Search Results

Search found 5968 results on 239 pages for 'generator expression'.

Page 173/239 | < Previous Page | 169 170 171 172 173 174 175 176 177 178 179 180  | Next Page >

  • How to convert source code to a xml based representation of the ast?

    - by autobiographer
    i wanna get a xml representation of the ast of java and c code. 3 months ago, i asked this question yet but the solutions weren't comfortable for me srcml seems to be a good solution for this problem but it does not support line numbers and columns but i need that feature. about elsa: cite: "There is ongoing effort to export the Elsa AST as an XML document; we expect to be able to advertise this in the next public release." dms... didn't understand that. especially for java, there is javaml which supports line numbers. but the sourceforge page doesn't list any files. question: there's software available which supports conversion of ast into xml which supports line numbers (and columns) [especially for java and c/c++]? is there an alternative to javaml and srcml? ps: i don't wanne have parser generators. i hope to find a tool which can be used on the console typing: ./my-xml-generator Test.java [or something like that]... or a java implementation would be great too.

    Read the article

  • Javascript substrings multiline replace by RegExp

    - by Radek Šimko
    Hi, I'm having some troubles with matching a regular expression in multi-line string. <script> var str="Welcome to Google!\n"; str = str + "We are proud to announce that Microsoft has \n"; str = str + "one of the worst Web Developers sites in the world."; document.write(str.replace(/.*(microsoft).*/gmi, "$1")); </script> http://jsbin.com/osoli3/3/edit As you may see on the link above, the output of the code looks like this: Welcome to Google! Microsoft one of the worst Web Developers sites in the world. Which means, that the replace() method goes line by line and if there's no match in that line, it returns just the whole line... Even if it has the "m" (multiline) modifier...

    Read the article

  • Error: A SQLParamenter wtih ParameterName @myparm is not contained by this SQLParameter Collection

    - by SidC
    Good Morning, I'm working on an ASP.NET 3.5 webforms application and have written the following code: Protected Sub btnSubmit_Click(ByVal sender As Object, ByVal e As System.EventArgs) Handles btnSubmit.Click Dim connectionString As String = WebConfigurationManager.ConnectionStrings("Diel_inventoryConnectionString").ConnectionString Dim con As New SqlConnection(connectionString) Dim adapter1 As New SqlDataAdapter adapter1.SelectCommand = New SqlCommand adapter1.SelectCommand.CommandType = CommandType.StoredProcedure adapter1.SelectCommand.CommandText = "PartSproc" Dim parmNSN As New SqlParameter("@NSN", SqlDbType.NVarChar) Dim parmName As New SqlParameter("@PartName", SqlDbType.NVarChar) txtNSN.Text = adapter1.SelectCommand.Parameters("@NSN").Value txtSearch.Text = adapter1.SelectCommand.Parameters("@PartName").Value Dim dt As New DataTable() adapter1.Fill(dt) MySearch.DataSource = dt MySearch.DataBind() End Sub When I run the page, I receive the error A SQLParameter with @NSN is not contained by this SQLParameter Collection. I tried using apostrophes around the @NSN and @PartName but that does not work either and presents expression expected error. How might I rectify the above code so that it references the @NSN and @PartName parameters correctly? Thanks, Sid

    Read the article

  • Do I need to include the 'this' when using a property name in a closure?

    - by Scott Whitlock
    I'm using a list of Actions to store an undo history for an object. Let's say I have a property of my object called myChildObject and it's being changed, so I want to store the undo action where I would set it back to it's current value: public class Class1 { public Class1() { } private readonly List<Action> m_undoActions = new List<Action>(); private SomeObject myChildObject { get; set; } public void ChangeState(SomeObject newChildObject) { // copies the reference SomeObject existingObject = myChildObject; m_undoActions.Add(() => myChildObject = existingObject); myChildObject = newChildObject; } } Looking at the lambda expression, existingObject is a local variable, so it's using a closure to pass a reference to that variable, but what about the property myChildObject? Do I need to use 'this' to preface it? Do I need to make a copy of the 'this' reference to a local variable first? Thanks for helping me understand this closure stuff.

    Read the article

  • Create xml file to be used in wordpress post import

    - by adedoy
    Alright here is the thing, I have this site that was once wordpress but have been converted into 70+ static pages, the admin is deleted and the whole site is static(which means every page is in index.html), I want to create a script that makes an xml so that I will just have to import it in the new wordpress install. So far, I am able to create an XML but it only imports one post. The data source is the URL of a page and I use jquery $get to filter only to gather the post of a given archive. //html <input type="text" class="full_path"> <input type="button" value="Get Data" class="getdata"> //script $('.getdata').click(function(){ $.get($('.full_path').val(), function(data) { post = $(data).find('div [style*="width:530px;"]'); $('.result').html(post.html()); }); });//get Data Through AJAX I send the cleaned data into a php below that creates the XML: $file = 'newpost.xml'; $post_data = $_REQUEST['post_data']; // Open the file to get existing content $current = file_get_contents($file); // Append a new post to the file $catStr = ''; if(isset($post_data['categories']) && count($post_data['categories']) > 0){ foreach($post_data['categories'] as $category) { $catStr .= '<category domain="category" nicename="'.$category.'"><![CDATA['.$category.']]></category>'; } } $tagStr = ''; if(isset($post_data['tags']) && count($post_data['tags']) > 0){ foreach($post_data['tags'] as $tag) { $tagStr = '<category domain="post_tag" nicename="'.$tag.'"><![CDATA['.$tag.']]></category>'; } } $post_name = str_replace(' ','-',$post_data["title"]); $post_name = str_replace(array('"','/',':','.',',','[',']','“','”'),'',strtolower($post_name)); $post_date = '2011-4-0'.rand(1, 29).''.rand(1, 12).':'.rand(1, 59).':'.rand(1, 59); $pubTime = rand(1, 12).':'.rand(1, 59).':'.rand(1, 59).' +0000'; $post = ' <item> <title>'.$post_data["title"].'</title> <link>'.$post_data["link"].'</link> <pubDate>'.$post_data["date"].' '.$pubTime.'</pubDate> <dc:creator>admin</dc:creator> <guid isPermaLink="false">http://localhost/saunders/?p=1</guid> <description></description> <content:encoded><![CDATA['.$post_data["content"].']]></content:encoded> <excerpt:encoded><![CDATA[]]></excerpt:encoded> <wp:post_id>1</wp:post_id> <wp:post_date>'.$post_date.'</wp:post_date> <wp:post_date_gmt>'.$post_date.'</wp:post_date_gmt> <wp:comment_status>open</wp:comment_status> <wp:ping_status>open</wp:ping_status> <wp:post_name>'.$post_name.'</wp:post_name> <wp:status>publish</wp:status> <wp:post_parent>0</wp:post_parent> <wp:menu_order>0</wp:menu_order> <wp:post_type>post</wp:post_type> <wp:post_password></wp:post_password> <wp:is_sticky>0</wp:is_sticky> '.$catStr.' '.$tagStr.' <wp:postmeta> <wp:meta_key>_edit_last</wp:meta_key> <wp:meta_value><![CDATA[1]]></wp:meta_value> </wp:postmeta> </item> '; // Write the contents back to the file with the appended post file_put_contents($file, $current.$post); After being appended I add the code below to complete the xml rss tag </channel> </rss> If I look and compare the xml file of one that is exported from a wordpress site, I see little difference. Please HELP!! here is a sample of a generated xml: <?xml version="1.0" encoding="UTF-8" ?> <rss version="2.0" xmlns:excerpt="http://wordpress.org/export/1.2/excerpt/" xmlns:content="http://purl.org/rss/1.0/modules/content/" xmlns:wfw="http://wellformedweb.org/CommentAPI/" xmlns:dc="http://purl.org/dc/elements/1.1/" xmlns:wp="http://wordpress.org/export/1.2/" > <channel> <title>lols why</title> <link>http://localhost/lols</link> <description>Just another WordPress site</description> <pubDate>Wed, 03 Oct 2012 04:24:04 +0000</pubDate> <language>en-US</language> <wp:wxr_version>1.2</wp:wxr_version> <wp:base_site_url>http://localhost/lols</wp:base_site_url> <wp:base_blog_url>http://localhost/lols</wp:base_blog_url> <wp:author><wp:author_id>1</wp:author_id><wp:author_login>adedoy</wp:author_login><wp:author_email>[email protected]</wp:author_email><wp:author_display_name><![CDATA[adedoy]]></wp:author_display_name><wp:author_first_name><![CDATA[]]></wp:author_first_name><wp:author_last_name><![CDATA[]]></wp:author_last_name></wp:author> <generator>http://wordpress.org/?v=3.4.1</generator> <item> <title>Sample lift?</title> <link>../../breast-lift/delaware-breast-surgery-do-i-need-a-breast-lift/</link> <pubDate>Wed, 03 Oct 2012 9:29:16 +0000</pubDate> <dc:creator>admin</dc:creator> <guid isPermaLink="false">http://localhost/lols/?p=1</guid> <description></description> <content:encoded><![CDATA[<p>sample</p>]]></content:encoded> <excerpt:encoded><![CDATA[]]></excerpt:encoded> <wp:post_id>1</wp:post_id> <wp:post_date>2011-4-0132:45:4</wp:post_date> <wp:post_date_gmt>2011-4-0132:45:4</wp:post_date_gmt> <wp:comment_status>open</wp:comment_status> <wp:ping_status>open</wp:ping_status> <wp:post_name>sample-lift?</wp:post_name> <wp:status>publish</wp:status> <wp:post_parent>0</wp:post_parent> <wp:menu_order>0</wp:menu_order> <wp:post_type>post</wp:post_type> <wp:post_password></wp:post_password> <wp:is_sticky>0</wp:is_sticky> <category domain="category" nicename="Sample Lift"><![CDATA[Sample Lift]]></category><category domain="category" nicename="Sample Procedures"><![CDATA[Yeah Procedures]]></category> <category domain="post_tag" nicename="delaware"><![CDATA[delaware]]></category> <wp:postmeta> <wp:meta_key>_edit_last</wp:meta_key> <wp:meta_value><![CDATA[1]]></wp:meta_value> </wp:postmeta> </item> <item> <title>lalalalalala</title> <link>../../administrative-tips-for-surgery/delaware-cosmetic-surgery-a-better-experience/</link> <pubDate>Wed, 03 Oct 2012 3:20:43 +0000</pubDate> <dc:creator>admin</dc:creator> <guid isPermaLink="false">http://localhost/lols/?p=1</guid> <description></description> <content:encoded><![CDATA[ lalalalalala ]]></content:encoded> <excerpt:encoded><![CDATA[]]></excerpt:encoded> <wp:post_id>1</wp:post_id> <wp:post_date>2011-4-0124:39:30</wp:post_date> <wp:post_date_gmt>2011-4-0124:39:30</wp:post_date_gmt> <wp:comment_status>open</wp:comment_status> <wp:ping_status>open</wp:ping_status> <wp:post_name>lalalalalala</wp:post_name> <wp:status>publish</wp:status> <wp:post_parent>0</wp:post_parent> <wp:menu_order>0</wp:menu_order> <wp:post_type>post</wp:post_type> <wp:post_password></wp:post_password> <wp:is_sticky>0</wp:is_sticky> <category domain="category" nicename="lalalalalala"><![CDATA[lalalalalala]]></category> <category domain="post_tag" nicename="oink"><![CDATA[oink]]></category> <wp:postmeta> <wp:meta_key>_edit_last</wp:meta_key> <wp:meta_value><![CDATA[1]]></wp:meta_value> </wp:postmeta> </item> </channel> </rss> Please tell me what am I missing....

    Read the article

  • asp.net databinding string is passed to function but runtime occurs

    - by rod
    Hi All, I'm using a code-behind function (called TestFx) in my binding expression. I'm passing a string and the function accepts a string but I still get a runtime error saying invalid args. But if I change the method to accept an object and inspect the value, "it's a string!" Can someone please explain? -rod ProductDescription: <asp:Label ID="ProductDescriptionLabel" runat="server" Text='<%# TestFx(Eval("ProductDescription")) %>' /> <br />

    Read the article

  • In Haskell, how can you sort a list of infinite lists of strings?

    - by HaskellNoob
    So basically, if I have a (finite or infinite) list of (finite or infinite) lists of strings, is it possible to sort the list by length first and then by lexicographic order, excluding duplicates? A sample input/output would be: Input: [["a", "b",...], ["a", "aa", "aaa"], ["b", "bb", "bbb",...], ...] Output: ["a", "b", "aa", "bb", "aaa", "bbb", ...] I know that the input list is not a valid haskell expression but suppose that there is an input like that. I tried using merge algorithm but it tends to hang on the inputs that I give it. Can somebody explain and show a decent sorting function that can do this? If there isn't any function like that, can you explain why? In case somebody didn't understand what I meant by the sorting order, I meant that shortest length strings are sorted first AND if one or more strings are of same length then they are sorted using < operator. Thanks!

    Read the article

  • Can't enumerate LinQ results with left join

    - by nvtthang
    var itemSet = from item in da.GetList<Models.account>() join file in objFileStorageList on item.account_id equals file.parent_id into objFile from fileItem in objFile.DefaultIfEmpty() where item.company != null && item.company.company_id == 123 orderby item.updatedDate descending select new { Id = item.account_id, RefNo = item.refNo, StartDate = item.StartDate , EndDate = item.EndDate , Comment = item.comment, FileStorageID = fileItem != null ? fileItem.fileStorage_id : -1, Identification = fileItem != null ? fileItem.identifier : null, fileName = fileItem != null ? fileItem.file_nm : null }; It raises error message when I try to enumerate through collection result from Linq query above. LINQ to Entities does not recognize the method 'System.Collections.Generic.IEnumerable1[SCEFramework.Models.fileStorage] DefaultIfEmpty[fileStorage](System.Collections.Generic.IEnumerable1[SCEFramework.Models.fileStorage])' method, and this method cannot be translated into a store expression foreach (var item in itemSet) { string itemRef= item.RefNo; } Please suggest me any solutions. Thanks in advance.

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • Delphi component or library to display mathematical expressions

    - by Svein Bringsli
    I'm looking for a simple component that displays mathematical expressions in Delphi. When I started out I thought it would be easy to find something on the net, but it turns out it was harder than anticipated. There are lots and lots of components that will parse mathematical expressions, but few (none?) that will display them. Ideally I would like a component as simple as a TLabel, where I could set the caption to some expression and it would be displayed correctly, but some sort of library that let's me draw expressions to a canvas would also be sufficient for my needs. Update: I'm not talking about plotting graphs of functions or something like that. I want to display (for instance) (X^2+3)/X like this:

    Read the article

  • PostgreSQL String search for partial patterns removing exrtaneous characters

    - by tbrandao
    Looking for a simple SQL (PostgreSQL) regular expression or similar solution (maybe soundex) that will allow a flexible search. So that dashes, spaces and such are omitted during the search. As part of the search and only the raw characters are searched in the table.: Currently using: SELECT * FROM Productions WHERE part_no ~* '%search_term%' If user types UTR-1 it fails to bring up UTR1 or UTR 1 stored in the database. But the matches do not happen when a part_no has a dash and the user omits this character (or vice versa) EXAMPLE search for part UTR-1 should find all matches below. UTR1 UTR --1 UTR 1 any suggestions...

    Read the article

  • a question on webpage data scraping using Java

    - by Gemma
    Hi there. I am now trying to implement a simple HTML webpage scraper using Java.Now I have a small problem. Suppose I have the following HTML fragment. <div id="sr-h-left" class="sr-comp"> <a class="link-gray-underline" id="compare_header" rel="nofollow" href="javascript:i18nCompareProd('/serv/main/buyer/ProductCompare.jsp?nxtg=41980a1c051f-0942A6ADCF43B802'); " Compare Showing 1 - 30 of 1,439 matches, The data I am interested is the integer 1.439 shown at the bottom.I am just wondering how can I get that integer out of the HTML. I am now considering using a regular expression,and then use the java.util.Pattern to help get the data out,but still not very clear about the process. I would be grateful if you guys could give me some hint or idea on this data scraping. Thanks a lot.

    Read the article

  • Visual Studio confused by server code inside javascript

    - by Felix
    I ran into an annoying problem: the following code gives a warning in Visual Studio. <script type="text/javascript"> var x = <%: ViewData["param"] %>; </script> The warning is "Expected expression". Visual Studion gets confused, and all the javascript code after that is giving tons of warnings. Granted, it's all warnings, and it works perfectly fine in runtime - but it is very easy to miss real warnings among dozen of false positives. It was working the same way in VS2008, and it wasn't fixed in VS2010. Does anybody know if there is a workaround, or a patch?

    Read the article

  • Eclipse keyword highlighting in in my own text editor

    - by Torok Balint
    I made a simple text editor in eclipse to which I added some simple WordRule based syntax highlighting to highlight the language keywords. The problem is that when a keyword is part of an identifier (eg. "import" is part of "extra_import"), then "import" is highlighted in "extra_import". How can I stop eclipse to highlight a a keyword if it is only a sub string of another string? Anlther question; is there a regular expression based IRule? What is the purpose of WhitespaceRule? White spaces are usually not highlighted. Thaks

    Read the article

  • Looping through list items with jquery

    - by Gallen
    I have this block of code listItems = $("#productList").find("li"); for (var li in listItems) { var product = $(li); var productid = product.children(".productId").val(); var productPrice = product.find(".productPrice").val(); var productMSRP = product.find(".productMSRP").val(); totalItemsHidden.val(parseInt(totalItemsHidden.val(), 10) + 1); subtotalHidden.val(parseFloat(subtotalHidden.val()) + parseFloat(productMSRP)); savingsHidden.val(parseFloat(savingsHidden.val()) + parseFloat(productMSRP - productPrice)); totalHidden.val(parseFloat(totalHidden.val()) + parseFloat(productPrice)); } and I'm not getting the desired results - totalItems is coming out as 180+ and the rest all NaN. I suspect its where i use var product = $(li); or perhaps with the expression on the loop itself. Either way - I need to loop through the <li> items in the <ul> labelled #productList

    Read the article

  • Tentative date casting in tsql

    - by Tewr
    I am looking for something like TRYCAST in TSQL or an equivalent method / hack. In my case I am extracting some date data from an xml column. The following query throws "Arithmetic overflow error converting expression to data type datetime." if the piece of data found in the xml cannot be converted to datetime (in this specific case, the date is "0001-01-01" in some cases). Is there a way to detect this exception before it occurs? select [CustomerInfo].value('(//*:InceptionDate/text())[1]', 'datetime') FROM Customers An example of what I am trying to achieve in pseudocode with an imagined tsql function TRYCAST(expr, totype, defaultvalue): select TRYCAST( [CustomerInfo].value('(//*:InceptionDate/text())[1]', 'nvarchar(100)'), datetime, null) FROM Customers

    Read the article

  • Where to post code for open source usage?

    - by Douglas
    I've been working for a few weeks now with the Google Maps API v3, and have done a good bit of development for the map I've been creating. Some of the things I've done have had to be done to add usability where there previously was not any, at least not that I could find online. Essentially, I made a list of what had to be done, searched all over the web for the ways to do what I needed, and found that some were not(at the time) possible(in the "grab an example off the web" sense). Thus, in my working on this map, I have created a number of very useful tools, which I would like to share with the development community. Is there anywhere I could use as a hub, apart from my portfolio ( http://dougglover.com ), to allow people to view and recycle my work? I know how hard it can be to need to do something, and be unable to find the solution elsewhere, and I don't think that if something has been done before, it should necessarily need to be written again and again. Hence open source code, right? Firstly, I was considering coming on here and asking a question, and then just answering it. Problem there is I assume that would just look like a big reputation grab. If not, please let me know and I'll go ahead and do that so people here can see it. Other suggestions appreciated. Some stuff I've made: A (new and improved) LatLng generator Works quicker, generates LatLng based on position of a draggable marker Allows searching for an address to place the marker on/near the desired location(much better than having to scroll to your location all the way from Siberia) Since it's a draggable marker, double-clicking zooms in, instead of creating a new LatLng marker like the one I was originally using The ability to create entirely custom "Smart Paths" Plot LatLng points on the map which connect to each other just like they do using the actual Google Maps Using Dijkstra's algorithm with Javascript, the routing is intelligent and always gives the shortest possible route, using the points provided Simple, easy to read multi-dimensional array system allows for easily adding new points to the grid Any suggestions, etc. appreciated.

    Read the article

  • Ordering by formula fields in NHibernate

    - by Darin Dimitrov
    Suppose that I have the following mapping with a formula property: <class name="Planet" table="planets"> <id name="Id" column="id"> <generator class="native" /> </id> <!-- somefunc() is a native SQL function --> <property name="Distance" formula="somefunc()" /> </class> I would like to get all planets and order them by the Distance calculated property: var planets = session .CreateCriteria<Planet>() .AddOrder(Order.Asc("Distance")) .List<Planet>(); This is translated to the following query: SELECT Id as id0, somefunc() as formula0 FROM planets ORDER BY somefunc() Desired query: SELECT Id as id0, somefunc() as formula0 FROM planets ORDER BY formula0 If I set a projection with an alias it works fine: var planets = session .CreateCriteria<Planet>() .SetProjection(Projections.Alias(Projections.Property("Distance"), "dist")) .AddOrder(Order.Asc("dist")) .List<Planet>(); SQL: SELECT somefunc() as formula0 FROM planets ORDER BY formula0 but it populates only the Distance property in the result and I really like to avoid projecting manually over all the other properties of my object (there could be many other properties). Is this achievable with NHibernate? As a bonus I would like to pass parameters to the native somefunc() SQL function. Anything producing the desired SQL is acceptable (replacing the formula field with subselects, etc...), the important thing is to have the calculated Distance property in the resulting object and order by this distance inside SQL.

    Read the article

  • Is it possible to create thread-safe collections without locks?

    - by Andrey
    This is pure just for interest question, any sort of questions are welcome. So is it possible to create thread-safe collections without any locks? By locks I mean any thread synchronization mechanisms, including Mutex, Semaphore, and even Interlocked, all of them. Is it possible at user level, without calling system functions? Ok, may be implementation is not effective, i am interested in theoretical possibility. If not what is the minimum means to do it? EDIT: Why immutable collections don't work. This of class Stack with methods Add that returns another Stack. Now here is program: Stack stack = new ...; ThreadedMethod() { loop { //Do the loop stack = stack.Add(element); } } this expression stack = stack.Add(element) is not atomic, and you can overwrite new stack from other thread. Thanks, Andrey

    Read the article

  • Assigning an @Annotation enum a value

    - by h2g2java
    I created enum Restrictions{ none, enumeration, fractionDigits, length, maxExclusive, maxInclusive, maxLength, minExclusive, minInclusive, minLength, pattern, totalDigits, whiteSpace; public Restrictions setValue(int value){ this.value = value; return this; } public int value; } So that I could happily do something like this, which is perfectly legal syntax. Restrictions r1 = Restrictions.maxLength.setValue(64); The reason being is, I am using enum to restrict the type of restriction that could be used, and be able to assign a value to that restriction. However, my actual motivation is to use that restriction in an @annotation. @Retention(RetentionPolicy.RUNTIME) @Target({ElementType.TYPE, ElementType.FIELD, ElementType.METHOD}) public @interface Presentable { Restrictions[] restrictions() default Restrictions.none; } So that, I intended to do this: @Presentable(restrictions=Restrictions.maxLength.setValue(64)) public String userName; to which, the compiler croaks The value for annotation enum attribute must be an enum constant expression. Is there a way to accomplish what I wish to accomplish

    Read the article

  • Get latest sql rows based on latest date and per user

    - by Umair
    I have the following table: RowId, UserId, Date 1, 1, 1/1/01 2, 1, 2/1/01 3, 2, 5/1/01 4, 1, 3/1/01 5, 2, 9/1/01 I want to get the latest records based on date and per UserId but as a part of the following query (due to a reason I cannot change this query as this is auto generated by a tool but I can write pass any thing starting with AND...): SELECT RowId, UserId, Date FROM MyTable WHERE 1 = 1 AND ( // everything which needs to be done goes here . . . ) I have tried similar query, but get an error: Only one expression can be specified in the select list when the subquery is not introduced with EXISTS.

    Read the article

  • Redirect www.example.com/apple to food.example.com/fruits/apple

    - by Senthil
    I want to redirect users from www.example.com/apple to http://food.example.com/fruits/apple Note: This is a hardcoded redirection. Even a mapping if you will. "apple" will not be substituted with anything else. Nothing in the two URLs will change except for the domain of course. So there is no need for a regular expression to match the "apple" or anything else. There is already dozens of RewriteCond and RewriteRule things in the .htaccess file. I do not want them to be affected. This redirection is independent of those. I have access to the .htaccess file at the root of www.example.com and the httpd.conf What code should I put in .htaccess in order to achieve this? Or should I change the httpd.conf?

    Read the article

  • Is it possible to use DLR in a .NET 3.5 website project?

    - by Aplato
    I'm trying to evaluate an expression stored in a database i.e. "if (Q1 ==2) {result = 3.1;} elseif (Q1 ==3){result=4.1;} else result = 5.9;" Rather than parsing it myself I'm trying to use the DLR. I'm using version .92 from the Codeplex repository and my solution is a .NET 3.5 website; and I'm having conflicts between the System.Core and Microsoft.Scripting.ExtenstionAttribute .dll's. Error = { Description: "'ExtensionAttribute' is ambiguous in the namespace 'System.Runtime.CompilerServices'.", File: "InternalXmlHelper.vb" } At this time I cannot upgrade to .NET 4.0 and make significant use of the .net 3.5 features (so downgrading is not an option). Any help greatly appreciated.

    Read the article

  • SQL Server T-SQL statement to replace/delete sub-strings

    - by StefanE
    Hi, I have a table with 6 columns containing HTML content with some markups in it and now when moving to a new designed site most of this HTML code has to be deleted. More or less all tags except <B> and </B>. Is there a nice way of doing this, identify all tags end delete them within the data? I'm sure there are no < symbols in the test so a regular expression would maybe work? My alternative is to fetch every row, process it and update the database but I'm guessing this is possible to do in T-SQL directly. My server is an MSSQL 2008 and is located in a hosted environment but I can fetch a local copy if needed. Thanks, Stefan

    Read the article

  • ngModel and component with isolated scope

    - by Artem Andreev
    I am creating simple ui-datetime directive. It splits javascript Date object into _date, _hours and _minutes parts. _date uses jquery ui datepicker, _hours and _minutes - number inputs. See example: http://jsfiddle.net/andreev_artem/nWsZp/3/ On github: https://github.com/andreev-artem/angular_experiments/tree/master/ui-datetime As far as I understand - best practice when you create a new component is to use isolated scope. When I tried to use isolated scope - nothing works. ngModel.$viewValue === undefined. When I tried to use new scope (my example, not so good variant imho) - ngModel uses value on newly created scope. Of course I can create directive with isolated scope and work with ngModel value through "=expression" (example). But I think that working with ngModelController is a better practice. My questions: Can I use ngModelController with isolated scope? If it is not possible which solution is better for creating such component?

    Read the article

< Previous Page | 169 170 171 172 173 174 175 176 177 178 179 180  | Next Page >