Search Results

Search found 5968 results on 239 pages for 'generator expression'.

Page 173/239 | < Previous Page | 169 170 171 172 173 174 175 176 177 178 179 180  | Next Page >

  • Setting an Excel Range with an Array using Python and comtypes?

    - by technomalogical
    Using comtypes to drive Python, it seems some magic is happening behind the scenes that is not converting tuples and lists to VARIANT types: # RANGE(“C14:D21”) has values # Setting the Value on the Range with a Variant should work, but # list or tuple is not getting converted properly it seems >>>from comtypes.client import CreateObject >>>xl = CreateObject("Excel.application") >>>xl.Workbooks.Open(r'C:\temp\my_file.xlsx') >>>xl.Visible = True >>>vals=tuple([(x,y) for x,y in zip('abcdefgh',xrange(8))]) # creates: #(('a', 0), ('b', 1), ('c', 2), ('d', 3), ('e', 4), ('f', 5), ('g', 6), ('h', 7)) >>>sheet = xl.Workbooks[1].Sheets["Sheet1"] >>>sheet.Range["C14","D21"].Value() (('foo',1),('foo',2),('foo',3),('foo',4),('foo',6),('foo',6),('foo',7),('foo',8)) >>>sheet.Range["C14","D21"].Value[()] = vals # no error, this blanks out the cells in the Range According to the comtypes docs: When you pass simple sequences (lists or tuples) as VARIANT parameters, the COM server will receive a VARIANT containing a SAFEARRAY of VARIANTs with the typecode VT_ARRAY | VT_VARIANT. This seems to be inline with what MSDN says about passing an array to a Range's Value. I also found this page showing something similar in C#. Can anybody tell me what I'm doing wrong? EDIT I've come up with a simpler example that performs the same way (in that, it does not work): >>>from comtypes.client import CreateObject >>>xl = CreateObject("Excel.application") >>>xl.Workbooks.Add() >>>sheet = xl.Workbooks[1].Sheets["Sheet1"] # at this point, I manually typed into the range A1:B3 >>> sheet.Range("A1","B3").Value() ((u'AAA', 1.0), (u'BBB', 2.0), (u'CCC', 3.0)) >>>sheet.Range("A1","B3").Value[()] = [(x,y) for x,y in zip('xyz',xrange(3))] # Using a generator expression, per @Mike's comment # However, this still blanks out my range :(

    Read the article

  • PostgreSQL String search for partial patterns removing exrtaneous characters

    - by tbrandao
    Looking for a simple SQL (PostgreSQL) regular expression or similar solution (maybe soundex) that will allow a flexible search. So that dashes, spaces and such are omitted during the search. As part of the search and only the raw characters are searched in the table.: Currently using: SELECT * FROM Productions WHERE part_no ~* '%search_term%' If user types UTR-1 it fails to bring up UTR1 or UTR 1 stored in the database. But the matches do not happen when a part_no has a dash and the user omits this character (or vice versa) EXAMPLE search for part UTR-1 should find all matches below. UTR1 UTR --1 UTR 1 any suggestions...

    Read the article

  • Error: A SQLParamenter wtih ParameterName @myparm is not contained by this SQLParameter Collection

    - by SidC
    Good Morning, I'm working on an ASP.NET 3.5 webforms application and have written the following code: Protected Sub btnSubmit_Click(ByVal sender As Object, ByVal e As System.EventArgs) Handles btnSubmit.Click Dim connectionString As String = WebConfigurationManager.ConnectionStrings("Diel_inventoryConnectionString").ConnectionString Dim con As New SqlConnection(connectionString) Dim adapter1 As New SqlDataAdapter adapter1.SelectCommand = New SqlCommand adapter1.SelectCommand.CommandType = CommandType.StoredProcedure adapter1.SelectCommand.CommandText = "PartSproc" Dim parmNSN As New SqlParameter("@NSN", SqlDbType.NVarChar) Dim parmName As New SqlParameter("@PartName", SqlDbType.NVarChar) txtNSN.Text = adapter1.SelectCommand.Parameters("@NSN").Value txtSearch.Text = adapter1.SelectCommand.Parameters("@PartName").Value Dim dt As New DataTable() adapter1.Fill(dt) MySearch.DataSource = dt MySearch.DataBind() End Sub When I run the page, I receive the error A SQLParameter with @NSN is not contained by this SQLParameter Collection. I tried using apostrophes around the @NSN and @PartName but that does not work either and presents expression expected error. How might I rectify the above code so that it references the @NSN and @PartName parameters correctly? Thanks, Sid

    Read the article

  • Create xml file to be used in wordpress post import

    - by adedoy
    Alright here is the thing, I have this site that was once wordpress but have been converted into 70+ static pages, the admin is deleted and the whole site is static(which means every page is in index.html), I want to create a script that makes an xml so that I will just have to import it in the new wordpress install. So far, I am able to create an XML but it only imports one post. The data source is the URL of a page and I use jquery $get to filter only to gather the post of a given archive. //html <input type="text" class="full_path"> <input type="button" value="Get Data" class="getdata"> //script $('.getdata').click(function(){ $.get($('.full_path').val(), function(data) { post = $(data).find('div [style*="width:530px;"]'); $('.result').html(post.html()); }); });//get Data Through AJAX I send the cleaned data into a php below that creates the XML: $file = 'newpost.xml'; $post_data = $_REQUEST['post_data']; // Open the file to get existing content $current = file_get_contents($file); // Append a new post to the file $catStr = ''; if(isset($post_data['categories']) && count($post_data['categories']) > 0){ foreach($post_data['categories'] as $category) { $catStr .= '<category domain="category" nicename="'.$category.'"><![CDATA['.$category.']]></category>'; } } $tagStr = ''; if(isset($post_data['tags']) && count($post_data['tags']) > 0){ foreach($post_data['tags'] as $tag) { $tagStr = '<category domain="post_tag" nicename="'.$tag.'"><![CDATA['.$tag.']]></category>'; } } $post_name = str_replace(' ','-',$post_data["title"]); $post_name = str_replace(array('"','/',':','.',',','[',']','“','”'),'',strtolower($post_name)); $post_date = '2011-4-0'.rand(1, 29).''.rand(1, 12).':'.rand(1, 59).':'.rand(1, 59); $pubTime = rand(1, 12).':'.rand(1, 59).':'.rand(1, 59).' +0000'; $post = ' <item> <title>'.$post_data["title"].'</title> <link>'.$post_data["link"].'</link> <pubDate>'.$post_data["date"].' '.$pubTime.'</pubDate> <dc:creator>admin</dc:creator> <guid isPermaLink="false">http://localhost/saunders/?p=1</guid> <description></description> <content:encoded><![CDATA['.$post_data["content"].']]></content:encoded> <excerpt:encoded><![CDATA[]]></excerpt:encoded> <wp:post_id>1</wp:post_id> <wp:post_date>'.$post_date.'</wp:post_date> <wp:post_date_gmt>'.$post_date.'</wp:post_date_gmt> <wp:comment_status>open</wp:comment_status> <wp:ping_status>open</wp:ping_status> <wp:post_name>'.$post_name.'</wp:post_name> <wp:status>publish</wp:status> <wp:post_parent>0</wp:post_parent> <wp:menu_order>0</wp:menu_order> <wp:post_type>post</wp:post_type> <wp:post_password></wp:post_password> <wp:is_sticky>0</wp:is_sticky> '.$catStr.' '.$tagStr.' <wp:postmeta> <wp:meta_key>_edit_last</wp:meta_key> <wp:meta_value><![CDATA[1]]></wp:meta_value> </wp:postmeta> </item> '; // Write the contents back to the file with the appended post file_put_contents($file, $current.$post); After being appended I add the code below to complete the xml rss tag </channel> </rss> If I look and compare the xml file of one that is exported from a wordpress site, I see little difference. Please HELP!! here is a sample of a generated xml: <?xml version="1.0" encoding="UTF-8" ?> <rss version="2.0" xmlns:excerpt="http://wordpress.org/export/1.2/excerpt/" xmlns:content="http://purl.org/rss/1.0/modules/content/" xmlns:wfw="http://wellformedweb.org/CommentAPI/" xmlns:dc="http://purl.org/dc/elements/1.1/" xmlns:wp="http://wordpress.org/export/1.2/" > <channel> <title>lols why</title> <link>http://localhost/lols</link> <description>Just another WordPress site</description> <pubDate>Wed, 03 Oct 2012 04:24:04 +0000</pubDate> <language>en-US</language> <wp:wxr_version>1.2</wp:wxr_version> <wp:base_site_url>http://localhost/lols</wp:base_site_url> <wp:base_blog_url>http://localhost/lols</wp:base_blog_url> <wp:author><wp:author_id>1</wp:author_id><wp:author_login>adedoy</wp:author_login><wp:author_email>[email protected]</wp:author_email><wp:author_display_name><![CDATA[adedoy]]></wp:author_display_name><wp:author_first_name><![CDATA[]]></wp:author_first_name><wp:author_last_name><![CDATA[]]></wp:author_last_name></wp:author> <generator>http://wordpress.org/?v=3.4.1</generator> <item> <title>Sample lift?</title> <link>../../breast-lift/delaware-breast-surgery-do-i-need-a-breast-lift/</link> <pubDate>Wed, 03 Oct 2012 9:29:16 +0000</pubDate> <dc:creator>admin</dc:creator> <guid isPermaLink="false">http://localhost/lols/?p=1</guid> <description></description> <content:encoded><![CDATA[<p>sample</p>]]></content:encoded> <excerpt:encoded><![CDATA[]]></excerpt:encoded> <wp:post_id>1</wp:post_id> <wp:post_date>2011-4-0132:45:4</wp:post_date> <wp:post_date_gmt>2011-4-0132:45:4</wp:post_date_gmt> <wp:comment_status>open</wp:comment_status> <wp:ping_status>open</wp:ping_status> <wp:post_name>sample-lift?</wp:post_name> <wp:status>publish</wp:status> <wp:post_parent>0</wp:post_parent> <wp:menu_order>0</wp:menu_order> <wp:post_type>post</wp:post_type> <wp:post_password></wp:post_password> <wp:is_sticky>0</wp:is_sticky> <category domain="category" nicename="Sample Lift"><![CDATA[Sample Lift]]></category><category domain="category" nicename="Sample Procedures"><![CDATA[Yeah Procedures]]></category> <category domain="post_tag" nicename="delaware"><![CDATA[delaware]]></category> <wp:postmeta> <wp:meta_key>_edit_last</wp:meta_key> <wp:meta_value><![CDATA[1]]></wp:meta_value> </wp:postmeta> </item> <item> <title>lalalalalala</title> <link>../../administrative-tips-for-surgery/delaware-cosmetic-surgery-a-better-experience/</link> <pubDate>Wed, 03 Oct 2012 3:20:43 +0000</pubDate> <dc:creator>admin</dc:creator> <guid isPermaLink="false">http://localhost/lols/?p=1</guid> <description></description> <content:encoded><![CDATA[ lalalalalala ]]></content:encoded> <excerpt:encoded><![CDATA[]]></excerpt:encoded> <wp:post_id>1</wp:post_id> <wp:post_date>2011-4-0124:39:30</wp:post_date> <wp:post_date_gmt>2011-4-0124:39:30</wp:post_date_gmt> <wp:comment_status>open</wp:comment_status> <wp:ping_status>open</wp:ping_status> <wp:post_name>lalalalalala</wp:post_name> <wp:status>publish</wp:status> <wp:post_parent>0</wp:post_parent> <wp:menu_order>0</wp:menu_order> <wp:post_type>post</wp:post_type> <wp:post_password></wp:post_password> <wp:is_sticky>0</wp:is_sticky> <category domain="category" nicename="lalalalalala"><![CDATA[lalalalalala]]></category> <category domain="post_tag" nicename="oink"><![CDATA[oink]]></category> <wp:postmeta> <wp:meta_key>_edit_last</wp:meta_key> <wp:meta_value><![CDATA[1]]></wp:meta_value> </wp:postmeta> </item> </channel> </rss> Please tell me what am I missing....

    Read the article

  • How do I create regex groups for replacement?

    - by resting
    I have this sample string: Image: SGD$45.32 SKU: 3f3f3 dfdfd grg4t BP 6yhf Pack Size: 1000's Color: Green Price: SGD$45.32 SGD$45... I would like to remove all the prices namely: SGD$45.32 Price: SGD$45.32 SGD$45 I have this expression thats supposed to match the 3 groups: $pattern = '/(Price.+\sSGD\$\d+\.\d{2})(SGD\$\d+\.\d{2})(SGD\$\d+)/'; $new_snippet = preg_replace($pattern, '', $snippet);` But apparently its not working. It works if I replace a single group at a time. But, I'd like to know if it possible to replace all possible matching groups with a single statement. Tried preg_match_all($pattern, $snippet, $matches); to show matches based on the above pattern, but no matches are found if I put all 3 groups together.

    Read the article

  • Using Regex groups in bash

    - by AlexeyMK
    Greetings, I've got a directory with a list of pdfs in it: file1.pdf, file2.pdf, morestuff.pdf ... etc. I want to convert these pdfs to pngs, ie file1.png, file2.png, morestuff.png ... etc. The basic command is, convert from to, But I'm having trouble getting convert to rename to the same file name. The obvious 'I wish it worked this way' is convert *.pdf *.png But clearly that doesn't work. My thought process is that I should utilize regular expression grouping here, to say somethink like convert (*).pdf %1.png but that clearly isn't the right syntax. I'm wondering what the correct syntax is, and whether there's a better approach (that doesn't require jumping into perl or python) that I'm ignoring. Thanks!

    Read the article

  • Do I need to include the 'this' when using a property name in a closure?

    - by Scott Whitlock
    I'm using a list of Actions to store an undo history for an object. Let's say I have a property of my object called myChildObject and it's being changed, so I want to store the undo action where I would set it back to it's current value: public class Class1 { public Class1() { } private readonly List<Action> m_undoActions = new List<Action>(); private SomeObject myChildObject { get; set; } public void ChangeState(SomeObject newChildObject) { // copies the reference SomeObject existingObject = myChildObject; m_undoActions.Add(() => myChildObject = existingObject); myChildObject = newChildObject; } } Looking at the lambda expression, existingObject is a local variable, so it's using a closure to pass a reference to that variable, but what about the property myChildObject? Do I need to use 'this' to preface it? Do I need to make a copy of the 'this' reference to a local variable first? Thanks for helping me understand this closure stuff.

    Read the article

  • a question on webpage data scraping using Java

    - by Gemma
    Hi there. I am now trying to implement a simple HTML webpage scraper using Java.Now I have a small problem. Suppose I have the following HTML fragment. <div id="sr-h-left" class="sr-comp"> <a class="link-gray-underline" id="compare_header" rel="nofollow" href="javascript:i18nCompareProd('/serv/main/buyer/ProductCompare.jsp?nxtg=41980a1c051f-0942A6ADCF43B802'); " Compare Showing 1 - 30 of 1,439 matches, The data I am interested is the integer 1.439 shown at the bottom.I am just wondering how can I get that integer out of the HTML. I am now considering using a regular expression,and then use the java.util.Pattern to help get the data out,but still not very clear about the process. I would be grateful if you guys could give me some hint or idea on this data scraping. Thanks a lot.

    Read the article

  • ngModel and component with isolated scope

    - by Artem Andreev
    I am creating simple ui-datetime directive. It splits javascript Date object into _date, _hours and _minutes parts. _date uses jquery ui datepicker, _hours and _minutes - number inputs. See example: http://jsfiddle.net/andreev_artem/nWsZp/3/ On github: https://github.com/andreev-artem/angular_experiments/tree/master/ui-datetime As far as I understand - best practice when you create a new component is to use isolated scope. When I tried to use isolated scope - nothing works. ngModel.$viewValue === undefined. When I tried to use new scope (my example, not so good variant imho) - ngModel uses value on newly created scope. Of course I can create directive with isolated scope and work with ngModel value through "=expression" (example). But I think that working with ngModelController is a better practice. My questions: Can I use ngModelController with isolated scope? If it is not possible which solution is better for creating such component?

    Read the article

  • Javascript substrings multiline replace by RegExp

    - by Radek Šimko
    Hi, I'm having some troubles with matching a regular expression in multi-line string. <script> var str="Welcome to Google!\n"; str = str + "We are proud to announce that Microsoft has \n"; str = str + "one of the worst Web Developers sites in the world."; document.write(str.replace(/.*(microsoft).*/gmi, "$1")); </script> http://jsbin.com/osoli3/3/edit As you may see on the link above, the output of the code looks like this: Welcome to Google! Microsoft one of the worst Web Developers sites in the world. Which means, that the replace() method goes line by line and if there's no match in that line, it returns just the whole line... Even if it has the "m" (multiline) modifier...

    Read the article

  • Can't enumerate LinQ results with left join

    - by nvtthang
    var itemSet = from item in da.GetList<Models.account>() join file in objFileStorageList on item.account_id equals file.parent_id into objFile from fileItem in objFile.DefaultIfEmpty() where item.company != null && item.company.company_id == 123 orderby item.updatedDate descending select new { Id = item.account_id, RefNo = item.refNo, StartDate = item.StartDate , EndDate = item.EndDate , Comment = item.comment, FileStorageID = fileItem != null ? fileItem.fileStorage_id : -1, Identification = fileItem != null ? fileItem.identifier : null, fileName = fileItem != null ? fileItem.file_nm : null }; It raises error message when I try to enumerate through collection result from Linq query above. LINQ to Entities does not recognize the method 'System.Collections.Generic.IEnumerable1[SCEFramework.Models.fileStorage] DefaultIfEmpty[fileStorage](System.Collections.Generic.IEnumerable1[SCEFramework.Models.fileStorage])' method, and this method cannot be translated into a store expression foreach (var item in itemSet) { string itemRef= item.RefNo; } Please suggest me any solutions. Thanks in advance.

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • gdb: SIGTRAP on std::string::c_str() call

    - by sheepsimulator
    So I've been trying to use gdb to return the value of a string I have by calling > print <member variable name>.c_str() But everytime I do so, I get this: Program received signal SIGTRAP, Trace/breakpoint trap. <some address> in std::string::c_str() from /usr/lib/libstdc++.so.6 GDB remains in the frame where the signal was received. To change this behavior use "set unwindonsignal on" Evaluation of the expression containing the function (std::string::c_str() const) will be abandoned. Two questions: Why/how is the standard library throwing SIGTRAP? I checked basic_string.h and c_str() is defined as: const _CharT* c_str() const { return _M_data(); } I don't see any SIGTRAP-throwing here... is there a way to get around this SIGTRAP? How can I read the text value of the std::string out (without getting some crazy extension library) in gdb?

    Read the article

  • Ordering by formula fields in NHibernate

    - by Darin Dimitrov
    Suppose that I have the following mapping with a formula property: <class name="Planet" table="planets"> <id name="Id" column="id"> <generator class="native" /> </id> <!-- somefunc() is a native SQL function --> <property name="Distance" formula="somefunc()" /> </class> I would like to get all planets and order them by the Distance calculated property: var planets = session .CreateCriteria<Planet>() .AddOrder(Order.Asc("Distance")) .List<Planet>(); This is translated to the following query: SELECT Id as id0, somefunc() as formula0 FROM planets ORDER BY somefunc() Desired query: SELECT Id as id0, somefunc() as formula0 FROM planets ORDER BY formula0 If I set a projection with an alias it works fine: var planets = session .CreateCriteria<Planet>() .SetProjection(Projections.Alias(Projections.Property("Distance"), "dist")) .AddOrder(Order.Asc("dist")) .List<Planet>(); SQL: SELECT somefunc() as formula0 FROM planets ORDER BY formula0 but it populates only the Distance property in the result and I really like to avoid projecting manually over all the other properties of my object (there could be many other properties). Is this achievable with NHibernate? As a bonus I would like to pass parameters to the native somefunc() SQL function. Anything producing the desired SQL is acceptable (replacing the formula field with subselects, etc...), the important thing is to have the calculated Distance property in the resulting object and order by this distance inside SQL.

    Read the article

  • Redirect www.example.com/apple to food.example.com/fruits/apple

    - by Senthil
    I want to redirect users from www.example.com/apple to http://food.example.com/fruits/apple Note: This is a hardcoded redirection. Even a mapping if you will. "apple" will not be substituted with anything else. Nothing in the two URLs will change except for the domain of course. So there is no need for a regular expression to match the "apple" or anything else. There is already dozens of RewriteCond and RewriteRule things in the .htaccess file. I do not want them to be affected. This redirection is independent of those. I have access to the .htaccess file at the root of www.example.com and the httpd.conf What code should I put in .htaccess in order to achieve this? Or should I change the httpd.conf?

    Read the article

  • asp.net databinding string is passed to function but runtime occurs

    - by rod
    Hi All, I'm using a code-behind function (called TestFx) in my binding expression. I'm passing a string and the function accepts a string but I still get a runtime error saying invalid args. But if I change the method to accept an object and inspect the value, "it's a string!" Can someone please explain? -rod ProductDescription: <asp:Label ID="ProductDescriptionLabel" runat="server" Text='<%# TestFx(Eval("ProductDescription")) %>' /> <br />

    Read the article

  • Gui problem after rewriting to MVC

    - by trevor_nise
    I'm practicing MVC style programming. I have a Mastermind game in a single file, working with no problems (maybe apart of the fact that "Check" button is invisible at start). http://paste.pocoo.org/show/226726/ But when I've rewritten it to model, view, controller files - when I click on empty Pin (that should be updated, and repainted with new color) - noting happens. Can anybody see any problems here ? I've tried placing repaint() in different places, but it simply does not work at all :/ Main : public class Main { public static void main(String[] args){ Model model = new Model(); View view = new View("Mastermind", 400, 590, model); Controller controller = new Controller(model, view); view.setVisible(true); } } Model : import java.util.Random; public class Model{ static final int LINE = 5, SCORE = 10, OPTIONS = 20; Pin pins[][] = new Pin[21][LINE]; int combination[] = new int[LINE]; int curPin = 0; int turn = 1; Random generator = new Random(); int repaintPin; boolean pinsRepaint=false; int pinsToRepaint; boolean isUpdate = true, isPlaying = true, isRowFull = false; static final int HIT_X[] = {270,290,310,290,310}, HIT_Y[] = {506,496,496,516,516}; public Model(){ for ( int i=0; i < SCORE; i++ ){ for ( int j = 0; j < LINE; j++ ){ pins[i][j] = new Pin(20,0); pins[i][j].setPosition(j*50+30,510-i*50); pins[i+SCORE][j] = new Pin(8,0); pins[i+SCORE][j].setPosition(HIT_X[j],HIT_Y[j]-i*50); } } for ( int i=0; i < LINE; i++ ){ pins[OPTIONS][i] = new Pin( 20, i+2 ); pins[OPTIONS][i].setPosition( 370,i * 50 + 56); } } void fillHole(int color) { pins[turn-1][curPin].setColor(color+1); pinsRepaint = true; pinsToRepaint = turn; curPin = (curPin+1) % LINE; if (curPin == 0){ isRowFull = true; } pinsRepaint = false; pinsToRepaint = 0; } void check() { int junkPins[] = new int[LINE], junkCode[] = new int[LINE]; int pinCount = 0, pico = 0; for ( int i = 0; i < LINE; i++ ) { junkPins[i] = pins[turn-1][i].getColor(); junkCode[i] = combination[i]; } for ( int i = 0; i < LINE; i++ ){ if (junkPins[i]==junkCode[i]) { pins[turn+SCORE][pinCount].setColor(1); pinCount++; pico++; junkPins[i] = 98; junkCode[i] = 99; } } for ( int i = 0; i < LINE; i++ ){ for ( int j = 0; j < LINE; j++ ) if (junkPins[i]==junkCode[j]) { pins[turn+SCORE][pinCount].setColor(2); pinCount++; junkPins[i] = 98; junkCode[j] = 99; j = LINE; } } pinsRepaint = true; pinsToRepaint = turn + SCORE; pinsRepaint = false; pinsToRepaint=0; if ( pico == LINE ){ isPlaying = false; } else if ( turn >= 10 ){ isPlaying = false; } else{ curPin = 0; isRowFull = false; turn++; } } void combination() { for ( int i = 0; i < LINE; i++ ){ combination[i] = generator.nextInt(6) + 1; } } } class Pin{ private int color, X, Y, radius; public Pin(){ X = 0; Y = 0; radius = 0; color = 0; } public Pin( int r,int c ){ X = 0; Y = 0; radius = r; color = c; } public int getX(){ return X; } public int getY(){ return Y; } public int getRadius(){ return radius; } public void setRadius(int r){ radius = r; } public void setPosition( int x,int y ){ this.X = x ; this.Y = y ; } public void setColor( int c ){ color = c; } public int getColor() { return color; } } View: import java.awt.*; import javax.swing.*; public class View extends Frame{ Model model; JButton checkAnswer; private JPanel button; private static final Color COLORS[] = {Color.black, Color.white, Color.red, Color.yellow, Color.green, Color.blue, new Color(7, 254, 250)}; public View(String name, int w, int h, Model m){ model = m; setTitle( name ); setSize( w,h ); setResizable( false ); this.setLayout(new BorderLayout()); button = new JPanel(); button.setSize( new Dimension(400, 100)); button.setVisible(true); checkAnswer = new JButton("Check"); checkAnswer.setSize( new Dimension(200, 30)); button.add( checkAnswer ); this.add( button, BorderLayout.SOUTH); button.setVisible(true); } @Override public void paint( Graphics g ) { g.setColor( new Color(238, 238, 238)); g.fillRect( 0,0,400,590); for ( int i=0; i < model.pins.length; i++ ) { paintPins(model.pins[i][0],g); paintPins(model.pins[i][1],g); paintPins(model.pins[i][2],g); paintPins(model.pins[i][3],g); paintPins(model.pins[i][4],g); } } @Override public void update( Graphics g ) { if ( model.isUpdate ) { paint(g); } else { model.isUpdate = true; paintPins(model.pins[model.repaintPin-1][0],g); paintPins(model.pins[model.repaintPin-1][1],g); paintPins(model.pins[model.repaintPin-1][2],g); paintPins(model.pins[model.repaintPin-1][3],g); paintPins(model.pins[model.repaintPin-1][4],g); } } void repaintPins( int pin ) { model.repaintPin = pin; model.isUpdate = false; repaint(); } public void paintPins(Pin p, Graphics g ){ int X = p.getX(); int Y = p.getY(); int color = p.getColor(); int radius = p.getRadius(); int x = X-radius; int y = Y-radius; if (color > 0){ g.setColor( COLORS[color]); g.fillOval( x,y,2*radius,2*radius ); } else{ g.setColor( new Color(238, 238, 238) ); g.drawOval( x,y,2*radius-1,2*radius-1 ); } g.setColor( Color.black ); g.drawOval( x,y,2*radius,2*radius ); } } Controller: import java.awt.*; import java.awt.event.*; public class Controller implements MouseListener, ActionListener { private Model model; private View view; public Controller(Model m, View v){ model = m; view = v; view.addWindowListener( new WindowAdapter(){ public void windowClosing(WindowEvent e){ System.exit(0); } }); view.addMouseListener(this); view.checkAnswer.addActionListener(this); model.combination(); } public void actionPerformed( ActionEvent e ) { if(e.getSource() == view.checkAnswer){ if(model.isRowFull){ model.check(); } } } public void mousePressed(MouseEvent e) { Point mouse = new Point(); mouse = e.getPoint(); if (model.isPlaying){ if (mouse.x > 350) { int button = 1 + (int)((mouse.y - 32) / 50); if ((button >= 1) && (button <= 5)){ model.fillHole(button); if(model.pinsRepaint){ view.repaintPins( model.pinsToRepaint ); } } } } } public void mouseClicked(MouseEvent e) {} public void mouseReleased(MouseEvent e){} public void mouseEntered(MouseEvent e) {} public void mouseExited(MouseEvent e) {} }

    Read the article

  • Numbering Regex Submatches

    - by gentlylisped
    Is there a canonical ordering of submatch expressions in a regular expression? For example: What is the order of the submatches in "(([0-9]{3}).([0-9]{3}).([0-9]{3}).([0-9]{3}))\s+([A-Z]+)" ? a. (([0-9]{3})\.([0-9]{3})\.([0-9]{3})\.([0-9]{3}))\s+([A-Z]+) (([0-9]{3})\.([0-9]{3})\.([0-9]{3})\.([0-9]{3})) ([A-Z]+) ([0-9]{3}) ([0-9]{3}) ([0-9]{3}) ([0-9]{3}) b. (([0-9]{3})\.([0-9]{3})\.([0-9]{3})\.([0-9]{3}))\s+([A-Z]+) (([0-9]{3})\.([0-9]{3})\.([0-9]{3})\.([0-9]{3})) ([0-9]{3}) ([0-9]{3}) ([0-9]{3}) ([0-9]{3}) ([A-Z]+) or c. somthin' else.

    Read the article

  • Delphi component or library to display mathematical expressions

    - by Svein Bringsli
    I'm looking for a simple component that displays mathematical expressions in Delphi. When I started out I thought it would be easy to find something on the net, but it turns out it was harder than anticipated. There are lots and lots of components that will parse mathematical expressions, but few (none?) that will display them. Ideally I would like a component as simple as a TLabel, where I could set the caption to some expression and it would be displayed correctly, but some sort of library that let's me draw expressions to a canvas would also be sufficient for my needs. Update: I'm not talking about plotting graphs of functions or something like that. I want to display (for instance) (X^2+3)/X like this:

    Read the article

  • F# - This code isn't compiling for me

    - by stacker
    This code isn't compiling for me: let countDown = [5L .. -1L .. 0L];; I have a book that says it should return this: val countDown : int list = [5L; 4L; 3L; 2L; 1L; 0L] Compiler Error: Program.fs(42,24): error FS0010: Unexpected character '-' in expression > > let countDown = [5L .. -1L .. 0L];; let countDown = [5L .. -1L .. 0L];; -----------------------^

    Read the article

  • the problem about different treatment to __VA_ARGS__ when using VS 2008 and GCC

    - by liuliu
    I am trying to identify a problem because of an unusual usage of variadic macros. Here is the hypothetic macro: #define va(c, d, ...) c(d, __VA_ARGS__) #define var(a, b, ...) va(__VA_ARGS__, a, b) var(2, 3, printf, “%d %d %d\n”, 1); For gcc, the preprocessor will output printf("%d %d %d\n", 1, 2, 3) but for VS 2008, the output is printf, “%d %d %d\n”, 1(2, 3); I suspect the difference is caused by the different treatment to VA_ARGS, for gcc, it will first expand the expression to va(printf, "%d %d %d\n", 1, 2, 3), and treat 1, 2, 3 as the VA_ARGS for macro va. But for VS 2008, it will first treat b as VA_ARGS for macro va, and then do the expansion. Which one is correct interpretation for C99 variadic macro? or my usage falls into an undefined behavior?

    Read the article

  • Where to post code for open source usage?

    - by Douglas
    I've been working for a few weeks now with the Google Maps API v3, and have done a good bit of development for the map I've been creating. Some of the things I've done have had to be done to add usability where there previously was not any, at least not that I could find online. Essentially, I made a list of what had to be done, searched all over the web for the ways to do what I needed, and found that some were not(at the time) possible(in the "grab an example off the web" sense). Thus, in my working on this map, I have created a number of very useful tools, which I would like to share with the development community. Is there anywhere I could use as a hub, apart from my portfolio ( http://dougglover.com ), to allow people to view and recycle my work? I know how hard it can be to need to do something, and be unable to find the solution elsewhere, and I don't think that if something has been done before, it should necessarily need to be written again and again. Hence open source code, right? Firstly, I was considering coming on here and asking a question, and then just answering it. Problem there is I assume that would just look like a big reputation grab. If not, please let me know and I'll go ahead and do that so people here can see it. Other suggestions appreciated. Some stuff I've made: A (new and improved) LatLng generator Works quicker, generates LatLng based on position of a draggable marker Allows searching for an address to place the marker on/near the desired location(much better than having to scroll to your location all the way from Siberia) Since it's a draggable marker, double-clicking zooms in, instead of creating a new LatLng marker like the one I was originally using The ability to create entirely custom "Smart Paths" Plot LatLng points on the map which connect to each other just like they do using the actual Google Maps Using Dijkstra's algorithm with Javascript, the routing is intelligent and always gives the shortest possible route, using the points provided Simple, easy to read multi-dimensional array system allows for easily adding new points to the grid Any suggestions, etc. appreciated.

    Read the article

  • Tentative date casting in tsql

    - by Tewr
    I am looking for something like TRYCAST in TSQL or an equivalent method / hack. In my case I am extracting some date data from an xml column. The following query throws "Arithmetic overflow error converting expression to data type datetime." if the piece of data found in the xml cannot be converted to datetime (in this specific case, the date is "0001-01-01" in some cases). Is there a way to detect this exception before it occurs? select [CustomerInfo].value('(//*:InceptionDate/text())[1]', 'datetime') FROM Customers An example of what I am trying to achieve in pseudocode with an imagined tsql function TRYCAST(expr, totype, defaultvalue): select TRYCAST( [CustomerInfo].value('(//*:InceptionDate/text())[1]', 'nvarchar(100)'), datetime, null) FROM Customers

    Read the article

  • LINQ query needs either ascending or descending in the same query

    - by Sir Psycho
    Is there anyway this code can be refactored? The only difference is the order by part. Idealy I'd like to use a delegate/lamda expression so the code is reusable but I don't know how to conditionally add and remove the query operators OrderBy and OrderByDescending var linq = new NorthwindDataContext(); var query1 = linq.Customers .Where(c => c.ContactName.StartsWith("a")) .SelectMany(cus=>cus.Orders) .OrderBy(ord => ord.OrderDate) .Select(ord => ord.CustomerID); var query2 = linq.Customers .Where(c => c.ContactName.StartsWith("a")) .SelectMany(cus => cus.Orders) .OrderByDescending(ord => ord.OrderDate) .Select(ord => ord.CustomerID);

    Read the article

  • Capturing the contents of <select>

    - by joey mueller
    I'm trying to use a regular expression to capture the contents of all option values inside an HTML select element For example, in: <select name="test"> <option value="blah">one</option> <option value="mehh">two</option> <option value="rawr">three</option> </select> I'd like to capture one two and three into an array. My current code is var pages = responseDetails.responseText.match(/<select name="page" .+?>(?:\s*<option .+?>([^<]+)<\/option>)+\s*<\/select>/); for (var c = 0; c<pages.length; c++) { alert(pages[c]); } But it only captures the last value, in this case, "three". How can I modify this to capture all of them? Thanks!

    Read the article

< Previous Page | 169 170 171 172 173 174 175 176 177 178 179 180  | Next Page >