list"><%= render :partial => "attachment", :collection => @deliver.assets %></div></p> <%= link_to 'Edit', edit_deliver_path(@deliver) %> | <%= link_to 'Back', deliver_path %> <%- if logged_in? %> <%= link_to 'Edit', edit_deliver_path(@deliver) %> | <%= link_to 'Back', delivers_path %> <% end %> _attachment.html.erb (Delivers view) <% if !attachment.id.nil? %><li id='attachment_<%=attachment.id %>'><a href='<%=attachment.url %>'><%=attachment.name %></a> (<%=attachment.file_size/1.kilobyte %>KB) <%= link_to_remote "Remove", :url => asset_path(:id => attachment), :method => :delete, :html => { :title => "Remove this attachment", :id => "remove" } %></li> <% end %> I have been banging my head against the wall with the error all day, if anyone can shed some light on it, I would be eternally grateful! Thanks, Danny

  Read the article

• How to publish multiple jar files to maven on a clean install

  - by Abhijit Hukkeri

  I have a used the maven assembly plugin to create multiple jar from one jar now the problem is that I have to publish these jar to the local repo, just like other maven jars publish by them self when they are built maven clean install how will I be able to do this here is my pom file <project> <parent> <groupId>parent.common.bundles</groupId> <version>1.0</version> <artifactId>child-bundle</artifactId> </parent> <modelVersion>4.0.0</modelVersion> <groupId>common.dataobject</groupId> <artifactId>common-dataobject</artifactId> <packaging>jar</packaging> <name>common-dataobject</name> <version>1.0</version> <dependencies> </dependencies> <build> <plugins> <plugin> <groupId>org.jibx</groupId> <artifactId>maven-jibx-plugin</artifactId> <version>1.2.1</version> <configuration> <directory>src/main/resources/jibx_mapping</directory> <includes> <includes>binding.xml</includes> </includes> <verbose>false</verbose> </configuration> <executions> <execution> <goals> <goal>bind</goal> </goals> </execution> </executions> </plugin> <plugin> <artifactId>maven-assembly-plugin</artifactId> <executions> <execution> <id>make-business-assembly</id> <phase>package</phase> <goals> <goal>single</goal> </goals> <configuration> <appendAssemblyId>false</appendAssemblyId> <finalName>flight-dto</finalName> <descriptors> <descriptor>src/main/assembly/car-assembly.xml</descriptor> </descriptors> <attach>true</attach> </configuration> </execution> <execution> <id>make-gui-assembly</id> <phase>package</phase> <goals> <goal>single</goal> </goals> <configuration> <appendAssemblyId>false</appendAssemblyId> <finalName>app_gui</finalName> <descriptors> <descriptor>src/main/assembly/bike-assembly.xml</descriptor> </descriptors> <attach>true</attach> </configuration> </execution> </executions> </plugin> </plugins> </build> </project> Here is my assembly file <assembly> <id>app_business</id> <formats> <format>jar</format> </formats> <baseDirectory>target</baseDirectory> <includeBaseDirectory>false</includeBaseDirectory> <fileSets> <fileSet> <directory>${project.build.outputDirectory}</directory> <outputDirectory></outputDirectory> <includes> <include>com/dataobjects/**</include> </includes> </fileSet> </fileSets> </assembly>

  Read the article

• Searching a set of data with multiple terms using Linq

  - by Cj Anderson

  I'm in the process of moving from ADO.NET to Linq. The application is a directory search program to look people up. The users are allowed to type the search criteria into a single textbox. They can separate each term with a space, or wrap a phrase in quotes such as "park place" to indicate that it is one term. Behind the scenes the data comes from a XML file that has about 90,000 records in it and is about 65 megs. I load the data into a DataTable and then use the .Select method with a SQL query to perform the searches. The query I pass is built from the search terms the user passed. I split the string from the textbox into an array using a regular expression that will split everything into a separate element that has a space in it. However if there are quotes around a phrase, that becomes it's own element in the array. I then end up with a single dimension array with x number of elements, which I iterate over to build a long query. I then build the search expression below: query = query & _ "((userid LIKE '" & tempstr & "%') OR " & _ "(nickname LIKE '" & tempstr & "%') OR " & _ "(lastname LIKE '" & tempstr & "%') OR " & _ "(firstname LIKE '" & tempstr & "%') OR " & _ "(department LIKE '" & tempstr & "%') OR " & _ "(telephoneNumber LIKE '" & tempstr & "%') OR " & _ "(email LIKE '" & tempstr & "%') OR " & _ "(Office LIKE '" & tempstr & "%'))" Each term will have a set of the above query. If there is more than one term, I put an AND in between, and build another query like above with the next term. I'm not sure how to do this in Linq. So far, I've got the XML file loading correctly. I'm able to search it with specific criteria, but I'm not sure how to best implement the search over multiple terms. 'this works but far too simple to get the job done Dim results = From c In m_DataSet...<Users> _ Where c.<userid>.Value = "XXXX" _ Select c The above code also doesn't use the LIKE operator either. So partial matches don't work. It looks like what I'd want to use is the .Startswith but that appears to be only in Linq2SQL. Any guidance would be appreciated. I'm new to Linq, so I might be missing a simple way to do this. The XML file looks like so: <?xml version="1.0" standalone="yes"?> <theusers> <Users> <userid>person1</userid> <nickname></nickname> <lastname></lastname> <firstname></firstname> <department></department> <telephoneNumber></telephoneNumber> <email></email> </Users> <Users> <userid>person2</userid> <nickname></nickname> <lastname></lastname> <firstname></firstname> <department></department> <telephoneNumber></telephoneNumber> <email></email> </Users>

  Read the article

• Multiple schema validation in Java

  - by user279554

  Hi, I am trying to do multiple schema validation in Java. I don't understand where I am doing wrong. Any help will be appreciated. abc.xsd <?xml version="1.0" encoding="UTF-8"?> <xsd:schema xmlns:xsd="http://www.w3.org/2001/XMLSchema" xmlns:xn="project-xml-r4j_another.xsd"> <xsd:import namespace="project-xml-r4j_another.xsd"/> <xsd:element name="abc" type="abc"> </xsd:element> <xsd:complexType name="abc"> <xsd:sequence> <xsd:element name="test" type="test" minOccurs="0" maxOccurs="1"> </xsd:element> <!--<xsd:element name="proj" type="xn:proj"/>--> </xsd:sequence> <xsd:attribute name="id" type="xsd:ID" use="required"/> </xsd:complexType> <xsd:complexType name="test"> <xsd:attribute name="id" type="xsd:ID" use="required"></xsd:attribute> <xsd:attribute name="value" use="required"> <xsd:simpleType> <xsd:restriction base="xsd:string"> <xsd:maxLength value="100" /> </xsd:restriction> </xsd:simpleType> </xsd:attribute> </xsd:complexType> </xsd:schema> project-xml-r4j_another.xsd <?xml version="1.0" encoding="UTF-8"?> <xsd:schema xmlns:xsd="http://www.w3.org/2001/XMLSchema" targetNamespace="project-xml-r4j_another.xsd" xmlns="project-xml-r4j_another.xsd" elementFormDefault="qualified" attributeFormDefault="unqualified"> <xsd:element name="proj" type="proj"> <xsd:annotation> <xsd:documentation> The project is the root tag of a project-xml. </xsd:documentation> </xsd:annotation> </xsd:element> <xsd:complexType name="proj"> <xsd:attribute name="id" type="xsd:ID" use="required"/> </xsd:complexType> </xsd:schema> Test case package test; import java.io.File; import java.io.IOException; import javax.xml.XMLConstants; import javax.xml.transform.Source; import javax.xml.transform.stream.StreamSource; import javax.xml.validation.Schema; import javax.xml.validation.SchemaFactory; import javax.xml.validation.Validator; import org.apache.log4j.Logger; import org.junit.Test; import org.xml.sax.SAXException; import org.xml.sax.SAXParseException; import org.xml.sax.helpers.DefaultHandler; import com.ericsson.ccrtool.core.project.projectxml.InvalidProjectXmlException; public class TestSchema { private static final Logger logger = Logger.getLogger(TestSchema.class); static final String W3C_XML_SCHEMA = XMLConstants.W3C_XML_SCHEMA_NS_URI; @Test public void test() { System.out.println("TestSchema.test()"); try { SchemaFactory schemaFactory = SchemaFactory.newInstance(W3C_XML_SCHEMA); // create a grammar object. Source [] source = { new StreamSource(new File("C:\\jaydeep\\Ericsson\\R5B\\abc.xsd")), new StreamSource(new File("C:\\jaydeep\\Ericsson\\R5B\\project-xml-r4j.xsd"))}; Schema schemaGrammar = schemaFactory.newSchema(source); Validator schemaValidator = schemaGrammar.newValidator(); schemaValidator.setErrorHandler(new MessageHandler()); // validate xml instance against the grammar. schemaValidator.validate(new StreamSource("C:\\jaydeep\\Ericsson\\R5B\\project_tmmk17cells_xnaveen_project-xml.xml")); } catch (SAXException e) { throw new InvalidProjectXmlException("Project-xml validation failed, Exception: " + e.getMessage(), e); } catch (IOException e) { throw new InvalidProjectXmlException("Project-xml validation failed, Exception: " + e.getMessage(), e); } } class MessageHandler extends DefaultHandler { private String errMessage = ""; @Override public void warning(SAXParseException e) { logger.info("Warning Line " + e.getLineNumber() + ": " + e.getMessage()); } @Override public void error(SAXParseException e) { errMessage = new String("Error Line " + e.getLineNumber() + ": " + e.getMessage()); logger.info(errMessage); throw new InvalidProjectXmlException("Project-xml validation failed, Exception: " + errMessage); } @Override public void fatalError(SAXParseException e) { errMessage = new String("Error Line " + e.getLineNumber() + ": " + e.getMessage()); logger.info(errMessage); throw new InvalidProjectXmlException("Project-xml validation failed, Exception: " + errMessage); } } } Thanks, Jaydeep

  Read the article

• Parse a text file into multiple text file

  - by Vijay Kumar Singh

  I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

  Read the article

• Android Multiple objects in SimpleAdapter

  - by Adam Sherratt

  I have a need (unless you can think of a better way) of passing multiple objects to a custom list adapter. I know that I'm barking up the wrong tree here, and would appreciate someone setting me on the right course! Thanks playlistadapter = new MyPlaylistAdapter(MyApplication.getAppContext(), songsList, retained_songsList, folderMode, R.layout.file_view, new String[] { "songTitle","songAlbum", "songPath" }, new int[] { R.id.checkTextView, R.id.text2, R.id.text3 }); And my adapter class: public class MyPlaylistAdapter extends SimpleAdapter{ private ArrayList <Song> songsList = new ArrayList<Song>(); private ArrayList <Song> retained_songsList = new ArrayList<Song>(); private ArrayList<Song> playlistcheck = new ArrayList<Song>(); private String folderMode; private String TAG = "AndroidMediaCenter"; public MyPlaylistAdapter(Context context,List<Song> SongsList, List<Song> Retained_songsList, String FolderMode,int resource, String[] from, int[] to) { super(context, null, resource, from, to); songsList.clear(); songsList.addAll(SongsList); Log.i(TAG, "MyPlayListAdapter Songslist = " + songsList.size()); retained_songsList.clear(); retained_songsList.addAll(Retained_songsList); folderMode = FolderMode; } public View getView(int position, View convertView, ViewGroup parent) { //PlayListViewHolder holder; CheckedTextView checkTextView; TextView text2; TextView text3; if (convertView == null) { LayoutInflater inflater = (LayoutInflater) MyApplication.getAppContext().getSystemService(Context.LAYOUT_INFLATER_SERVICE); //LayoutInflater inflater=getLayoutInflater(); convertView=inflater.inflate(R.layout.file_view, parent, false); //convertView.setBackgroundColor(0xFF00FF00 ); //holder = new PlayListViewHolder(); checkTextView = (CheckedTextView) convertView.findViewById(R.id.checkTextView); text2 = (TextView) convertView.findViewById(R.id.text2); text3 = (TextView) convertView.findViewById(R.id.text3); //convertView.setTag(holder); } else { //holder = (PlayListViewHolder) convertView.getTag(); } //put something into textviews String tracks = null; String tracks_Details = null; String trackspath = null; tracks = songsList.get(position).getSongTitle(); tracks_Details = songsList.get(position).getAlbum() + " (" + songsList.get(position).getArtist() + ")"; trackspath = songsList.get(position).getSongPath(); checkTextView = (CheckedTextView) convertView.findViewById(R.id.checkTextView); text2 = (TextView) convertView.findViewById(R.id.text2); text3 = (TextView) convertView.findViewById(R.id.text3); checkTextView.setText(tracks); if(folderMode.equals("Playlists")){ checkTextView.setBackgroundColor(Color.GREEN); checkTextView.setChecked(false); try { int listsize_rs = retained_songsList.size(); for (int j = 0; j<listsize_rs;j++){ if((retained_songsList.get(j).getSongPath()).equals(songsList.get(position).getSongPath())){ checkTextView.setBackgroundColor(Color.TRANSPARENT); //Need to check here whether the checkedtextview is ticked or not checkTextView.setChecked(true); playlistcheck.add(songsList.get(position)); break; } } } catch (Exception e) { e.printStackTrace(); } }else { //Need to check here whether the checkedtextview is ticked or not try { if (songsList.get(position).getSongCheckedStatus()==true){ checkTextView.setChecked(true); }else{ checkTextView.setChecked(false); } } catch (Exception e) { e.printStackTrace(); } } text2.setText(tracks_Details); text3.setText(trackspath); Log.i(TAG, "MyPlayListAdapter Songslist = " + songsList.size()); return convertView; } } However, this doesn't inflate, throwing the following errors: 10-26 23:11:09.464: E/AndroidRuntime(2826): FATAL EXCEPTION: main 10-26 23:11:09.464: E/AndroidRuntime(2826): java.lang.RuntimeException: Error receiving broadcast Intent { act=android.intent.action.GetMusicComplete flg=0x10 } in com.Nmidia.AMC.MusicActivity$18@414c5770 10-26 23:11:09.464: E/AndroidRuntime(2826): at android.app.LoadedApk$ReceiverDispatcher$Args.run(LoadedApk.java:765) 10-26 23:11:09.464: E/AndroidRuntime(2826): at android.os.Handler.handleCallback(Handler.java:615) 10-26 23:11:09.464: E/AndroidRuntime(2826): at android.os.Handler.dispatchMessage(Handler.java:92) 10-26 23:11:09.464: E/AndroidRuntime(2826): at android.os.Looper.loop(Looper.java:137) 10-26 23:11:09.464: E/AndroidRuntime(2826): at android.app.ActivityThread.main(ActivityThread.java:4745) 10-26 23:11:09.464: E/AndroidRuntime(2826): at java.lang.reflect.Method.invokeNative(Native Method) 10-26 23:11:09.464: E/AndroidRuntime(2826): at java.lang.reflect.Method.invoke(Method.java:511) 10-26 23:11:09.464: E/AndroidRuntime(2826): at com.android.internal.os.ZygoteInit$MethodAndArgsCaller.run(ZygoteInit.java:786) 10-26 23:11:09.464: E/AndroidRuntime(2826): at com.android.internal.os.ZygoteInit.main(ZygoteInit.java:553) 10-26 23:11:09.464: E/AndroidRuntime(2826): at dalvik.system.NativeStart.main(Native Method) 10-26 23:11:09.464: E/AndroidRuntime(2826): Caused by: java.lang.NullPointerException 10-26 23:11:09.464: E/AndroidRuntime(2826): at android.widget.SimpleAdapter.getCount(SimpleAdapter.java:93) 10-26 23:11:09.464: E/AndroidRuntime(2826): at android.widget.ListView.setAdapter(ListView.java:460) 10-26 23:11:09.464: E/AndroidRuntime(2826): at com.Nmidia.AMC.MusicActivity.setFilterMusic(MusicActivity.java:1230) 10-26 23:11:09.464: E/AndroidRuntime(2826): at com.Nmidia.AMC.MusicActivity$18.onReceive(MusicActivity.java:996) 10-26 23:11:09.464: E/AndroidRuntime(2826): at android.app.LoadedApk$ReceiverDispatcher$Args.run(LoadedApk.java:755) 10-26 23:11:09.464: E/AndroidRuntime(2826): ... 9 more

  Read the article

• How can I use curl to login multiple users from one php script

  - by kamal

  Here is the scenario: I have configured multiple users with login names aa1, aa2 .. zz99 , all with the same password, now i want to login to a php based server with these login ID's. I have a working script that logs in one user with a username and password, and using curl, browses to a target page: // Assume php , since somehow the php encapsulation quotes were giving me trouble $sHost = $argv[2]; $sStart = $argv[3]; $sReqId = $argv[4]; $sPage = $argv[5]; $sReqLogFile = $argv[6]; $sRespLogFile = $argv[7]; $sUserName = $argv[8]; $sPassword = $argv[9]; $sExecDelay = $argv[10]; //optional args: if($argc 11) { $sCommonSID = $argv[11]; } //$sXhprofLogFile = ""; $sSysStatsLogFile= ""; $sBaseUrl = 'https://'.$sHost.'/'; $nExecTime = 0; $sCookieFileName = 'cookiejar/'.genRandomString().'.txt'; touch($sCookieFileName); // Set the execution delay: $sStart += $sExecDelay; // Get the PHP Session Id: if(isset($sCommonSID)) { $sSID = $sCommonSID; }else{ $sSID = getSID($sHost,$sBaseUrl, $sUserName, $sPassword); } // Sleep for 100us intervals until we reach the stated execution time: do { usleep(100); }while(getFullMicrotime()$sPage, "pageUrl"=$sBaseUrl, "execStart" =$nExecStart, "execEnd"=$nExecEnd, "respTime"=$nExecTime, "xhprofToken"=$sXhpToken, "xhprofLink"=$sXhpLink, "fiveMinLoad"=$nFiveMinLoad); }else{ $nExecStart = 0; $sUrl = "***ERROR***"; $aReturn = null; } writeReqLog($sReqId, $nExecStart, $sSID, $sUrl, $sReqLogFile); return $aReturn; } function getFullMicrotime() { $fMtime = microtime(true); if(strpos($fMtime, ' ') !== false) { list($nUsec, $nSec) = explode(' ', $fMtime); return $nSec + $nUsec; } return $fMtime; } function writeRespLog($nReqId, $sHost, $sPage, $sSID = "***ERROR***", $nExecStart = 0, $nExecEnd = 0, $nRespTime = 0, $sXhpToken = "", $sXhpLink = "", $nFiveMinLoad = 0, $sRespLogFile) { $sMsg = $nReqId; $sMsg .= "\t".$sHost; $sMsg .= "/".$sPage; $sMsg .= "\t".$sSID; $sMsg .= "\t".$nExecStart; $sMsg .= "\t".$nExecEnd; $sMsg .= "\t".$nRespTime; $sMsg .= "\t".$sXhpToken; $sMsg .= "\t".$nFiveMinLoad; error_log($sMsg."\n",3,$sRespLogFile); } function writeReqLog($nReqId, $nExecStart, $sSID, $sUrl, $sReqLogFile) { $sMsg = $nReqId; $sMsg .= "\t".$sUrl; $sMsg .= "\t".$sSID; $sMsg .= "\t".$nExecStart; error_log($sMsg."\n",3,$sReqLogFile); } function parseSIDValue($sText) { $sSID = ""; preg_match('/SID:(.*)/',$sText, $aSID); if (count($aSID)) { $sSID = $aSID[1]; } return $sSID; } function parseFiveMinLoad($sText) { $nLoad = 0; $aMatch = array(); preg_match('/--5-MIN-LOAD:(.*)--/',$sText, $aMatch); if (count($aMatch)) { $nLoad = $aMatch[1]; } return $nLoad; } function curlRequest($sUrl, $sSID="") { global $sCookieFileName; $ch = curl_init(); curl_setopt($ch, CURLOPT_URL, $sUrl); curl_setopt($ch, CURLOPT_SSL_VERIFYPEER, FALSE); curl_setopt($ch, CURLOPT_SSL_VERIFYHOST, 2); curl_setopt($ch, CURLOPT_HEADER, 1); curl_setopt($ch, CURLOPT_USERAGENT, "Mozilla/4.0 (compatible; MSIE 6.0; Windows NT 5.0)"); curl_setopt($ch, CURLOPT_RETURNTRANSFER,1); if($sSID == "") { curl_setopt($ch, CURLOPT_COOKIEJAR, $sCookieFileName); } else { curl_setopt($ch, CURLOPT_COOKIEFILE, $sCookieFileName); } $result =curl_exec ($ch); curl_close ($ch); return $result; } function parseXHProfToken($sPageContent) { //https://ktest.server.net/xhprof/xhprof_html/index.php?run=4d004b280a990&source=mybox $sToken = ""; $sRelLink = ""; $aMatch = array(); $aResp = array(); preg_match('/$sToken, "relLink"=$sRelLink); return $aResp; } function genRandomString() { $length = 10; $characters = '0123456789abcdefghijklmnopqrstuvwxyz'; $string = ''; for ($p = 0; $p

  Read the article

• Send mail to multiple recipient

  - by Ahmad Maslan

  Hi, i have already research on using the mail() to send to multiple recipient's but i just cant get it to work. What im trying to do is, for every order that i have, order 1,2,3, each having their own email addresses, when i change their order status from pending to confirm, the mail() will use that id to refer to the db table and send the email of those 3 orders. But for my case, it mailed just the latest order which is order 3. This is the form that i use to change the order status. <form action="results-action" method="post" enctype="multipart/form-data"> <fieldset> <table id ="table_id" class="display"> <thead> <tr><td><h2>Pending Order</h2></td></tr> <tr> <th scope="col">Order ID</th> <th scope="col"> </th> <th scope="col">Name</th> <th scope="col">Address</th> <th scope="col">Product Name</th> <th scope="col">Produt Quantity</th> <th scope="col">Price</th> <th scope="col">Order status</th> </tr> </thead> <tbody> <?php while ($row = mysqli_fetch_array($result)) { ?> <tr> <td><input type="text" value='<?=$row['virtuemart_order_id']?>' name="orderid" id="virtuemart_order_id"></td> <td><input type="hidden" value='<?=$row['virtuemart_product_id']?>' name="productid" id="virtuemart_product_id"></td> <td><?=$row['first_name']?></td> <td><?=$row['address_1']?></td> <td><?=$row['order_item_name']?></td> <td><?=$row['product_quantity']?></td> <td><?=$row['product_final_price'] ?></td> <td><select name='change[<?=$row['virtuemart_order_id']?>]'> <option value='C'> Confirmed</option> <option value='X'> Cancelled</option></select></td> </tr> <?php } ?> </tbody> </table> </fieldset> <fieldset> <table> <tr> <td><input type="submit" value="Update status" name="update status"> </td> </tr> </table> </fieldset> </form> This is the php, using the order id from the form to select the email addresses. <?php $orderid = $_POST['orderid']; // build SQL statement to select email addresses $query3 = "SELECT email from ruj3d_virtuemart_order_userinfos where virtuemart_order_id = '$orderid'"; // execute SQL statement $result3 = mysqli_query($link, $query3) or die(mysqli_error($link)); $subject = "Order confirmed by Home and decor"; $message = "Hello! This is a message to inform that your order has been confirmed"; $from = "[email protected]"; $headers = "From: $from"; while($row3 = mysqli_fetch_array($result3)){ $addresses[] = $row3['email']; } $to = implode(",", $addresses); mail($to, $subject, $message, $headers); ?>

  Read the article

• Changing multiple objects with a new class name using Jquery

  - by liquilife

  I'd like to click on a trigger and show a specific image. There are multiple triggers which would show a specific image related to it within a set. There are 4 sets The challenge for me is toggling the other images to hide only in this 'set' when one of these triggers are clicked, as there can only be one image showing at a time in each set. Here is the HTML I've put together thus far: <!-- Thumbnails which can be clicked on to toggle the larger preview image --> <div class="materials"> <a href="javascript:;" id="shirtgrey"><img src="/grey_shirt.png" height="122" width="122" /></a> <a href="javascript:;" id="shirtred"><img src="red_shirt.png" height="122" width="122" /></a> <a href="javascript:;" id="shirtblue"><img src="hblue_shirt.png" height="122" width="122" /></a> <a href="javascript:;" id="shirtgreen"><img src="green_shirt.png" height="122" width="122" /></a> </div> <div class="collars"> <a href="javascript:;" id="collargrey"><img src="grey_collar.png" height="122" width="122" /></a> <a href="javascript:;" id="collarred"><img src="red_collar.png" height="122" width="122" /></a> <a href="javascript:;" id="collarblue"><img src="blue_collar.png" height="122" width="122" /></a> <a href="javascript:;" id="collargreen"><img src="green_collar.png" height="122" width="122" /></a> </div> <div class="cuffs"> <a href="javascript:;" id="cuffgrey"><img src="grey_cuff.png" height="122" width="122" /></a> <a href="javascript:;" id="cuffred"><img src="red_cuff.png" height="122" width="122" /></a> <a href="javascript:;" id="cuffblue"><img src="blue_cuff.png" height="122" width="122" /></a> <a href="javascript:;" id="cuffgreen"><img src="/green_cuff.png" height="122" width="122" /></a> </div> <div class="pockets"> <a href="javascript:;" id="pocketgrey"><img src="grey_pocket.png" height="122" width="122" /></a> <a href="javascript:;" id="pocketred"><img src=".png" height="122" width="122" /></a> <a href="javascript:;" id="pocketblue"><img src="blue_pocket.png" height="122" width="122" /></a> <a href="javascript:;" id="pocketgreen"><img src="green_pocket.png" height="122" width="122" /></a> </div> <!-- The larger images where one from each set should be viewable at one time, triggered by the thumb clicked above --> <div class="selectionimg"> <div class="selectShirt"> <img src="grey_shirt.png" height="250" width="250" class="selectShirtGrey show" /> <img src="red_shirt.png" height="250" width="250" class="selectShirtRed hide" /> <img src="blue_shirt.png" height="250" width="250" class="selectShirtBlue hide" /> <img src="green_shirt.png" height="250" width="250" class="selectShirtGreen hide" /> </div> <div class="selectCollar"> <img src="grey_collar.png" height="250" width="250" class="selectCollarGrey show" /> <img src="red_collar.png" height="250" width="250" class="selectCollarRed hide" /> <img src="blue_collar.png" height="250" width="250" class="selectCollarBlue hide" /> <img src="green_collar.png" height="250" width="250" class="selectCollarGreen hide" /> </div> <div class="selectCuff"> <img src="grey_cuff.png" height="250" width="250" class="selectCuffGrey show" /> <img src="red_cuff.png" height="250" width="250" class="selectCuffRed hide" /> <img src="blue_cuff.png" height="250" width="250" class="selectCuffBlue hide" /> <img src="green_cuff.png" height="250" width="250" class="selectCuffGreen hide" /> </div> <div class="selectPocket"> <img src="grey_pocket.png" height="250" width="250" class="selectPocketGrey show" /> <img src="hred_pocket.png" height="250" width="250" class="selectPocketRed hide" /> <img src="blue_pocket.png" height="250" width="250" class="selectPocketBlue hide" /> <img src="green_pocket.png" height="250" width="250" class="selectPocketGreen hide" /> </div> </div> How can jQuery be used to change a class of an image to "show" and ensure that all other images in that same div are set to a class of "hide"? First time posting here. I'm very efficient with HTML and CSS and have a basic understanding of jQuery. I'm learning and this just seems a little bit beyond my abilities at the moment. I hope this all makes sense. Thanks for any help.

  Read the article

• Should I go along with my choice of web hosting company or still search?

  - by Devner

  Hi all, I have been searching for a good website hosting company that can offer me all the services that I need for hosting my PHP & MySQL based website. Now this is a community based website and users will be able to upload pictures, etc. The hosting company that I have in mind, currently lets me do everything... let me use mail(), supports CRON jobs, etc. Of course they are charging about $6/month. Now the only problem with this company is that they have a limit of 50,000 files that can exist within the hosting account at any time. This kind of contradicts their frontpage ad of "UNLIMITED SPACE" on their website. Apart from this, I know of no other reason why I should not go with this hosting company. But my issue is that 50,000 file limit is what I cannot live with, once the users increase in significant number and the files they upload, exceed 50,000 in number. Now since this is a dynamic website and also includes sensitive issues like payments, etc. I am not sure if I should go ahead with this company as I am just starting out and then later switch over to a better hosting company which does not limit me with 50,000 files. If I need to switch over once I host with this company, I will need to take backups of all the files located in my account (jpg, zip, etc.), then upload them to the new host. I am not aware of any tools that can help me in this process. Can you please mention if you know any? I can go ahead with the other companies right now, but their cost is double/triple of the current price and they all sport less features than my current choice. If I pay more, then they are ready to accommodate my higher demands. Unfortunately, the company that I am willing to go with now, does NOT have any other higher/better plans that I can switch to. So that's the really really bad part. So my question(s): Since I am starting out with my website and since the scope of users initially is going to be less/small, should I go ahead with the current choice and then once the demand increases, switch over to a better provider? If yes, how can I transfer my database, especially the jpg files, etc. to the new provider? I don't even know the tools required to backup and restore to another host. (I don't like this idea but still..) Should I go ahead and pay more right now and go with better providers (without knowing if the website is going to do really that well) just for saving myself the trouble of having to take a backup of the 50,000 files and upload to a new host from an old host and just start paying double/triple the price without even knowing if I would receive back the returns as I expected? Backup and Restore in such a bulky numbers is something that I have never done before and hence I am stuck here trying to decide what to do. The price per month is also a considerable factor in my decision. All these web hosting companies say one common thing: It is customers responsibility to backup and restore data and they are not liable for any loss. So no matter what hosting company that I would like to go with, they ask me to take backup via FTP so that I can restore them whenever I want (& it seems to be safer to have the files locally with me). Some are providing tools for backup and some are not and I am not sure how much their backup tools can be trusted considering the disclaimers they have. I have never backed-up and restored 50,000 files from one web host to another, so please, all you experienced people out there, leave your comments and let me know your suggestions so that I can decide. I have spent 2 days fighting with myself trying to decide what to do and finally concluded that this is a double-edged sword and I can't arrive at a satisfactory final decision without involving others suggestions. I believe that someone must be out there who may have had such troublesome decision to make. So all your suggestions to help me make my decision are appreciated. Thank you all.

  Read the article

• Error "Input length must be multiple of 8 when decrypting with padded cipher"

  - by Ross Peoples

  I am trying to move a project from C# to Java for a learning exercise. I am still very new to Java, but I have a TripleDES class in C# that encrypts strings and returns a string value of the encrypted byte array. Here is my C# code: using System; using System.IO; using System.Collections.Generic; using System.Security.Cryptography; using System.Text; namespace tDocc.Classes { /// <summary> /// Triple DES encryption class /// </summary> public static class TripleDES { private static byte[] key = { 110, 32, 73, 24, 125, 66, 75, 18, 79, 150, 211, 122, 213, 14, 156, 136, 171, 218, 119, 240, 81, 142, 23, 4 }; private static byte[] iv = { 25, 117, 68, 23, 99, 78, 231, 219 }; /// <summary> /// Encrypt a string to an encrypted byte array /// </summary> /// <param name="plainText">Text to encrypt</param> /// <returns>Encrypted byte array</returns> public static byte[] Encrypt(string plainText) { UTF8Encoding utf8encoder = new UTF8Encoding(); byte[] inputInBytes = utf8encoder.GetBytes(plainText); TripleDESCryptoServiceProvider tdesProvider = new TripleDESCryptoServiceProvider(); ICryptoTransform cryptoTransform = tdesProvider.CreateEncryptor(key, iv); MemoryStream encryptedStream = new MemoryStream(); CryptoStream cryptStream = new CryptoStream(encryptedStream, cryptoTransform, CryptoStreamMode.Write); cryptStream.Write(inputInBytes, 0, inputInBytes.Length); cryptStream.FlushFinalBlock(); encryptedStream.Position = 0; byte[] result = new byte[encryptedStream.Length]; encryptedStream.Read(result, 0, (int)encryptedStream.Length); cryptStream.Close(); return result; } /// <summary> /// Decrypt a byte array to a string /// </summary> /// <param name="inputInBytes">Encrypted byte array</param> /// <returns>Decrypted string</returns> public static string Decrypt(byte[] inputInBytes) { UTF8Encoding utf8encoder = new UTF8Encoding(); TripleDESCryptoServiceProvider tdesProvider = new TripleDESCryptoServiceProvider(); ICryptoTransform cryptoTransform = tdesProvider.CreateDecryptor(key, iv); MemoryStream decryptedStream = new MemoryStream(); CryptoStream cryptStream = new CryptoStream(decryptedStream, cryptoTransform, CryptoStreamMode.Write); cryptStream.Write(inputInBytes, 0, inputInBytes.Length); cryptStream.FlushFinalBlock(); decryptedStream.Position = 0; byte[] result = new byte[decryptedStream.Length]; decryptedStream.Read(result, 0, (int)decryptedStream.Length); cryptStream.Close(); UTF8Encoding myutf = new UTF8Encoding(); return myutf.GetString(result); } /// <summary> /// Decrypt an encrypted string /// </summary> /// <param name="text">Encrypted text</param> /// <returns>Decrypted string</returns> public static string DecryptText(string text) { if (text == "") { return text; } return Decrypt(Convert.FromBase64String(text)); } /// <summary> /// Encrypt a string /// </summary> /// <param name="text">Unencrypted text</param> /// <returns>Encrypted string</returns> public static string EncryptText(string text) { if (text == "") { return text; } return Convert.ToBase64String(Encrypt(text)); } } /// <summary> /// Random number generator /// </summary> public static class RandomGenerator { /// <summary> /// Generate random number /// </summary> /// <param name="length">Number of randomizations</param> /// <returns>Random number</returns> public static int GenerateNumber(int length) { byte[] randomSeq = new byte[length]; new RNGCryptoServiceProvider().GetBytes(randomSeq); int code = Environment.TickCount; foreach (byte b in randomSeq) { code += (int)b; } return code; } } /// <summary> /// Hash generator class /// </summary> public static class Hasher { /// <summary> /// Hash type /// </summary> public enum eHashType { /// <summary> /// MD5 hash. Quick but collisions are more likely. This should not be used for anything important /// </summary> MD5 = 0, /// <summary> /// SHA1 hash. Quick and secure. This is a popular method for hashing passwords /// </summary> SHA1 = 1, /// <summary> /// SHA256 hash. Slower than SHA1, but more secure. Used for encryption keys /// </summary> SHA256 = 2, /// <summary> /// SHA348 hash. Even slower than SHA256, but offers more security /// </summary> SHA348 = 3, /// <summary> /// SHA512 hash. Slowest but most secure. Probably overkill for most applications /// </summary> SHA512 = 4, /// <summary> /// Derrived from MD5, but only returns 12 digits /// </summary> Digit12 = 5 } /// <summary> /// Hashes text using a specific hashing method /// </summary> /// <param name="text">Input text</param> /// <param name="hash">Hash method</param> /// <returns>Hashed text</returns> public static string GetHash(string text, eHashType hash) { if (text == "") { return text; } if (hash == eHashType.MD5) { MD5CryptoServiceProvider hasher = new MD5CryptoServiceProvider(); return ByteToHex(hasher.ComputeHash(Encoding.ASCII.GetBytes(text))); } else if (hash == eHashType.SHA1) { SHA1Managed hasher = new SHA1Managed(); return ByteToHex(hasher.ComputeHash(Encoding.ASCII.GetBytes(text))); } else if (hash == eHashType.SHA256) { SHA256Managed hasher = new SHA256Managed(); return ByteToHex(hasher.ComputeHash(Encoding.ASCII.GetBytes(text))); } else if (hash == eHashType.SHA348) { SHA384Managed hasher = new SHA384Managed(); return ByteToHex(hasher.ComputeHash(Encoding.ASCII.GetBytes(text))); } else if (hash == eHashType.SHA512) { SHA512Managed hasher = new SHA512Managed(); return ByteToHex(hasher.ComputeHash(Encoding.ASCII.GetBytes(text))); } else if (hash == eHashType.Digit12) { MD5CryptoServiceProvider hasher = new MD5CryptoServiceProvider(); string newHash = ByteToHex(hasher.ComputeHash(Encoding.ASCII.GetBytes(text))); return newHash.Substring(0, 12); } return ""; } /// <summary> /// Generates a hash based on a file's contents. Used for detecting changes to a file and testing for duplicate files /// </summary> /// <param name="info">FileInfo object for the file to be hashed</param> /// <param name="hash">Hash method</param> /// <returns>Hash string representing the contents of the file</returns> public static string GetHash(FileInfo info, eHashType hash) { FileStream hashStream = new FileStream(info.FullName, FileMode.Open, FileAccess.Read); string hashString = ""; if (hash == eHashType.MD5) { MD5CryptoServiceProvider hasher = new MD5CryptoServiceProvider(); hashString = ByteToHex(hasher.ComputeHash(hashStream)); } else if (hash == eHashType.SHA1) { SHA1Managed hasher = new SHA1Managed(); hashString = ByteToHex(hasher.ComputeHash(hashStream)); } else if (hash == eHashType.SHA256) { SHA256Managed hasher = new SHA256Managed(); hashString = ByteToHex(hasher.ComputeHash(hashStream)); } else if (hash == eHashType.SHA348) { SHA384Managed hasher = new SHA384Managed(); hashString = ByteToHex(hasher.ComputeHash(hashStream)); } else if (hash == eHashType.SHA512) { SHA512Managed hasher = new SHA512Managed(); hashString = ByteToHex(hasher.ComputeHash(hashStream)); } hashStream.Close(); hashStream.Dispose(); hashStream = null; return hashString; } /// <summary> /// Converts a byte array to a hex string /// </summary> /// <param name="data">Byte array</param> /// <returns>Hex string</returns> public static string ByteToHex(byte[] data) { StringBuilder builder = new StringBuilder(); foreach (byte hashByte in data) { builder.Append(string.Format("{0:X1}", hashByte)); } return builder.ToString(); } /// <summary> /// Converts a hex string to a byte array /// </summary> /// <param name="hexString">Hex string</param> /// <returns>Byte array</returns> public static byte[] HexToByte(string hexString) { byte[] returnBytes = new byte[hexString.Length / 2]; for (int i = 0; i <= returnBytes.Length - 1; i++) { returnBytes[i] = byte.Parse(hexString.Substring(i * 2, 2), System.Globalization.NumberStyles.HexNumber); } return returnBytes; } } } And her is what I've got for Java code so far, but I'm getting the error "Input length must be multiple of 8 when decrypting with padded cipher" when I run the test on this: import java.security.InvalidAlgorithmParameterException; import java.security.InvalidKeyException; import javax.crypto.Cipher; import javax.crypto.NoSuchPaddingException; import javax.crypto.SecretKey; import javax.crypto.spec.IvParameterSpec; import javax.crypto.spec.SecretKeySpec; import com.tdocc.utils.Base64; public class TripleDES { private static byte[] keyBytes = { 110, 32, 73, 24, 125, 66, 75, 18, 79, (byte)150, (byte)211, 122, (byte)213, 14, (byte)156, (byte)136, (byte)171, (byte)218, 119, (byte)240, 81, (byte)142, 23, 4 }; private static byte[] ivBytes = { 25, 117, 68, 23, 99, 78, (byte)231, (byte)219 }; public static String encryptText(String plainText) { try { if (plainText.isEmpty()) return plainText; return Base64.decode(TripleDES.encrypt(plainText)).toString(); } catch (Exception e) { e.printStackTrace(); } return null; } public static byte[] encrypt(String plainText) throws InvalidKeyException, InvalidAlgorithmParameterException, NoSuchPaddingException { try { final SecretKey key = new SecretKeySpec(keyBytes, "DESede"); final IvParameterSpec iv = new IvParameterSpec(ivBytes); final Cipher cipher = Cipher.getInstance("DESede/CBC/PKCS5Padding"); cipher.init(Cipher.ENCRYPT_MODE, key, iv); final byte[] plainTextBytes = plainText.getBytes("utf-8"); final byte[] cipherText = cipher.doFinal(plainTextBytes); return cipherText; } catch (Exception e) { e.printStackTrace(); } return null; } public static String decryptText(String message) { try { if (message.isEmpty()) return message; else return TripleDES.decrypt(message.getBytes()); } catch (Exception e) { e.printStackTrace(); } return null; } public static String decrypt(byte[] message) { try { final SecretKey key = new SecretKeySpec(keyBytes, "DESede"); final IvParameterSpec iv = new IvParameterSpec(ivBytes); final Cipher cipher = Cipher.getInstance("DESede/CBC/PKCS5Padding"); cipher.init(Cipher.DECRYPT_MODE, key, iv); final byte[] plainText = cipher.doFinal(message); return plainText.toString(); } catch (Exception e) { e.printStackTrace(); } return null; } }

  Read the article

• Issue with Multiple ModalPopups, ValidationSummary and UpdatePanels

  - by Aaron Hoffman

  I am having an issue when a page contains multiple ModalPopups each containing a ValidationSummary Control. Here is the functionality I need: A user clicks a button and a Modal Popup appears with dynamic content based on the button that was clicked. (This functionality is working. Buttons are wrapped in UpdatePanels and the partial page postback calls .Show() on the ModalPopup) "Save" button in ModalPopup causes client side validation, then causes a full page postback so the entire ModalPopup disappears. (ModalPopup could disappear another way - the ModalPopup just needs to disappear after a successful save operation) If errors occur in the codebehind during Save operation, messages are added to the ValidationSummary (contained within the ModalPopup) and the ModalPopup is displayed again. When the ValidationSummary's are added to the PopupPanel's, the ModalPopups no longer display correctly after a full page postback caused by the "Save" button within the second PopupPanel. (the first panel continues to function correctly) Both PopupPanels are displayed, and neither is "Popped-Up", they are displayed in-line. Any ideas on how to solve this? Image of Error State (after "PostBack Popup2" button has been clicked) ASPX markup <asp:ScriptManager ID="ScriptManager1" runat="server"> </asp:ScriptManager> <%--********************************************************************* Popup1 *********************************************************************--%> <asp:UpdatePanel ID="Popup1ShowButtonUpdatePanel" runat="server"> <ContentTemplate> <%--This button will cause a partial page postback and pass a parameter to the Popup1ModalPopup in code behind and call its .Show() method to make it visible--%> <asp:Button ID="Popup1ShowButton" runat="server" Text="Show Popup1" OnClick="Popup1ShowButton_Click" CommandArgument="1" /> </ContentTemplate> </asp:UpdatePanel> <%--Hidden Control is used as ModalPopup's TargetControlID .Usually this is the ID of control that causes the Popup, but we want to control the modal popup from code behind --%> <asp:HiddenField ID="Popup1ModalPopupTargetControl" runat="server" /> <ajax:ModalPopupExtender ID="Popup1ModalPopup" runat="server" TargetControlID="Popup1ModalPopupTargetControl" PopupControlID="Popup1PopupControl" CancelControlID="Popup1CancelButton"> </ajax:ModalPopupExtender> <asp:Panel ID="Popup1PopupControl" runat="server" CssClass="ModalPopup" Style="width: 600px; background-color: #FFFFFF; border: solid 1px #000000;"> <%--This button causes validation and a full-page post back. Full page postback will causes the ModalPopup to be Hid. If there are errors in code behind, the code behind will add a message to the ValidationSummary, and make the ModalPopup visible again--%> <asp:Button ID="Popup1PostBackButton" runat="server" Text="PostBack Popup1" OnClick="Popup1PostBackButton_Click" />&nbsp; <asp:Button ID="Popup1CancelButton" runat="server" Text="Cancel Popup1" /> <asp:UpdatePanel ID="Popup1UpdatePanel" runat="server"> <ContentTemplate> <%--*************ISSUE HERE*************** The two ValidationSummary's are causing an issue. When the second ModalPopup's PostBack button is clicked, Both ModalPopup's become visible, but neither are "Popped-Up". If ValidationSummary's are removed, both ModalPopups Function Correctly--%> <asp:ValidationSummary ID="Popup1ValidationSummary" runat="server" /> <%--Will display dynamically passed paramter during partial page post-back--%> Popup1 Parameter:<asp:Literal ID="Popup1Parameter" runat="server"></asp:Literal><br /> </ContentTemplate> </asp:UpdatePanel> &nbsp;<br /> &nbsp;<br /> &nbsp;<br /> </asp:Panel> &nbsp;<br /> &nbsp;<br /> &nbsp;<br /> <%--********************************************************************* Popup2 *********************************************************************--%> <asp:UpdatePanel ID="Popup2ShowButtonUpdatePanel" runat="server"> <ContentTemplate> <%--This button will cause a partial page postback and pass a parameter to the Popup2ModalPopup in code behind and call its .Show() method to make it visible--%> <asp:Button ID="Popup2ShowButton" runat="server" Text="Show Popup2" OnClick="Popup2ShowButton_Click" CommandArgument="2" /> </ContentTemplate> </asp:UpdatePanel> <%--Hidden Control is used as ModalPopup's TargetControlID .Usually this is the ID of control that causes the Popup, but we want to control the modal popup from code behind --%> <asp:HiddenField ID="Popup2ModalPopupTargetControl" runat="server" /> <ajax:ModalPopupExtender ID="Popup2ModalPopup" runat="server" TargetControlID="Popup2ModalPopupTargetControl" PopupControlID="Popup2PopupControl" CancelControlID="Popup2CancelButton"> </ajax:ModalPopupExtender> <asp:Panel ID="Popup2PopupControl" runat="server" CssClass="ModalPopup" Style="width: 600px; background-color: #FFFFFF; border: solid 1px #000000;"> <%--This button causes validation and a full-page post back. Full page postback will causes the ModalPopup to be Hid. If there are errors in code behind, the code behind will add a message to the ValidationSummary, and make the ModalPopup visible again--%> <asp:Button ID="Popup2PostBackButton" runat="server" Text="PostBack Popup2" OnClick="Popup2PostBackButton_Click" />&nbsp; <asp:Button ID="Popup2CancelButton" runat="server" Text="Cancel Popup2" /> <asp:UpdatePanel ID="Popup2UpdatePanel" runat="server"> <ContentTemplate> <%--*************ISSUE HERE*************** The two ValidationSummary's are causing an issue. When the second ModalPopup's PostBack button is clicked, Both ModalPopup's become visible, but neither are "Popped-Up". If ValidationSummary's are removed, both ModalPopups Function Correctly--%> <asp:ValidationSummary ID="Popup2ValidationSummary" runat="server" /> <%--Will display dynamically passed paramter during partial page post-back--%> Popup2 Parameter:<asp:Literal ID="Popup2Parameter" runat="server"></asp:Literal><br /> </ContentTemplate> </asp:UpdatePanel> &nbsp;<br /> &nbsp;<br /> &nbsp;<br /> </asp:Panel> Code Behind protected void Popup1ShowButton_Click(object sender, EventArgs e) { Button btn = sender as Button; //Dynamically pass parameter to ModalPopup during partial page postback Popup1Parameter.Text = btn.CommandArgument; Popup1ModalPopup.Show(); } protected void Popup1PostBackButton_Click(object sender, EventArgs e) { //if there is an error, add a message to the validation summary and //show the ModalPopup again //TODO: add message to validation summary //show ModalPopup after page refresh (request/response) Popup1ModalPopup.Show(); } protected void Popup2ShowButton_Click(object sender, EventArgs e) { Button btn = sender as Button; //Dynamically pass parameter to ModalPopup during partial page postback Popup2Parameter.Text = btn.CommandArgument; Popup2ModalPopup.Show(); } protected void Popup2PostBackButton_Click(object sender, EventArgs e) { //***********After This is when the issue appears********************** //if there is an error, add a message to the validation summary and //show the ModalPopup again //TODO: add message to validation summary //show ModalPopup after page refresh (request/response) Popup2ModalPopup.Show(); }

  Read the article

• How define several elements with same name, but different type in xsd:choice element?

  - by Nikolay Ponomarenko

  Is it possible in some way, to define an xsd scheme which could validate such xml: <item_list> <item ItemType="SimpleMessage" Caption="Simplest message"/> <item ItemType="ComplexMessage" SomeAttr="value"> <item_data>some text</item_data> </item> </item_list> Problem is that i havn't find any possibility to define smth like: <xsd:element name="Items"> <xsd:complexType> <xsd:choice> <xsd:element name="item" type="SimpleMessType"/> <xsd:element name="item" type="ComplexMessType"/> </xsd:choice> </xsd:complexType> </xsd:element> But i need to check, that SimpleMessage has no child elements or additional attrs :(

  Read the article

• Hosting Multiple hosts under IIS for WCF

  - by Josh

  Hello everyone, I need to use multiple hosts under IIS for WCF. We're using wshttpbinding and we've found NO success so far even after checking out a couple of similar questions on stackoveflow. Here is my web.config <?xml version="1.0"?> <!-- Note: As an alternative to hand editing this file you can use the web admin tool to configure settings for your application. Use the Website->Asp.Net Configuration option in Visual Studio. A full list of settings and comments can be found in machine.config.comments usually located in \Windows\Microsoft.Net\Framework\v2.x\Config --> <configuration> <configSections> <sectionGroup name="system.web.extensions" type="System.Web.Configuration.SystemWebExtensionsSectionGroup, System.Web.Extensions, Version=3.5.0.0, Culture=neutral, PublicKeyToken=31BF3856AD364E35"> <sectionGroup name="scripting" type="System.Web.Configuration.ScriptingSectionGroup, System.Web.Extensions, Version=3.5.0.0, Culture=neutral, PublicKeyToken=31BF3856AD364E35"> <section name="scriptResourceHandler" type="System.Web.Configuration.ScriptingScriptResourceHandlerSection, System.Web.Extensions, Version=3.5.0.0, Culture=neutral, PublicKeyToken=31BF3856AD364E35" requirePermission="false" allowDefinition="MachineToApplication"/> <sectionGroup name="webServices" type="System.Web.Configuration.ScriptingWebServicesSectionGroup, System.Web.Extensions, Version=3.5.0.0, Culture=neutral, PublicKeyToken=31BF3856AD364E35"> <section name="jsonSerialization" type="System.Web.Configuration.ScriptingJsonSerializationSection, System.Web.Extensions, Version=3.5.0.0, Culture=neutral, PublicKeyToken=31BF3856AD364E35" requirePermission="false" allowDefinition="Everywhere"/> <section name="profileService" type="System.Web.Configuration.ScriptingProfileServiceSection, System.Web.Extensions, Version=3.5.0.0, Culture=neutral, PublicKeyToken=31BF3856AD364E35" requirePermission="false" allowDefinition="MachineToApplication"/> <section name="authenticationService" type="System.Web.Configuration.ScriptingAuthenticationServiceSection, System.Web.Extensions, Version=3.5.0.0, Culture=neutral, PublicKeyToken=31BF3856AD364E35" requirePermission="false" allowDefinition="MachineToApplication"/> <section name="roleService" type="System.Web.Configuration.ScriptingRoleServiceSection, System.Web.Extensions, Version=3.5.0.0, Culture=neutral, PublicKeyToken=31BF3856AD364E35" requirePermission="false" allowDefinition="MachineToApplication"/> </sectionGroup> </sectionGroup> </sectionGroup> </configSections> <appSettings/> <connectionStrings> <add name="ConString" connectionString="Data Source=.\SQLEXPRESS;Initial Catalog=WebSMS20July;Integrated Security=True"/> </connectionStrings> <system.web> <customErrors mode="Off"/> <!--<httpRuntime maxRequestLength="999999999" useFullyQualifiedRedirectUrl="true" executionTimeout="459999999" appRequestQueueLimit="99999999" delayNotificationTimeout="999999999" maxWaitChangeNotification="999999999" shutdownTimeout="9999999999"/>--> <!-- Set compilation debug="true" to insert debugging symbols into the compiled page. Because this affects performance, set this value to true only during development. --> <compilation debug="true"> <assemblies> <add assembly="System.Core, Version=3.5.0.0, Culture=neutral, PublicKeyToken=B77A5C561934E089"/> <add assembly="System.Web.Extensions, Version=3.5.0.0, Culture=neutral, PublicKeyToken=31BF3856AD364E35"/> </assemblies> </compilation> <!-- The <authentication> section enables configuration of the security authentication mode used by ASP.NET to identify an incoming user. --> <authentication mode="Windows"/> <!-- The <customErrors> section enables configuration of what to do if/when an unhandled error occurs during the execution of a request. Specifically, it enables developers to configure html error pages to be displayed in place of a error stack trace. <customErrors mode="RemoteOnly" defaultRedirect="GenericErrorPage.htm"> <error statusCode="403" redirect="NoAccess.htm" /> <error statusCode="404" redirect="FileNotFound.htm" /> </customErrors>--> <pages> <controls> <add tagPrefix="asp" namespace="System.Web.UI" assembly="System.Web.Extensions, Version=3.5.0.0, Culture=neutral, PublicKeyToken=31BF3856AD364E35"/> </controls> </pages> <httpHandlers> <remove verb="*" path="*.asmx"/> <add verb="*" path="*.asmx" validate="false" type="System.Web.Script.Services.ScriptHandlerFactory, System.Web.Extensions, Version=3.5.0.0, Culture=neutral, PublicKeyToken=31BF3856AD364E35"/> <add verb="*" path="*_AppService.axd" validate="false" type="System.Web.Script.Services.ScriptHandlerFactory, System.Web.Extensions, Version=3.5.0.0, Culture=neutral, PublicKeyToken=31BF3856AD364E35"/> <add verb="GET,HEAD" path="ScriptResource.axd" type="System.Web.Handlers.ScriptResourceHandler, System.Web.Extensions, Version=3.5.0.0, Culture=neutral, PublicKeyToken=31BF3856AD364E35" validate="false"/> </httpHandlers> <httpModules> <add name="ScriptModule" type="System.Web.Handlers.ScriptModule, System.Web.Extensions, Version=3.5.0.0, Culture=neutral, PublicKeyToken=31BF3856AD364E35"/> </httpModules> </system.web> <system.codedom> <compilers> <compiler language="c#;cs;csharp" extension=".cs" warningLevel="4" type="Microsoft.CSharp.CSharpCodeProvider, System, Version=2.0.0.0, Culture=neutral, PublicKeyToken=b77a5c561934e089"> <providerOption name="CompilerVersion" value="v3.5"/> <providerOption name="WarnAsError" value="false"/> </compiler> </compilers> </system.codedom> <!-- The system.webServer section is required for running ASP.NET AJAX under Internet Information Services 7.0. It is not necessary for previous version of IIS. --> <system.webServer> <validation validateIntegratedModeConfiguration="false"/> <modules> <add name="ScriptModule" preCondition="integratedMode" type="System.Web.Handlers.ScriptModule, System.Web.Extensions, Version=3.5.0.0, Culture=neutral, PublicKeyToken=31BF3856AD364E35"/> </modules> <handlers> <remove name="WebServiceHandlerFactory-Integrated"/> <add name="ScriptHandlerFactory" verb="*" path="*.asmx" preCondition="integratedMode" type="System.Web.Script.Services.ScriptHandlerFactory, System.Web.Extensions, Version=3.5.0.0, Culture=neutral, PublicKeyToken=31BF3856AD364E35"/> <add name="ScriptHandlerFactoryAppServices" verb="*" path="*_AppService.axd" preCondition="integratedMode" type="System.Web.Script.Services.ScriptHandlerFactory, System.Web.Extensions, Version=3.5.0.0, Culture=neutral, PublicKeyToken=31BF3856AD364E35"/> <add name="ScriptResource" preCondition="integratedMode" verb="GET,HEAD" path="ScriptResource.axd" type="System.Web.Handlers.ScriptResourceHandler, System.Web.Extensions, Version=3.5.0.0, Culture=neutral, PublicKeyToken=31BF3856AD364E35"/> </handlers> </system.webServer> <system.serviceModel> <serviceHostingEnvironment aspNetCompatibilityEnabled="true"> <baseAddressPrefixFilters> <add prefix="http://localhost:12350"/> </baseAddressPrefixFilters> </serviceHostingEnvironment> <bindings> <wsHttpBinding> <binding name="wsHttpBinding" maxBufferPoolSize="2147483647" maxReceivedMessageSize="2147483647"> <readerQuotas maxDepth="2147483647" maxStringContentLength="2147483647" maxArrayLength="2147483647" maxBytesPerRead="2147483647" maxNameTableCharCount="2147483647" /> <security mode="None"> <transport clientCredentialType="None" /> <message clientCredentialType="None" negotiateServiceCredential="false" establishSecurityContext="false" /> </security> </binding> <binding name="NewBinding0" /> </wsHttpBinding> </bindings> <services> <service behaviorConfiguration="WcfService1.Service1Behavior" name="WcfService1.Service1"> <endpoint address="" binding="wsHttpBinding" bindingConfiguration="wsHttpBinding" bindingName="wsHttpBinding" contract="WcfService1.IService1"> <identity> <dns value="localhost" /> </identity> </endpoint> <endpoint address="mex" binding="mexHttpBinding" contract="IMetadataExchange" /> <endpoint binding="wsHttpBinding" bindingConfiguration="wsHttpBinding" bindingName="wsHttpBinding2" contract="WcfService1.IService1" listenUri="http://localhost:8090" /> <host> <baseAddresses> <add baseAddress="http://mydomain/mywcfservice/Service1.svc" /> <add baseAddress="http://localhost/mywcfservice/Service1.svc" /> </baseAddresses> </host> </service> </services> <behaviors> <serviceBehaviors> <behavior name="WcfService1.Service1Behavior"> <!-- To avoid disclosing metadata information, set the value below to false and remove the metadata endpoint above before deployment --> <serviceMetadata httpGetEnabled="true"/> <!-- To receive exception details in faults for debugging purposes, set the value below to true. Set to false before deployment to avoid disclosing exception information --> <serviceDebug includeExceptionDetailInFaults="false"/> </behavior> </serviceBehaviors> </behaviors> </system.serviceModel> </configuration> Here's my service factory class using System; using System.Collections.Generic; using System.Linq; using System.Web; using System.ServiceModel; using System.ServiceModel.Activation; namespace WcfService1 { public class CustomHostFactory : ServiceHostFactory { protected override ServiceHost CreateServiceHost(Type serviceType, Uri[] baseAddresses) { //CustomHost customServiceHost = // new CustomHost(serviceType, baseAddresses[1]); //return customServiceHost; ServiceHost host; host = new ServiceHost(serviceType, baseAddresses[0]); return host; } class CustomHost : ServiceHost { public CustomHost(Type serviceType, params Uri[] baseAddresses) : base(serviceType, baseAddresses) { } protected override void ApplyConfiguration() { base.ApplyConfiguration(); } } } } Contents of my Service1.svc file <%@ ServiceHost Language="C#" Debug="true" Service="WcfService1.Service1" CodeBehind="Service1.svc.cs" Factory="WcfService1.CustomHostFactory" %> What could possibly be wrong? Would appreciate any help. Thanks.

  Read the article

• Questions related to writing your own file downloader using multiple threads java

  - by Shekhar

  Hello In my current company, i am doing a PoC on how we can write a file downloader utility. We have to use socket programming(TCP/IP) for downloading the files. One of the requirements of the client is that a file(which will be large in size) should be transfered in chunks for example if we have a file of 5Mb size then we can have 5 threads which transfer 1 Mb each. I have written a small application which downloads a file. You can download the eclipe project from http://www.fileflyer.com/view/QM1JSC0 A brief explanation of my classes FileSender.java This class provides the bytes of file. It has a method called sendBytesOfFile(long start,long end, long sequenceNo) which gives the number of bytes. import java.io.File; import java.io.IOException; import java.util.zip.CRC32; import org.apache.commons.io.FileUtils; public class FileSender { private static final String FILE_NAME = "C:\\shared\\test.pdf"; public ByteArrayWrapper sendBytesOfFile(long start,long end, long sequenceNo){ try { File file = new File(FILE_NAME); byte[] fileBytes = FileUtils.readFileToByteArray(file); System.out.println("Size of file is " +fileBytes.length); System.out.println(); System.out.println("Start "+start +" end "+end); byte[] bytes = getByteArray(fileBytes, start, end); ByteArrayWrapper wrapper = new ByteArrayWrapper(bytes, sequenceNo); return wrapper; } catch (IOException e) { throw new RuntimeException(e); } } private byte[] getByteArray(byte[] bytes, long start, long end){ long arrayLength = end-start; System.out.println("Start : "+start +" end : "+end + " Arraylength : "+arrayLength +" length of source array : "+bytes.length); byte[] arr = new byte[(int)arrayLength]; for(int i = (int)start, j =0; i < end;i++,j++){ arr[j] = bytes[i]; } return arr; } public static long fileSize(){ File file = new File(FILE_NAME); return file.length(); } } Second Class is FileReceiver.java - This class receives the file. Small Explanation what this file does This class finds the size of the file to be fetched from Sender Depending upon the size of the file it finds the start and end position till the bytes needs to be read. It starts n number of threads giving each thread start,end, sequence number and a list which all the threads share. Each thread reads the number of bytes and creates a ByteArrayWrapper. ByteArrayWrapper objects are added to the list Then i have while loop which basically make sure that all threads have done their work finally it sorts the list based on the sequence number. then the bytes are joined, and a complete byte array is formed which is converted to a file. Code of File Receiver package com.filedownloader; import java.io.File; import java.io.IOException; import java.util.ArrayList; import java.util.Collections; import java.util.Comparator; import java.util.List; import java.util.zip.CRC32; import org.apache.commons.io.FileUtils; public class FileReceiver { public static void main(String[] args) { FileReceiver receiver = new FileReceiver(); receiver.receiveFile(); } public void receiveFile(){ long startTime = System.currentTimeMillis(); long numberOfThreads = 10; long filesize = FileSender.fileSize(); System.out.println("File size received "+filesize); long start = filesize/numberOfThreads; List<ByteArrayWrapper> list = new ArrayList<ByteArrayWrapper>(); for(long threadCount =0; threadCount<numberOfThreads ;threadCount++){ FileDownloaderTask task = new FileDownloaderTask(threadCount*start,(threadCount+1)*start,threadCount,list); new Thread(task).start(); } while(list.size() != numberOfThreads){ // this is done so that all the threads should complete their work before processing further. //System.out.println("Waiting for threads to complete. List size "+list.size()); } if(list.size() == numberOfThreads){ System.out.println("All bytes received "+list); Collections.sort(list, new Comparator<ByteArrayWrapper>() { @Override public int compare(ByteArrayWrapper o1, ByteArrayWrapper o2) { long sequence1 = o1.getSequence(); long sequence2 = o2.getSequence(); if(sequence1 < sequence2){ return -1; }else if(sequence1 > sequence2){ return 1; } else{ return 0; } } }); byte[] totalBytes = list.get(0).getBytes(); byte[] firstArr = null; byte[] secondArr = null; for(int i = 1;i<list.size();i++){ firstArr = totalBytes; secondArr = list.get(i).getBytes(); totalBytes = concat(firstArr, secondArr); } System.out.println(totalBytes.length); convertToFile(totalBytes,"c:\\tmp\\test.pdf"); long endTime = System.currentTimeMillis(); System.out.println("Total time taken with "+numberOfThreads +" threads is "+(endTime-startTime)+" ms" ); } } private byte[] concat(byte[] A, byte[] B) { byte[] C= new byte[A.length+B.length]; System.arraycopy(A, 0, C, 0, A.length); System.arraycopy(B, 0, C, A.length, B.length); return C; } private void convertToFile(byte[] totalBytes,String name) { try { FileUtils.writeByteArrayToFile(new File(name), totalBytes); } catch (IOException e) { throw new RuntimeException(e); } } } Code of ByteArrayWrapper package com.filedownloader; import java.io.Serializable; public class ByteArrayWrapper implements Serializable{ private static final long serialVersionUID = 3499562855188457886L; private byte[] bytes; private long sequence; public ByteArrayWrapper(byte[] bytes, long sequenceNo) { this.bytes = bytes; this.sequence = sequenceNo; } public byte[] getBytes() { return bytes; } public long getSequence() { return sequence; } } Code of FileDownloaderTask import java.util.List; public class FileDownloaderTask implements Runnable { private List<ByteArrayWrapper> list; private long start; private long end; private long sequenceNo; public FileDownloaderTask(long start,long end,long sequenceNo,List<ByteArrayWrapper> list) { this.list = list; this.start = start; this.end = end; this.sequenceNo = sequenceNo; } @Override public void run() { ByteArrayWrapper wrapper = new FileSender().sendBytesOfFile(start, end, sequenceNo); list.add(wrapper); } } Questions related to this code 1) Does file downloading becomes fast when multiple threads is used? In this code i am not able to see the benefit. 2) How should i decide how many threads should i create ? 3) Are their any opensource libraries which does that 4) The file which file receiver receives is valid and not corrupted but checksum (i used FileUtils of common-io) does not match. Whats the problem? 5) This code gives out of memory when used with large file(above 100 Mb) i.e. because byte array which is created. How can i avoid? I know this is a very bad code but i have to write this in one day -:). Please suggest any other good way to do this? Thanks Shekhar

  Read the article

• Is JBehave a good choice for Web Service Automated Testing?

  - by Vanchinathan

  Hi All, We have a requirement at my workplace to automate the webservice testing. We have been using QTP scripts to do so. We as a team, Kind of leaning towards Jbehave as a choice. Is JBehave a good choice for web service functional testing automation? We do use Soap UI to test manually. But we are planning to automate the functional and regression testing to reduce the release cycle time. Suggestions welcome.

  Read the article

• XSD: xs:sequence & xs:choice combination for xs:extension elements?

  - by bguiz

  Hi, My question is about defining an XML schema that will validate the following sample XML: <rules> <other>...</other> <bool>...</bool> <other>...</other> <string>...</string> <other>...</other> </rules> The order of the child nodes does not matter. The cardinality of the child nodes is 0..unbounded. All the child elements of the rules node have a common base type, rule, like so: <xs:complexType name="booleanRule"> <xs:complexContent> <xs:extension base="rule"> ... </xs:extension> </xs:complexContent> </xs:complexType> <xs:complexType name="stringFilterRule"> <xs:complexContent> <xs:extension base="filterRule"> ... </xs:extension> </xs:complexContent> </xs:complexType> My current attempt at defining the schema for the rules node is below. However, Can I nest xs:choice within xs:sequence? If, where do I specify the maxOccurs="unbounded" attribute? Is there a better way to do this, such as an xs:sequence which specifies only the base type of its child elements? <xs:element name="rules"> <xs:complexType> <xs:sequence> <xs:choice> <xs:element name="bool" type="booleanRule" /> <xs:element name="string" type="stringRule" /> <xs:element name="other" type="someOtherRule" /> </xs:choice> </xs:sequence> </xs:complexType> </xs:element>

  Read the article

• How can I display a dialog box for making a choice before a CALL is processed in android?

  - by jsight

  I would like to intercept outgoing calls and pass them to a VOIP application. I see that the Google Voice application has a feature for displaying a question before each call is actually initiated. It provides the user with the choice: Initiate call via Google Voice Initiate call via standard call I would like a way to do something similar with my application (so that not all calls have to be routed through it). At the moment, I can intercept CALL events via a BroadcastReceiver, however, these are not allowed to open dialogs (thus making it possible to display the choice). What is the best way of achieving this goal?

  Read the article

• XSD: xs:sequence & xs:choice combination for xs:extension elements of a common base type?

  - by bguiz

  Hi, My question is about defining an XML schema that will validate the following XML: <rules> <other>...</other> <bool>...</bool> <other>...</other> <string>...</string> <other>...</other> </rules> The order of the child nodes does not matter. The cardinality of the child nodes is 0..unbounded. All the child elements of the rules node have a common base type, rule, like so: <xs:complexType name="booleanRule"> <xs:complexContent> <xs:extension base="rule"> ... </xs:extension> </xs:complexContent> </xs:complexType> <xs:complexType name="stringFilterRule"> <xs:complexContent> <xs:extension base="filterRule"> ... </xs:extension> </xs:complexContent> </xs:complexType> My current (feeble) attempt at defining the schema for the rules node is below. However, Can I nest xs:choice within xs:sequence? If, where do I specify the maxOccurs="unbounded" attribute? Is there a better way to do this, such as an xs:sequence which specifies only the base type of its child elements? <xs:element name="rules"> <xs:complexType> <xs:sequence> <xs:choice> <xs:element name="bool" type="booleanRule" /> <xs:element name="string" type="stringRule" /> <xs:element name="other" type="someOtherRule" /> </xs:choice> </xs:sequence> </xs:complexType> </xs:element>

  Read the article

• Java. What to do with Choice()???

  - by modzo

  import java.awt.*; import java.awt.event.*; import java.applet.*; public class ChoiceSample extends Applet implements ActionListener, ItemListener { Choice dz2; public void init(){ dz2 = new Choice(); dz2.addItem("female"); dz2.addItem("male"); dz2.addItemListener(this); add(dz2); public void itemStateChanged(ItemEvent e) { String result = dz2.getSelectedItem(); repaint(); if(result.equals(getParameter("male"))){ dz1 = 0.5; } else{ dz1 = 0.7; } } } /* this is yust a fragment from my program but this is the only thing that I can`t make right. I need when I chose male - dz1 = 0.5, but when I chose female dz1 = 0.7 Can someone help me, please? */

  Read the article

• Search multiple datepicker on same grid

  - by DHF

  I'm using multiple datepicker on same grid and I face the problem to get a proper result. I used 3 datepicker in 1 grid. Only the first datepicker (Order Date)is able to output proper result while the other 2 datepicker (Start Date & End Date) are not able to generate proper result. There is no problem with the query, so could you find out what's going on here? Thanks in advance! php wrapper <?php ob_start(); require_once 'config.php'; // include the jqGrid Class require_once "php/jqGrid.php"; // include the PDO driver class require_once "php/jqGridPdo.php"; // include the datepicker require_once "php/jqCalendar.php"; // Connection to the server $conn = new PDO(DB_DSN,DB_USER,DB_PASSWORD); // Tell the db that we use utf-8 $conn->query("SET NAMES utf8"); // Create the jqGrid instance $grid = new jqGridRender($conn); // Write the SQL Query $grid->SelectCommand = "SELECT c.CompanyID, c.CompanyCode, c.CompanyName, c.Area, o.OrderCode, o.Date, m.maID ,m.System, m.Status, m.StartDate, m.EndDate, m.Type FROM company c, orders o, maintenance_agreement m WHERE c.CompanyID = o.CompanyID AND o.OrderID = m.OrderID "; // Set the table to where you update the data $grid->table = 'maintenance_agreement'; // set the ouput format to json $grid->dataType = 'json'; // Let the grid create the model $grid->setPrimaryKeyId('maID'); // Let the grid create the model $grid->setColModel(); // Set the url from where we obtain the data $grid->setUrl('grouping_ma_details.php'); // Set grid caption using the option caption $grid->setGridOptions(array( "sortable"=>true, "rownumbers"=>true, "caption"=>"Group by Maintenance Agreement", "rowNum"=>20, "height"=>'auto', "width"=>1300, "sortname"=>"maID", "hoverrows"=>true, "rowList"=>array(10,20,50), "footerrow"=>false, "userDataOnFooter"=>false, "grouping"=>true, "groupingView"=>array( "groupField" => array('CompanyName'), "groupColumnShow" => array(true), //show or hide area column "groupText" =>array('<b> Company Name: {0}</b>',), "groupDataSorted" => true, "groupSummary" => array(true) ) )); if(isset($_SESSION['login_admin'])) { $grid->addCol(array( "name"=>"Action", "formatter"=>"actions", "editable"=>false, "sortable"=>false, "resizable"=>false, "fixed"=>true, "width"=>60, "formatoptions"=>array("keys"=>true), "search"=>false ), "first"); } // Change some property of the field(s) $grid->setColProperty("CompanyID", array("label"=>"ID","hidden"=>true,"width"=>30,"editable"=>false,"editoptions"=>array("readonly"=>"readonly"))); $grid->setColProperty("CompanyName", array("label"=>"Company Name","hidden"=>true,"editable"=>false,"width"=>150,"align"=>"center","fixed"=>true)); $grid->setColProperty("CompanyCode", array("label"=>"Company Code","hidden"=>true,"width"=>50,"align"=>"center")); $grid->setColProperty("OrderCode", array("label"=>"Order Code","width"=>110,"editable"=>false,"align"=>"center","fixed"=>true)); $grid->setColProperty("maID", array("hidden"=>true)); $grid->setColProperty("System", array("width"=>150,"fixed"=>true,"align"=>"center")); $grid->setColProperty("Type", array("width"=>280,"fixed"=>true)); $grid->setColProperty("Status", array("width"=>70,"align"=>"center","edittype"=>"select","editoptions"=>array("value"=>"Yes:Yes;No:No"),"fixed"=>true)); $grid->setSelect('System', "SELECT DISTINCT System, System AS System FROM master_ma_system ORDER BY System", false, true, true, array(""=>"All")); $grid->setSelect('Type', "SELECT DISTINCT Type, Type AS Type FROM master_ma_type ORDER BY Type", false, true, true, array(""=>"All")); $grid->setColProperty("StartDate", array("label"=>"Start Date","width"=>120,"align"=>"center","fixed"=>true, "formatter"=>"date", "formatoptions"=>array("srcformat"=>"Y-m-d H:i:s","newformat"=>"d M Y") )); // this is only in this case since the orderdate is set as date time $grid->setUserTime("d M Y"); $grid->setUserDate("d M Y"); $grid->setDatepicker("StartDate",array("buttonOnly"=>false)); $grid->datearray = array('StartDate'); $grid->setColProperty("EndDate", array("label"=>"End Date","width"=>120,"align"=>"center","fixed"=>true, "formatter"=>"date", "formatoptions"=>array("srcformat"=>"Y-m-d H:i:s","newformat"=>"d M Y") )); // this is only in this case since the orderdate is set as date time $grid->setUserTime("d M Y"); $grid->setUserDate("d M Y"); $grid->setDatepicker("EndDate",array("buttonOnly"=>false)); $grid->datearray = array('EndDate'); $grid->setColProperty("Date", array("label"=>"Order Date","width"=>100,"editable"=>false,"align"=>"center","fixed"=>true, "formatter"=>"date", "formatoptions"=>array("srcformat"=>"Y-m-d H:i:s","newformat"=>"d M Y") )); // this is only in this case since the orderdate is set as date time $grid->setUserTime("d M Y"); $grid->setUserDate("d M Y"); $grid->setDatepicker("Date",array("buttonOnly"=>false)); $grid->datearray = array('Date'); // This command is executed after edit $maID = jqGridUtils::GetParam('maID'); $Status = jqGridUtils::GetParam('Status'); $StartDate = jqGridUtils::GetParam('StartDate'); $EndDate = jqGridUtils::GetParam('EndDate'); $Type = jqGridUtils::GetParam('Type'); // This command is executed immediatley after edit occur. $grid->setAfterCrudAction('edit', "UPDATE maintenance_agreement SET m.Status=?, m.StartDate=?, m.EndDate=?, m.Type=? WHERE m.maID=?", array($Status,$StartDate,$EndDate,$Type,$maID)); $selectorder = <<<ORDER function(rowid, selected) { if(rowid != null) { jQuery("#detail").jqGrid('setGridParam',{postData:{CompanyID:rowid}}); jQuery("#detail").trigger("reloadGrid"); // Enable CRUD buttons in navigator when a row is selected jQuery("#add_detail").removeClass("ui-state-disabled"); jQuery("#edit_detail").removeClass("ui-state-disabled"); jQuery("#del_detail").removeClass("ui-state-disabled"); } } ORDER; // We should clear the grid data on second grid on sorting, paging, etc. $cleargrid = <<<CLEAR function(rowid, selected) { // clear the grid data and footer data jQuery("#detail").jqGrid('clearGridData',true); // Disable CRUD buttons in navigator when a row is not selected jQuery("#add_detail").addClass("ui-state-disabled"); jQuery("#edit_detail").addClass("ui-state-disabled"); jQuery("#del_detail").addClass("ui-state-disabled"); } CLEAR; $grid->setGridEvent('onSelectRow', $selectorder); $grid->setGridEvent('onSortCol', $cleargrid); $grid->setGridEvent('onPaging', $cleargrid); $grid->setColProperty("Area", array("width"=>100,"hidden"=>false,"editable"=>false,"fixed"=>true)); $grid->setColProperty("HeadCount", array("label"=>"Head Count","align"=>"center", "width"=>100,"hidden"=>false,"fixed"=>true)); $grid->setSelect('Area', "SELECT DISTINCT AreaName, AreaName AS Area FROM master_area ORDER BY AreaName", false, true, true, array(""=>"All")); $grid->setSelect('CompanyName', "SELECT DISTINCT CompanyName, CompanyName AS CompanyName FROM company ORDER BY CompanyName", false, true, true, array(""=>"All")); $custom = <<<CUSTOM jQuery("#getselected").click(function(){ var selr = jQuery('#grid').jqGrid('getGridParam','selrow'); if(selr) { window.open('http://www.smartouch-cdms.com/order.php?CompanyID='+selr); } else alert("No selected row"); return false; }); CUSTOM; $grid->setJSCode($custom); // Enable toolbar searching $grid->toolbarfilter = true; $grid->setFilterOptions(array("stringResult"=>true,"searchOnEnter"=>false,"defaultSearch"=>"cn")); // Enable navigator $grid->navigator = true; // disable the delete operation programatically for that table $grid->del = false; // we need to write some custom code when we are in delete mode. // get the grid operation parameter to see if we are in delete mode // jqGrid sends the "oper" parameter to identify the needed action $deloper = $_POST['oper']; // det the company id $cid = $_POST['CompanyID']; // if the operation is del and the companyid is set if($deloper == 'del' && isset($cid) ) { // the two tables are linked via CompanyID, so let try to delete the records in both tables try { jqGridDB::beginTransaction($conn); $comp = jqGridDB::prepare($conn, "DELETE FROM company WHERE CompanyID= ?", array($cid)); $cont = jqGridDB::prepare($conn,"DELETE FROM contact WHERE CompanyID = ?", array($cid)); jqGridDB::execute($comp); jqGridDB::execute($cont); jqGridDB::commit($conn); } catch(Exception $e) { jqGridDB::rollBack($conn); echo $e->getMessage(); } } // Enable only deleting if(isset($_SESSION['login_admin'])) { $grid->setNavOptions('navigator', array("pdf"=>true, "excel"=>true,"add"=>false,"edit"=>true,"del"=>false,"view"=>true, "search"=>true)); } else $grid->setNavOptions('navigator', array("pdf"=>true, "excel"=>true,"add"=>false,"edit"=>false,"del"=>false,"view"=>true, "search"=>true)); // In order to enable the more complex search we should set multipleGroup option // Also we need show query roo $grid->setNavOptions('search', array( "multipleGroup"=>false, "showQuery"=>true )); // Set different filename $grid->exportfile = 'Company.xls'; // Close the dialog after editing $grid->setNavOptions('edit',array("closeAfterEdit"=>true,"editCaption"=>"Update Company","bSubmit"=>"Update","dataheight"=>"auto")); $grid->setNavOptions('add',array("closeAfterAdd"=>true,"addCaption"=>"Add New Company","bSubmit"=>"Update","dataheight"=>"auto")); $grid->setNavOptions('view',array("Caption"=>"View Company","dataheight"=>"auto","width"=>"1100")); ob_end_clean(); //solve TCPDF error // Enjoy $grid->renderGrid('#grid','#pager',true, null, null, true,true); $conn = null; ?> javascript code jQuery(document).ready(function ($) { jQuery('#grid').jqGrid({ "width": 1300, "hoverrows": true, "viewrecords": true, "jsonReader": { "repeatitems": false, "subgrid": { "repeatitems": false } }, "xmlReader": { "repeatitems": false, "subgrid": { "repeatitems": false } }, "gridview": true, "url": "session_ma_details.php", "editurl": "session_ma_details.php", "cellurl": "session_ma_details.php", "sortable": true, "rownumbers": true, "caption": "Group by Maintenance Agreement", "rowNum": 20, "height": "auto", "sortname": "maID", "rowList": [10, 20, 50], "footerrow": false, "userDataOnFooter": false, "grouping": true, "groupingView": { "groupField": ["CompanyName"], "groupColumnShow": [false], "groupText": ["<b> Company Name: {0}</b>"], "groupDataSorted": true, "groupSummary": [true] }, "onSelectRow": function (rowid, selected) { if (rowid != null) { jQuery("#detail").jqGrid('setGridParam', { postData: { CompanyID: rowid } }); jQuery("#detail").trigger("reloadGrid"); // Enable CRUD buttons in navigator when a row is selected jQuery("#add_detail").removeClass("ui-state-disabled"); jQuery("#edit_detail").removeClass("ui-state-disabled"); jQuery("#del_detail").removeClass("ui-state-disabled"); } }, "onSortCol": function (rowid, selected) { // clear the grid data and footer data jQuery("#detail").jqGrid('clearGridData', true); // Disable CRUD buttons in navigator when a row is not selected jQuery("#add_detail").addClass("ui-state-disabled"); jQuery("#edit_detail").addClass("ui-state-disabled"); jQuery("#del_detail").addClass("ui-state-disabled"); }, "onPaging": function (rowid, selected) { // clear the grid data and footer data jQuery("#detail").jqGrid('clearGridData', true); // Disable CRUD buttons in navigator when a row is not selected jQuery("#add_detail").addClass("ui-state-disabled"); jQuery("#edit_detail").addClass("ui-state-disabled"); jQuery("#del_detail").addClass("ui-state-disabled"); }, "datatype": "json", "colModel": [ { "name": "Action", "formatter": "actions", "editable": false, "sortable": false, "resizable": false, "fixed": true, "width": 60, "formatoptions": { "keys": true }, "search": false }, { "name": "CompanyID", "index": "CompanyID", "sorttype": "int", "label": "ID", "hidden": true, "width": 30, "editable": false, "editoptions": { "readonly": "readonly" } }, { "name": "CompanyCode", "index": "CompanyCode", "sorttype": "string", "label": "Company Code", "hidden": true, "width": 50, "align": "center", "editable": true }, { "name": "CompanyName", "index": "CompanyName", "sorttype": "string", "label": "Company Name", "hidden": true, "editable": false, "width": 150, "align": "center", "fixed": true, "edittype": "select", "editoptions": { "value": "Aquatex Industries:Aquatex Industries;Benithem Sdn Bhd:Benithem Sdn Bhd;Daily Bakery Sdn Bhd:Daily Bakery Sdn Bhd;Eurocor Asia Sdn Bhd:Eurocor Asia Sdn Bhd;Evergrown Technology:Evergrown Technology;Goldpar Precision:Goldpar Precision;MicroSun Technologies Asia:MicroSun Technologies Asia;NCI Industries Sdn Bhd:NCI Industries Sdn Bhd;PHHP Marketing:PHHP Marketing;Smart Touch Technology:Smart Touch Technology;THOSCO Treatech:THOSCO Treatech;YHL Trading (Johor) Sdn Bhd:YHL Trading (Johor) Sdn Bhd;Zenxin Agri-Organic Food:Zenxin Agri-Organic Food", "separator": ":", "delimiter": ";" }, "stype": "select", "searchoptions": { "value": ":All;Aquatex Industries:Aquatex Industries;Benithem Sdn Bhd:Benithem Sdn Bhd;Daily Bakery Sdn Bhd:Daily Bakery Sdn Bhd;Eurocor Asia Sdn Bhd:Eurocor Asia Sdn Bhd;Evergrown Technology:Evergrown Technology;Goldpar Precision:Goldpar Precision;MicroSun Technologies Asia:MicroSun Technologies Asia;NCI Industries Sdn Bhd:NCI Industries Sdn Bhd;PHHP Marketing:PHHP Marketing;Smart Touch Technology:Smart Touch Technology;THOSCO Treatech:THOSCO Treatech;YHL Trading (Johor) Sdn Bhd:YHL Trading (Johor) Sdn Bhd;Zenxin Agri-Organic Food:Zenxin Agri-Organic Food", "separator": ":", "delimiter": ";" } }, { "name": "Area", "index": "Area", "sorttype": "string", "width": 100, "hidden": true, "editable": false, "fixed": true, "edittype": "select", "editoptions": { "value": "Cemerlang:Cemerlang;Danga Bay:Danga Bay;Kulai:Kulai;Larkin:Larkin;Masai:Masai;Nusa Cemerlang:Nusa Cemerlang;Nusajaya:Nusajaya;Pasir Gudang:Pasir Gudang;Pekan Nenas:Pekan Nenas;Permas Jaya:Permas Jaya;Pontian:Pontian;Pulai:Pulai;Senai:Senai;Skudai:Skudai;Taman Gaya:Taman Gaya;Taman Johor Jaya:Taman Johor Jaya;Taman Molek:Taman Molek;Taman Pelangi:Taman Pelangi;Taman Sentosa:Taman Sentosa;Tebrau 4:Tebrau 4;Ulu Tiram:Ulu Tiram", "separator": ":", "delimiter": ";" }, "stype": "select", "searchoptions": { "value": ":All;Cemerlang:Cemerlang;Danga Bay:Danga Bay;Kulai:Kulai;Larkin:Larkin;Masai:Masai;Nusa Cemerlang:Nusa Cemerlang;Nusajaya:Nusajaya;Pasir Gudang:Pasir Gudang;Pekan Nenas:Pekan Nenas;Permas Jaya:Permas Jaya;Pontian:Pontian;Pulai:Pulai;Senai:Senai;Skudai:Skudai;Taman Gaya:Taman Gaya;Taman Johor Jaya:Taman Johor Jaya;Taman Molek:Taman Molek;Taman Pelangi:Taman Pelangi;Taman Sentosa:Taman Sentosa;Tebrau 4:Tebrau 4;Ulu Tiram:Ulu Tiram", "separator": ":", "delimiter": ";" } }, { "name": "OrderCode", "index": "OrderCode", "sorttype": "string", "label": "Order No.", "width": 110, "editable": false, "align": "center", "fixed": true }, { "name": "Date", "index": "Date", "sorttype": "date", "label": "Order Date", "width": 100, "editable": false, "align": "center", "fixed": true, "formatter": "date", "formatoptions": { "srcformat": "Y-m-d H:i:s", "newformat": "d M Y" }, "editoptions": { "dataInit": function(el) { setTimeout(function() { if (jQuery.ui) { if (jQuery.ui.datepicker) { jQuery(el).datepicker({ "disabled": false, "dateFormat": "dd M yy" }); jQuery('.ui-datepicker').css({ 'font-size': '75%' }); } } }, 100); } }, "searchoptions": { "dataInit": function(el) { setTimeout(function() { if (jQuery.ui) { if (jQuery.ui.datepicker) { jQuery(el).datepicker({ "disabled": false, "dateFormat": "dd M yy" }); jQuery('.ui-datepicker').css({ 'font-size': '75%' }); } } }, 100); } } }, { "name": "maID", "index": "maID", "sorttype": "int", "key": true, "hidden": true, "editable": true }, { "name": "System", "index": "System", "sorttype": "string", "width": 150, "fixed": true, "align": "center", "edittype": "select", "editoptions": { "value": "Payroll:Payroll;TMS:TMS;TMS & Payroll:TMS & Payroll", "separator": ":", "delimiter": ";" }, "stype": "select", "searchoptions": { "value": ":All;Payroll:Payroll;TMS:TMS;TMS & Payroll:TMS & Payroll", "separator": ":", "delimiter": ";" }, "editable": true }, { "name": "Status", "index": "Status", "sorttype": "string", "width": 70, "align": "center", "edittype": "select", "editoptions": { "value": "Yes:Yes;No:No" }, "fixed": true, "editable": true }, { "name": "StartDate", "index": "StartDate", "sorttype": "date", "label": "Start Date", "width": 120, "align": "center", "fixed": true, "formatter": "date", "formatoptions": { "srcformat": "Y-m-d H:i:s", "newformat": "d M Y" }, "editoptions": { "dataInit": function(el) { setTimeout(function() { if (jQuery.ui) { if (jQuery.ui.datepicker) { jQuery(el).datepicker({ "disabled": false, "dateFormat": "dd M yy" }); jQuery('.ui-datepicker').css({ 'font-size': '75%' }); } } }, 100); } }, "searchoptions": { "dataInit": function(el) { setTimeout(function() { if (jQuery.ui) { if (jQuery.ui.datepicker) { jQuery(el).datepicker({ "disabled": false, "dateFormat": "dd M yy" }); jQuery('.ui-datepicker').css({ 'font-size': '75%' }); } } }, 100); } }, "editable": true }, { "name": "EndDate", "index": "EndDate", "sorttype": "date", "label": "End Date", "width": 120, "align": "center", "fixed": true, "formatter": "date", "formatoptions": { "srcformat": "Y-m-d H:i:s", "newformat": "d M Y" }, "editoptions": { "dataInit": function(el) { setTimeout(function() { if (jQuery.ui) { if (jQuery.ui.datepicker) { jQuery(el).datepicker({ "disabled": false, "dateFormat": "dd M yy" }); jQuery('.ui-datepicker').css({ 'font-size': '75%' }); } } }, 100); } }, "searchoptions": { "dataInit": function(el) { setTimeout(function() { if (jQuery.ui) { if (jQuery.ui.datepicker) { jQuery(el).datepicker({ "disabled": false, "dateFormat": "dd M yy" }); jQuery('.ui-datepicker').css({ 'font-size': '75%' }); } } }, 100); } }, "editable": true }, { "name": "Type", "index": "Type", "sorttype": "string", "width": 530, "fixed": true, "edittype": "select", "editoptions": { "value": "Comprehensive MA:Comprehensive MA;FOC service, 20% spare part discount:FOC service, 20% spare part discount;Standard Package, FOC 1 time service, 20% spare part discount:Standard Package, FOC 1 time service, 20% spare part discount;Standard Package, FOC 2 time service, 20% spare part discount:Standard Package, FOC 2 time service, 20% spare part discount;Standard Package, FOC 3 time service, 20% spare part discount:Standard Package, FOC 3 time service, 20% spare part discount;Standard Package, FOC 4 time service, 20% spare part discount:Standard Package, FOC 4 time service, 20% spare part discount;Standard Package, FOC 6 time service, 20% spare part discount:Standard Package, FOC 6 time service, 20% spare part discount;Standard Package, no free:Standard Package, no free", "separator": ":", "delimiter": ";" }, "stype": "select", "searchoptions": { "value": ":All;Comprehensive MA:Comprehensive MA;FOC service, 20% spare part discount:FOC service, 20% spare part discount;Standard Package, FOC 1 time service, 20% spare part discount:Standard Package, FOC 1 time service, 20% spare part discount;Standard Package, FOC 2 time service, 20% spare part discount:Standard Package, FOC 2 time service, 20% spare part discount;Standard Package, FOC 3 time service, 20% spare part discount:Standard Package, FOC 3 time service, 20% spare part discount;Standard Package, FOC 4 time service, 20% spare part discount:Standard Package, FOC 4 time service, 20% spare part discount;Standard Package, FOC 6 time service, 20% spare part discount:Standard Package, FOC 6 time service, 20% spare part discount;Standard Package, no free:Standard Package, no free", "separator": ":", "delimiter": ";" }, "editable": true } ], "postData": { "oper": "grid" }, "prmNames": { "page": "page", "rows": "rows", "sort": "sidx", "order": "sord", "search": "_search", "nd": "nd", "id": "maID", "filter": "filters", "searchField": "searchField", "searchOper": "searchOper", "searchString": "searchString", "oper": "oper", "query": "grid", "addoper": "add", "editoper": "edit", "deloper": "del", "excel": "excel", "subgrid": "subgrid", "totalrows": "totalrows", "autocomplete": "autocmpl" }, "loadError": function(xhr, status, err) { try { jQuery.jgrid.info_dialog(jQuery.jgrid.errors.errcap, '<div class="ui-state-error">' + xhr.responseText + '</div>', jQuery.jgrid.edit.bClose, { buttonalign: 'right' } ); } catch(e) { alert(xhr.responseText); } }, "pager": "#pager" }); jQuery('#grid').jqGrid('navGrid', '#pager', { "edit": true, "add": false, "del": false, "search": true, "refresh": true, "view": true, "excel": true, "pdf": true, "csv": false, "columns": false }, { "drag": true, "resize": true, "closeOnEscape": true, "dataheight": "auto", "errorTextFormat": function (r) { return r.responseText; }, "closeAfterEdit": true, "editCaption": "Update Company", "bSubmit": "Update" }, { "drag": true, "resize": true, "closeOnEscape": true, "dataheight": "auto", "errorTextFormat": function (r) { return r.responseText; }, "closeAfterAdd": true, "addCaption": "Add New Company", "bSubmit": "Update" }, { "errorTextFormat": function (r) { return r.responseText; } }, { "drag": true, "closeAfterSearch": true, "multipleSearch": true }, { "drag": true, "resize": true, "closeOnEscape": true, "dataheight": "auto", "Caption": "View Company", "width": "1100" } ); jQuery('#grid').jqGrid('navButtonAdd', '#pager', { id: 'pager_excel', caption: '', title: 'Export To Excel', onClickButton: function (e) { try { jQuery("#grid").jqGrid('excelExport', { tag: 'excel', url: 'session_ma_details.php' }); } catch (e) { window.location = 'session_ma_details.php?oper=excel'; } }, buttonicon: 'ui-icon-newwin' }); jQuery('#grid').jqGrid('navButtonAdd', '#pager', { id: 'pager_pdf', caption: '', title: 'Export To Pdf', onClickButton: function (e) { try { jQuery("#grid").jqGrid('excelExport', { tag: 'pdf', url: 'session_ma_details.php' }); } catch (e) { window.location = 'session_ma_details.php?oper=pdf'; } }, buttonicon: 'ui-icon-print' }); jQuery('#grid').jqGrid('filterToolbar', { "stringResult": true, "searchOnEnter": false, "defaultSearch": "cn" }); jQuery("#getselected").click(function () { var selr = jQuery('#grid').jqGrid('getGridParam', 'selrow'); if (selr) { window.open('http://www.smartouch-cdms.com/order.php?CompanyID=' + selr); } else alert("No selected row"); return false; }); });

  Read the article

• Do any CDN services offer multiple urls (or aliases) for your files?

  - by Jakobud

  Lets say a company has multiple commercial web properties that happen to use a lot of the same images on each site. For SEO reasons, the sites must not appear to be related to eachother in any way. This means that the sites can't all link to the same image, even though they all use the same one. Therefore, an image is uploaded to each site and served from each site separately. In order to improve maintainability and latency, lets say the company wanted to use a CDN service. What I'm wondering is, if you upload a file, like an image or something, to a CDN, is there basically one single URL that you access that image at? Or do some (or all) CDN services offer alias URLs so that you can access the same resource from multiple URLs? Example of undesirable situation: Both sites link to the same file URL Site ABC links to <img src="http://123.cdnservice.com/some-path/myimage.jpg"/> Site XYZ links to <img src="http://123.cdnservice.com/some-path/myimage.jpg"/> Example of DESIRABLE situation: Both sites link to the same file via different URLs Site ABC links to <img src="http://123.cdnservice.com/some-path/myimage.jpg"/> Site XYZ links to <img src="http://123.cdnservice.com/some-alias-path/myimage.jpg"/> So in the end, there is only one single file, myimage.jpg on the CDN server, but it is accessible from multiple URLs. Is this possible with CDN services? I know this would make browsers cache the same image twice, but at least it would be better for maintainability. Only one file would ever have to be uploaded.

  Read the article

• RAID 10 or RAID 5 for multiple VMs - what is the best choice?

  - by Lars Fastrup

  I have just ordered a new rig for my business. We do a lot of software development for Microsoft SharePoint and need the rig to run several virtual machines for development and test purposes. We will be using the free VMware ESXi for virtualization. For a start, we plan to build and start the following VMs - all with Windows Server 2008 R2 x64: Active Directory server MS SQL Server 2008 R2 Automated Build Server SharePoint 2010 Server for hosting our public Web site and our internal Intranet for a few people. The load on this server is going to be quite insignificant. 2xSharePoint 2007 development server 2xSharePoint 2010 development server Beyond that we will need to build several SharePoint farms for testing purposes. These VMs will only be started when needed. The specs of the new rig is: Dell R610 rack server 2xIntel XEON E5620 48GB RAM 6x146GB SAS drives Dell H700 RAID controller We believe the new server is going to make our VMs perform a lot better than our existing setup (2xIntel XEON, 16GB RAM, 2x500 GB SATA in RAID 1). But we are not sure about the RAID level for the new rig. Should we go for having the the 6x146GB SAS drives in a RAID 10 configuration or a RAID 5 configuration? RAID 10 seems to offer better write performance and lower risk of a RAID failure. But it comes at a cost of less drive space. Do we need RAID 10 or would RAID 5 also be a good choice for us?

  Read the article

• Content Management for WebCenter Installation Guide

  - by Gary Niu

  Overvew As we known, there are two way to install Content Management for WebCenter. One way is install it by WebCenter installer wizard, another way is to install it use their own installer. This guide is for the later one. For SSO purpose, I also mentioned how to config OID identity store for Content Management for WebCenter. Content Management for WebCenter( 10.1.3.5.1) Oracle Enterprise Linux R5U4 Basic Installation -bash-3.2$ ./setup.sh Please select your locale from the list.           1. Chinese-Simplified           2. Chinese-Traditional           3. Deutsch          *4. English-US           5. English-UK           6. Español           7. Français           8. Italiano           9. Japanese          10. Korean          11. Nederlands          12. Português-Brazil Choice? Throughout the install, when entering a text value, you can press Enter to accept the default that appears between square brackets ([]). When selecting from a list, you can select the choice followed by an asterisk by pressing Enter. Select installation type from the list.         *1. Install new server          2. Update a server Choice? Content Server Installation Directory Please enter the full pathname to the installation directory. Content Server Core Folder [/oracle/ucm/server]:/opt/oracle/ucm/server Create Directory         *1. yes          2. no Choice? Java virtual machine         *1. Sun Java 1.5.0_11 JDK          2. Specify a custom Java virtual machine Choice? Installing with Java version 1.5.0_11. Enter the location of the native file repository. This directory contains the native files checked in by contributors. Content Server Native Vault Folder [/opt/oracle/ucm/server/vault/]: Create Directory         *1. yes          2. no Choice? Enter the location of the web-viewable file repository. This directory contains files that can be accessed through the web server. Content Server Weblayout Folder [/opt/oracle/ucm/server/weblayout/]: Create Directory         *1. yes          2. no Choice? This server can be configured to manage its own authentication or to allow another master to act as an authentication proxy. Configure this server as a master or proxied server.         *1. Configure as a master server.          2. Configure as server proxied by a local master server. Choice? During installation, an admin server can be installed and configured to manage this server. If there is already an admin server on this system, you can have the installer configure it to administrate this server instead. Select admin server configuration.         *1. Install an admin server to manage this server.          2. Configure an existing admin server to manage this server.          3. Don't configure an admin server. Choice? Enter the location of an executable to start your web browser. This browser will be used to display the online help. Web Browser Path [/usr/bin/firefox]: Content Server System locale           1. Chinese-Simplified           2. Chinese-Traditional           3. Deutsch          *4. English-US           5. English-UK           6. Español           7. Français           8. Italiano           9. Japanese          10. Korean          11. Nederlands          12. Português-Brazil Choice? Please select the region for your timezone from the list.         *1. Use the timezone setting for your operating system          2. Pacific          3. America          4. Atlantic          5. Europe          6. Africa          7. Asia          8. Indian          9. Australia Choice? Please enter the port number that will be used to connect to the Content Server. This port must be otherwise unused. Content Server Port [4444]: Please enter the port number that will be used to connect to the Admin Server. This port must be otherwise unused. Admin Server Port [4440]: Enter a security filter for the server port. Hosts which are allowed to communicate directly with the server port may access any resources managed by the server. Insure that hosts which need access are included in the filter. See the installation guide for more details. Incoming connection address filter [127.0.0.1]:*.*.*.* *** Content Server URL Prefix The URL prefix specified here is used when generating HTML pages that refer to the contents of the weblayout directory within the installation. This prefix must be mapped in the web server Additional Document Directories section of the Content Management administration menu to the physical location of the weblayout directory. For example, "/idc/" would be used in your installation to refer to the URL http://ucm.company.com/idc which would be mapped in the web server to the physical location /oracle/ucm/server/weblayout. Web Server Relative Root [/idc/]: Enter the name of the local mail server. The server will contact this system to deliver email. Company Mail Server [mail]: Enter the e-mail address for the system administrator. Administrator E-Mail Address [sysadmin@mail]: *** Web Server Address Many generated HTML pages refer to the web server you are using. The address specified here will be used when generating those pages. The address should include the host and domain name in most cases. If your webserver is running on a port other than 80, append a colon and the port number. Examples: www.company.com, ucm.company.com:90 Web Server HTTP Address [yekki]:yekki.cn.oracle.com:7777 Enter the name for this instance. This name should be unique across your entire enterprise. It may not contain characters other than letters, numbers, and underscores. Server Instance Name [idc]: Enter a short label for this instance. This label is used on web pages to identify this instance. It should be less than 12 characters long. Server Instance Label [idc]: Enter a long description for this instance. Server Description [Content Server idc]: Web Server         *1. Apache          2. Sun ONE          3. Configure manually Choice? Please select a database from the list below to use with the Content Server. Content Server Database         *1. Oracle          2. Microsoft SQL Server 2005          3. Microsoft SQL Server 2000          4. Sybase          5. DB2          6. Custom JDBC settings          7. Skip database configuration Choice? Manually configure JDBC settings for this database          1. yes         *2. no Choice? Oracle Server Hostname [localhost]: Oracle Listener Port Number [1521]: *** Database User ID The user name is used to log into the database used by the content server. Oracle User [user]:YEKKI_OCSERVER *** Database Password The password is used to log into the database used by the content server. Oracle Password []:oracle Oracle Instance Name [ORACLE]:orcl Configure the JVM to find the JDBC driver in a specific jar file          1. yes         *2. no Choice? The installer can attempt to create the database tables or you can manually create them. If you choose to manually create the tables, you should create them now. Attempt to create database tables          1. yes         *2. no Choice? Select components to install.          1. ContentFolios: Collect related items in folios          2. Folders_g: Organize content into hierarchical folders          3. LinkManager8: Hypertext link management support          4. OracleTextSearch: External Oracle 11g database as search indexer support          5. ThreadedDiscussions: Threaded discussion management Enter numbers separated by commas to toggle, 0 to unselect all, F to finish: 1,2,3,4,5         *1. ContentFolios: Collect related items in folios         *2. Folders_g: Organize content into hierarchical folders         *3. LinkManager8: Hypertext link management support         *4. OracleTextSearch: External Oracle 11g database as search indexer support         *5. ThreadedDiscussions: Threaded discussion management Enter numbers separated by commas to toggle, 0 to unselect all, F to finish: F Checking configuration. . . Configuration OK. Review install settings. . . Content Server Core Folder: /opt/oracle/ucm/server Java virtual machine: Sun Java 1.5.0_11 JDK Content Server Native Vault Folder: /opt/oracle/ucm/server/vault/ Content Server Weblayout Folder: /opt/oracle/ucm/server/weblayout/ Proxy authentication through another server: no Install admin server: yes Web Browser Path: /usr/bin/firefox Content Server System locale: English-US Content Server Port: 4444 Admin Server Port: 4440 Incoming connection address filter: *.*.*.* Web Server Relative Root: /idc/ Company Mail Server: mail Administrator E-Mail Address: sysadmin@mail Web Server HTTP Address: yekki.cn.oracle.com:7777 Server Instance Name: idc Server Instance Label: idc Server Description: Content Server idc Web Server: Apache Content Server Database: Oracle Manually configure JDBC settings for this database: false Oracle Server Hostname: localhost Oracle Listener Port Number: 1521 Oracle User: YEKKI_OCSERVER Oracle Password: 6GP1gBgzSyKa4JW10U8UqqPznr/lzkNn/Ojf6M8GJ8I= Oracle Instance Name: orcl Configure the JVM to find the JDBC driver in a specific jar file: false Attempt to create database tables: no Components: ContentFolios,Folders_g,LinkManager8,OracleTextSearch,ThreadedDiscussions Proceed with install         *1. Proceed          2. Change configuration          3. Recheck the configuration          4. Abort installation Choice? Finished install type Install with warnings at 4/2/10 12:32 AM. Run Scripts -bash-3.2$ ./wc_contentserverconfig.sh /opt/oracle/ucm/server /mnt/hgfs/SOFTWARE/ofm_ucm_generic_10.1.3.5.1_disk1_1of1/ContentServer/webcenter-conf Installing '/mnt/hgfs/SOFTWARE/ofm_ucm_generic_10.1.3.5.1_disk1_1of1/ContentServer/webcenter-conf/CS10gR35UpdateBundle.zip' Service 'DELETE_DOC' Extended Service 'DELETE_BYREV_REVISION' Extended Installing '/mnt/hgfs/SOFTWARE/ofm_ucm_generic_10.1.3.5.1_disk1_1of1/ContentServer/webcenter-conf/ContentAccess/ContentAccess-linux.zip' (internal)      04.02 00:40:38.019      main    updateDocMetaDefinitionV11: adding decimal column Installing '/opt/oracle/ucm/server/custom/CS10gR35UpdateBundle/extras/Folders_g.zip' Installing '/opt/oracle/ucm/server/custom/CS10gR35UpdateBundle/extras/FusionLibraries.zip' Installing '/opt/oracle/ucm/server/custom/CS10gR35UpdateBundle/extras/JpsUserProvider.zip' Installing '/mnt/hgfs/SOFTWARE/ofm_ucm_generic_10.1.3.5.1_disk1_1of1/ContentServer/webcenter-conf/WcConfigure.zip' Apr 2, 2010 12:41:24 AM oracle.security.jps.internal.core.util.JpsConfigUtil getPasswordCredential WARNING: A password credential is expected; instead found . Apr 2, 2010 12:41:24 AM oracle.security.jps.internal.idstore.util.IdentityStoreUtil getUnamePwdFromCredStore WARNING: The credential with map JPS and key ldap.credential does not exist. Apr 2, 2010 12:41:27 AM oracle.security.jps.internal.core.util.JpsConfigUtil getPasswordCredential WARNING: A password credential is expected; instead found . Apr 2, 2010 12:41:27 AM oracle.security.jps.internal.idstore.util.IdentityStoreUtil getUnamePwdFromCredStore WARNING: The credential with map JPS and key ldap.credential does not exist. Apr 2, 2010 12:41:28 AM oracle.security.jps.internal.core.util.JpsConfigUtil getPasswordCredential WARNING: A password credential is expected; instead found . Apr 2, 2010 12:41:28 AM oracle.security.jps.internal.idstore.util.IdentityStoreUtil getUnamePwdFromCredStore WARNING: The credential with map JPS and key ldap.credential does not exist. Restart Content Server to apply updates. Configuring Apache Web Server append the following lines at httpd.conf: include "/opt/oracle/ucm/server/data/users/apache22/apache.conf" Configuring the Identity Store( Optional ) 1.  Stop Oracle Content Server and the Admin Server 2.  Update the Oracle Content Server's JPS configuration file, jps-config.xml: a. add a service instance <serviceInstance provider="idstore.ldap.provider" name="idstore.oid"> <property name="subscriber.name" value="dc=cn,dc=oracle,dc=com"></property> <property name="idstore.type" value="OID"></property> <property name="security.principal.key" value="ldap.credential"></property> <property name="security.principal.alias" value="JPS"></property> <property name="ldap.url" value="ldap://yekki.cn.oracle.com:3060"></property> <extendedProperty> <name>user.search.bases</name> <values> <value>cn=users,dc=cn,dc=oracle,dc=com</value> </values> </extendedProperty> <extendedProperty> <name>group.search.bases</name> <values> <value>cn=groups,dc=cn,dc=oracle,dc=com</value> </values> </extendedProperty> <property name="username.attr" value="uid"></property> <property name="user.login.attr" value="uid"></property> <property name="groupname.attr" value="cn"></property> </serviceInstance> b. Ensure that the <jpsContext> entry in the jps-config.xml file refers to the new serviceInstance, that is, idstore.oid and not idstore.ldap: <jpsContext name="default"> <serviceInstanceRef ref="idstore.oid"/> 3. Run the new script to setup the credentials for idstore.oid in the credential store: cd CONTENT_SERVER_HOME/custom/FusionLibraries/tools -bash-3.2$ ./run_credtool.sh Buildfile: ./../tools/credtool.xml     [input] skipping input as property action has already been set.     [input] Alias: [JPS]     [input] Key: [ldap.credential]     [input] User Name: cn=orcladmin     [input] Password: welcome1     [input] JPS Config: [/opt/oracle/ucm/server/custom/FusionLibraries/tools/../../../config/jps-config.xml] manage-creds:      [echo] @@@ Help: run 'ant manage-creds' command to see the detailed usage      [java] Using default context in /opt/oracle/ucm/server/custom/FusionLibraries/tools/../../../config/jps-config.xml file for credential store.      [java] Credential store location : /opt/oracle/ucm/server/config      [java] Credential with map JPS key ldap.credential stored successfully!      [java]      [java]      [java]     Credential for map JPS and key ldap.credential is:      [java]             PasswordCredential name : cn=orcladmin      [java]             PasswordCredential password : welcome1 BUILD SUCCESSFUL Total time: 1 minute 27 seconds Testing 1. acces http://yekki.cn.oracle.com:7777/idc 2. login in with OID user, for example: orcladmin/welcome1 3. make sure your JpsUserProvider status is "good"

  Read the article

• Linq to Datarow, Select multiple columns as distinct?

  - by Beta033

  basically i'm trying to reproduce the following mssql query as LINQ SELECT DISTINCT [TABLENAME], [COLUMNNAME] FROM [DATATABLE] the closest i've got is Dim query = (From row As DataRow In ds.Tables("DATATABLE").Rows _ Select row("COLUMNNAME") ,row("TABLENAME").Distinct when i do the above i get the error Range variable name can be inferred only from a simple or qualified name with no arguments. i was sort of expecting it to return a collection that i could then iterate through and perform actions for each entry. maybe a datarow collection? As a complete LINQ newb, i'm not sure what i'm missing. i've tried variations on Select new with { row("COLUMNNAME") ,row("TABLENAME")} and get: Anonymous type member name can be inferred only from a simple or qualified name with no arguments. Also, does anyone know of any good books/resources to get fluent?

  Read the article

< Previous Page | 167 168 169 170 171 172 173 174 175 176 177 178  | Next Page >