Search Results

Search found 78183 results on 3128 pages for 'file options'.

Page 18/3128 | < Previous Page | 14 15 16 17 18 19 20 21 22 23 24 25  | Next Page >

  • Copy mdf file and use it in run time

    - by Anibas
    After I copy mdf file (and his log file) I tries to Insert data. I receive the following message: "An attempt to attach an auto-named database for file [fileName].mdf failed. A database with the same name exists, or specified file cannot be opened, or it is located on UNC share. When I copied the file manual everything worked normally. Is it correct the order File.Copy leaves the file engaged?

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • Designing a database file format

    - by RoliSoft
    I would like to design my own database engine for educational purposes, for the time being. Designing a binary file format is not hard nor the question, I've done it in the past, but while designing a database file format, I have come across a very important question: How to handle the deletion of an item? So far, I've thought of the following two options: Each item will have a "deleted" bit which is set to 1 upon deletion. Pro: relatively fast. Con: potentially sensitive data will remain in the file. 0x00 out the whole item upon deletion. Pro: potentially sensitive data will be removed from the file. Con: relatively slow. Recreating the whole database. Pro: no empty blocks which makes the follow-up question void. Con: it's a really good idea to overwrite the whole 4 GB database file because a user corrected a typo. I will sell this method to Twitter ASAP! Now let's say you already have a few empty blocks in your database (deleted items). The follow-up question is how to handle the insertion of a new item? Append the item to the end of the file. Pro: fastest possible. Con: file will get huge because of all the empty blocks that remain because deleted items aren't actually deleted. Search for an empty block exactly the size of the one you're inserting. Pro: may get rid of some blocks. Con: you may end up scanning the whole file at each insert only to find out it's very unlikely to come across a perfectly fitting empty block. Find the first empty block which is equal or larger than the item you're inserting. Pro: you probably won't end up scanning the whole file, as you will find an empty block somewhere mid-way; this will keep the file size relatively low. Con: there will still be lots of leftover 0x00 bytes at the end of items which were inserted into bigger empty blocks than they are. Rigth now, I think the first deletion method and the last insertion method are probably the "best" mix, but they would still have their own small issues. Alternatively, the first insertion method and scheduled full database recreation. (Probably not a good idea when working with really large databases. Also, each small update in that method will clone the whole item to the end of the file, thus accelerating file growth at a potentially insane rate.) Unless there is a way of deleting/inserting blocks from/to the middle of the file in a file-system approved way, what's the best way to do this? More importantly, how do databases currently used in production usually handle this?

    Read the article

  • Reading data from text file in C

    - by themake
    I have a text file which contains words separated by space. I want to take each word from the file and store it. So i have opened the file but am unsure how to assign the word to a char. FILE *fp; fp = fopen("file.txt", "r"); //then i want char one = the first word in the file char two = the second word in the file

    Read the article

  • opening and viewing a file in php

    - by Christian Burgos
    how do i open/view for editing an uploaded file in php? i have tried this but it doesn't open the file. $my_file = 'file.txt'; $handle = fopen($my_file, 'r'); $data = fread($handle,filesize($my_file)); i've also tried this but it wont work. $my_file = 'file.txt'; $handle = fopen($my_file, 'w') or die('Cannot open file: '.$my_file); $data = 'This is the data'; fwrite($handle, $data); what i have in mind is like when you want to view an uploaded resume,documents or any other ms office files like .docx,.xls,.pptx and be able to edit them, save and close the said file. edit: latest tried code... <?php // Connects to your Database include "configdb.php"; //Retrieves data from MySQL $data = mysql_query("SELECT * FROM employees") or die(mysql_error()); //Puts it into an array while($info = mysql_fetch_array( $data )) { //Outputs the image and other data //Echo "<img src=localhost/uploadfile/images".$info['photo'] ."> <br>"; Echo "<b>Name:</b> ".$info['name'] . "<br> "; Echo "<b>Email:</b> ".$info['email'] . " <br>"; Echo "<b>Phone:</b> ".$info['phone'] . " <hr>"; //$file=fopen("uploadfile/images/".$info['photo'],"r+"); $file=fopen("Applications/XAMPP/xamppfiles/htdocs/uploadfile/images/file.odt","r") or exit("unable to open file");; } ?> i am getting the error: Warning: fopen(Applications/XAMPP/xamppfiles/htdocs/uploadfile/images/file.odt): failed to open stream: No such file or directory in /Applications/XAMPP/xamppfiles/htdocs/uploadfile/view.php on line 17 unable to open file the file is in that folder, i don't know it wont find it.

    Read the article

  • Copied a file with winscp; only winscp can see it

    - by nilbus
    I recently copied a 25.5GB file from another machine using WinSCP. I copied it to C:\beth.tar.gz, and WinSCP can still see the file. However no other app (including Explorer) can see the file. What might cause this, and how can I fix it? The details that might or might not matter WinSCP shows the size of the file (C:\beth.tar.gz) correctly as 27,460,124,080 bytes, which matches the filesize on the remote host Neither explorer, cmd (command line prompt w/ dir C:\), the 7Zip archive program, nor any other File Open dialog can see the beth.tar.gz file under C:\ I have configured Explorer to show hidden files I can move the file to other directories using WinSCP If I try to move the file to Users/, UAC prompts me for administrative rights, which I grant, and I get this error: Could not find this item The item is no longer located in C:\ When I try to transfer the file back to the remote host in a new directory, the transfer starts successfully and transfers data The transfer had about 30 minutes remaining when I left it for the night The morning after the file transfer, I was greeted with a message saying that the connection to the server had been lost. I don't think this is relevant, since I did not tell it to disconnect after the file was done transferring, and it likely disconnected after the file transfer finished. I'm using an old version of WinSCP - v4.1.8 from 2008 I can view the file properties in WinSCP: Type of file: 7zip (.gz) Location: C:\ Attributes: none (Ready-only, Hidden, Archive, or Ready for indexing) Security: SYSTEM, my user, and Administrators group have full permissions - everything other than "special permissions" is checked under Allow for all 3 users/groups (my user, Administrators, SYSTEM) What's going on?!

    Read the article

  • C++, Ifstream opens local file but not file on HTTP Server

    - by fammi
    Hi, I am using ifstream to open a file and then read from it. My program works fine when i give location of the local file on my system. for eg /root/Desktop/abc.xxx works fine But once the location is on the http server the file fails to open. for eg http://192.168.0.10/abc.xxx fails to open. Is there any alternate for ifstream when using a URL address? thanks. part of the code where having problem: bool readTillEof = (endIndex == -1) ? true : false; // Open the file in binary mode and seek to the end to determine file size ifstream file ( fileName.c_str ( ), ios::in|ios::ate|ios::binary ); if ( file.is_open ( ) ) { long size = (long) file.tellg ( ); long numBytesRead; if ( readTillEof ) { numBytesRead = size - startIndex; } else { numBytesRead = endIndex - startIndex + 1; } // Allocate a new buffer ptr to read in the file data BufferSptr buf (new Buffer ( numBytesRead ) ); mpStreamingClientEngine->SetResponseBuffer ( nextRequest, buf ); // Seek to the start index of the byte range // and read the data file.seekg ( startIndex, ios::beg ); file.read ( (char *)buf->GetData(), numBytesRead ); // Pass on the data to the SCE // and signal completion of request mpStreamingClientEngine->HandleDataReceived( nextRequest, numBytesRead); mpStreamingClientEngine->MarkRequestCompleted( nextRequest ); // Close the file file.close ( ); } else { // Report error to the Streaming Client Engine // as unable to open file AHS_ERROR ( ConnectionManager, " Error while opening file \"%s\"\n", fileName.c_str ( ) ); mpStreamingClientEngine->HandleRequestFailed( nextRequest, CONNECTION_FAILED ); } }

    Read the article

  • How do I open a file in such a way that if the file doesn't exist it will be created and opened automatically?

    - by snakile
    Here's how I open a file for writing+ : if( fopen_s( &f, fileName, "w+" ) !=0 ) { printf("Open file failed\n"); return; } fprintf_s(f, "content"); If the file doesn't exist the open operation fails. What's the right way to fopen if I want to create the file automatically if the file doesn't already exist? EDIT: If the file does exist, I would like fprintf to overwrite the file, not to append to it.

    Read the article

  • Problem with File uplolad in javascript.

    - by Nikhil
    I have used javascript to upload more than one file. when user clicks on 'add more' javascript appends new object to older div using innerHTML. Now the problem is if I select a file and then click on "add more" then new file button exist but older selected file removes and two blank file buttons display. I want this old file must be selected when user add new file button. If anybody can, Help Plz!!! tnX.

    Read the article

  • excel cannot open the file xxx.xlsx' because the file format is not valid error

    - by Yavuz
    I have difficulty open opening word and excel files suddenly. Only particular office file give me the problem. These files were previously scanned by combo fix and I believe they were damaged. The error response that I from office is Excel cannot open the file xxx.xlsx because the file format is not valid. Verify that the file has not been corrupted and that the file extension matches the format of the file. This is for excel and a similar kind of error response comes for word. The file looks fine. I mean the size vise... Please help me with this problem. I really appreciate your help and time....

    Read the article

  • Upon clicking on a file, excel opens but not the file itself

    - by william
    Platform: Windows XP SP2, Excel 2007 Problem description: Upon clicking on a file in Windows Explorer (file is either .xls or .xlsx) Excel 2007 opens, but does not open the file itself. I need either to click on a file again in Windows Explorer or open it manually with File/Open ... from Excel. Does anyone know what could cause this rather strange behaviour ? The old versions of Excel worked "normally" ... i.e. upon clicking on a file, an Excel would open along with the file. Please, help !

    Read the article

  • Adding Volcanos and Options - Earthquake Locator, part 2

    - by Bobby Diaz
    Since volcanos are often associated with earthquakes, and vice versa, I decided to show recent volcanic activity on the Earthquake Locator map.  I am pulling the data from a website created for a joint project between the Smithsonian's Global Volcanism Program and the US Geological Survey's Volcano Hazards Program, found here.  They provide a Weekly Volcanic Activity Report as an RSS feed.   I started implementing this new functionality by creating a new Volcano entity in the domain model and adding the following to the EarthquakeService class (I also factored out the common reading/parsing helper methods to a separate FeedReader class that can be used by multiple domain service classes):           private static readonly string VolcanoFeedUrl =             ConfigurationManager.AppSettings["VolcanoFeedUrl"];           /// <summary>         /// Gets the volcano data for the previous week.         /// </summary>         /// <returns>A queryable collection of <see cref="Volcano"/> objects.</returns>         public IQueryable<Volcano> GetVolcanos()         {             var feed = FeedReader.Load(VolcanoFeedUrl);             var list = new List<Volcano>();               if ( feed != null )             {                 foreach ( var item in feed.Items )                 {                     var quake = CreateVolcano(item);                     if ( quake != null )                     {                         list.Add(quake);                     }                 }             }               return list.AsQueryable();         }           /// <summary>         /// Creates a <see cref="Volcano"/> object for each item in the RSS feed.         /// </summary>         /// <param name="item">The RSS item.</param>         /// <returns></returns>         private Volcano CreateVolcano(SyndicationItem item)         {             Volcano volcano = null;             string title = item.Title.Text;             string desc = item.Summary.Text;             double? latitude = null;             double? longitude = null;               FeedReader.GetGeoRssPoint(item, out latitude, out longitude);               if ( !String.IsNullOrEmpty(title) )             {                 title = title.Substring(0, title.IndexOf('-'));             }             if ( !String.IsNullOrEmpty(desc) )             {                 desc = String.Join("\n\n", desc                         .Replace("<p>", "")                         .Split(                             new string[] { "</p>" },                             StringSplitOptions.RemoveEmptyEntries)                         .Select(s => s.Trim())                         .ToArray())                         .Trim();             }               if ( latitude != null && longitude != null )             {                 volcano = new Volcano()                 {                     Id = item.Id,                     Title = title,                     Description = desc,                     Url = item.Links.Select(l => l.Uri.OriginalString).FirstOrDefault(),                     Latitude = latitude.GetValueOrDefault(),                     Longitude = longitude.GetValueOrDefault()                 };             }               return volcano;         } I then added the corresponding LoadVolcanos() method and Volcanos collection to the EarthquakeViewModel class in much the same way I did with the Earthquakes in my previous article in this series. Now that I am starting to add more information to the map, I wanted to give the user some options as to what is displayed and allowing them to choose what gets turned off.  I have updated the MainPage.xaml to look like this:   <UserControl x:Class="EarthquakeLocator.MainPage"     xmlns="http://schemas.microsoft.com/winfx/2006/xaml/presentation"     xmlns:x="http://schemas.microsoft.com/winfx/2006/xaml"     xmlns:d="http://schemas.microsoft.com/expression/blend/2008"     xmlns:mc="http://schemas.openxmlformats.org/markup-compatibility/2006"     xmlns:basic="clr-namespace:System.Windows.Controls;assembly=System.Windows.Controls"     xmlns:bing="clr-namespace:Microsoft.Maps.MapControl;assembly=Microsoft.Maps.MapControl"     xmlns:vm="clr-namespace:EarthquakeLocator.ViewModel"     mc:Ignorable="d" d:DesignWidth="640" d:DesignHeight="480" >     <UserControl.Resources>         <DataTemplate x:Key="EarthquakeTemplate">             <Ellipse Fill="Red" Stroke="Black" StrokeThickness="1"                      Width="{Binding Size}" Height="{Binding Size}"                      bing:MapLayer.Position="{Binding Location}"                      bing:MapLayer.PositionOrigin="Center">                 <ToolTipService.ToolTip>                     <StackPanel>                         <TextBlock Text="{Binding Title}" FontSize="14" FontWeight="Bold" />                         <TextBlock Text="{Binding UtcTime}" />                         <TextBlock Text="{Binding LocalTime}" />                         <TextBlock Text="{Binding DepthDesc}" />                     </StackPanel>                 </ToolTipService.ToolTip>             </Ellipse>         </DataTemplate>           <DataTemplate x:Key="VolcanoTemplate">             <Polygon Fill="Gold" Stroke="Black" StrokeThickness="1" Points="0,10 5,0 10,10"                      bing:MapLayer.Position="{Binding Location}"                      bing:MapLayer.PositionOrigin="Center"                      MouseLeftButtonUp="Volcano_MouseLeftButtonUp">                 <ToolTipService.ToolTip>                     <StackPanel>                         <TextBlock Text="{Binding Title}" FontSize="14" FontWeight="Bold" />                         <TextBlock Text="Click icon for more information..." />                     </StackPanel>                 </ToolTipService.ToolTip>             </Polygon>         </DataTemplate>     </UserControl.Resources>       <UserControl.DataContext>         <vm:EarthquakeViewModel AutoLoadData="True" />     </UserControl.DataContext>       <Grid x:Name="LayoutRoot">           <bing:Map x:Name="map" CredentialsProvider="--Your-Bing-Maps-Key--"                   Center="{Binding MapCenter, Mode=TwoWay}"                   ZoomLevel="{Binding ZoomLevel, Mode=TwoWay}">               <bing:MapItemsControl ItemsSource="{Binding Earthquakes}"                                   ItemTemplate="{StaticResource EarthquakeTemplate}" />               <bing:MapItemsControl ItemsSource="{Binding Volcanos}"                                   ItemTemplate="{StaticResource VolcanoTemplate}" />         </bing:Map>           <basic:TabControl x:Name="tabs" VerticalAlignment="Bottom" MaxHeight="25" Opacity="0.7">             <basic:TabItem Margin="90,0,-90,0" MouseLeftButtonUp="TabItem_MouseLeftButtonUp">                 <basic:TabItem.Header>                     <TextBlock x:Name="txtHeader" Text="Options"                                FontSize="13" FontWeight="Bold" />                 </basic:TabItem.Header>                   <StackPanel Orientation="Horizontal">                     <TextBlock Text="Earthquakes:" FontWeight="Bold" Margin="3" />                     <StackPanel Margin="3">                         <CheckBox Content=" &lt; 4.0"                                   IsChecked="{Binding ShowLt4, Mode=TwoWay}" />                         <CheckBox Content="4.0 - 4.9"                                   IsChecked="{Binding Show4s, Mode=TwoWay}" />                         <CheckBox Content="5.0 - 5.9"                                   IsChecked="{Binding Show5s, Mode=TwoWay}" />                     </StackPanel>                       <StackPanel Margin="10,3,3,3">                         <CheckBox Content="6.0 - 6.9"                                   IsChecked="{Binding Show6s, Mode=TwoWay}" />                         <CheckBox Content="7.0 - 7.9"                                   IsChecked="{Binding Show7s, Mode=TwoWay}" />                         <CheckBox Content="8.0 +"                                   IsChecked="{Binding ShowGe8, Mode=TwoWay}" />                     </StackPanel>                       <TextBlock Text="Other:" FontWeight="Bold" Margin="50,3,3,3" />                     <StackPanel Margin="3">                         <CheckBox Content="Volcanos"                                   IsChecked="{Binding ShowVolcanos, Mode=TwoWay}" />                     </StackPanel>                 </StackPanel>               </basic:TabItem>         </basic:TabControl>       </Grid> </UserControl> Notice that I added a VolcanoTemplate that uses a triangle-shaped Polygon to represent the Volcano locations, and I also added a second <bing:MapItemsControl /> tag to the map to bind to the Volcanos collection.  The TabControl found below the map houses the options panel that will present the user with several checkboxes so they can filter the different points based on type and other properties (i.e. Magnitude).  Initially, the TabItem is collapsed to reduce it's footprint, but the screen shot below shows the options panel expanded to reveal the available settings:     I have updated the Source Code and Live Demo to include these new features.   Happy Mapping!

    Read the article

  • Azure Task Scheduling Options

    - by charlie.mott
    Currently, the Azure PaaS does not offer a distributed\resilient task scheduling service.  If you do want to host a task scheduling product\solution off-premise (and ideally use Azure), what are your options? PaaS Option 1: Worker Roles Use a worker role to schedule and execute actions at specific time periods.  There are a few frameworks available to assist with this: http://azuretoolkit.codeplex.com https://github.com/Lokad/lokad-cloud/wiki/TaskScheduler http://blog.smarx.com/posts/building-a-task-scheduler-in-windows-azure - This addresses a slightly different set of requirements. It’s a more dynamic approach for queuing up tasks, but not repeatable tasks (e.g. daily). I found the Azure Toolkit option the most simple to implement.  Step 1 : Create a domain entity implementing IJob for each job to schedule.  In this sample, I asynchronously call a WCF service method. 1: namespace Acme.WorkerRole.Jobs 2: { 3: using AzureToolkit; 4: using ScheduledTasksService; 5: 6: public class UploadEmployeesJob : IJob 7: { 8: public void Run() 9: { 10: // Call Tasks Service 11: var client = new ScheduledTasksServiceClient("BasicHttpBinding_IScheduledTasksService"); 12: client.UploadEmployees(); 13: client.Close(); 14: } 15: } 16: } Step 2 : In the worker role run method, add the jobs to the toolkit engine. 1: namespace Acme.WorkerRole 2: { 3: using AzureToolkit.Engine; 4: using Jobs; 5:   6: public class WorkerRole : WorkerRoleEntryPoint 7: { 8: public override void Run() 9: { 10: var engine = new CloudEngine(); 11:   12: // Add Scheduled Jobs (using CronJob syntax - see http://www.adminschoice.com/crontab-quick-reference). 13:   14: // 1. Upload Employee job - 8.00 PM every weekday (Mon-Fri) 15: engine.WithJobScheduler().ScheduleJob<UploadEmployeesJob>(c => { c.CronSchedule = "0 20 * * 1-5"; }); 16: // 2. Purge Data job - 10 AM every Saturday 17: engine.WithJobScheduler().ScheduleJob<PurgeDataJob>(c => { c.CronSchedule = "0 10 * * 6"; }); 18: // 3. Process Exceptions job - Every 5 minutes 19: engine.WithJobScheduler().ScheduleJob<ProcessExceptionsJob>(c => { c.CronSchedule = "*/5 * * * *"; }); 20:   21: engine.Run(); 22: base.Run(); 23: } 24: } 25: } Pros Cons Azure Toolkit option is simple to implement. For the AzureToolkit option, you are limited to a single worker role.  Otherwise, the jobs will be executed multiple times, once for each worker role instance.   Paying for a continuously running worker role, even if it just processes a single job once a week.  If you only have a few scheduled tasks to run calling asynchronous services hosted in different web roles, an extra small worker role likely to be sufficient.  However, for an extra small worker role this still costs $14.40/month (03/09/2012). Option 2: Use Scheduled Task on Azure Web Role calling a console app Setup a Windows Scheduled Task on the Azure Web Role. This calls a console application that calls the WCF service methods that run the task actions. This design is described here: http://www.ronaldwidha.net/2011/02/23/cron-job-on-azure-using-scheduled-task-on-a-web-role-to-replace-azure-worker-role-for-background-job/ http://www.voiceoftech.com/swhitley/index.php/2011/07/windows-azure-task-scheduler/ http://devlicio.us/blogs/vinull/archive/2011/10/23/moving-to-azure-worker-roles-for-nothing-and-tasks-for-free.aspx Pros Cons Fairly easy to implement. Supportability - I RDC’ed onto the Azure server and stopped the scheduled task. I then rebooted the machine and the task was re-started. I also tried deleting the task and rebooting, the same thing occurred. The only way to permanently guarantee that a task is disabled is to do a fresh deployment. I think this is a major supportability concern.   Saleability - multiple instances would trigger multiple tasks. You can only have one instance for the scheduled task web role. The guidance implements setup of the scheduled task as part of a web role instance. But if you have more than one instance in a web role, the task will be triggered multiple times for each scheduled action (once per machine). Workaround: If we wanted to use scheduled tasks for another client with a saleable WCF service, then we could include the console & tasks scripts in a separate web role (e.g. a empty WCF service with no real purpose to it). SaaS Option 3: Azure Marketplace I thought that someone might be offering this type of service via the Azure marketplace. At the point of writing this blog post, I did not find anyone doing so. https://datamarket.azure.com/ Pros Cons   Nobody currently offers this on the Azure Marketplace. Option 4: Online Job Scheduling Service Provider There are plenty of online providers that offer this type of service on a pay-as-you-go approach.  Some of these are free for small usage.   Many of these providers are listed here: http://en.wikipedia.org/wiki/Webcron Pros Cons No bespoke development for scheduler. Reliance on third party. IaaS Option 5: Setup Scheduling Software on Azure IaaS VM’s One of job scheduling software offerings could be installed and configured on Azure VM’s.  A list of software options is listed here: http://en.wikipedia.org/wiki/List_of_job_scheduler_software Pros Cons Enterprise distributed\resilient task scheduling service VM Setup and maintenance   Software Licence Costs Option 6: VM Gallery A the time of writing this blog post, I did not spot a VM in the gallery that included pre-installation of any of the above software options. Pros Cons   No current VM template. Summary For my current project that had a small handful of tasks to schedule with a limited project budget I chose option 1 (a worker role using the Azure Toolkit to schedule tasks).  If I was building an enterprise scale solution for the future, options 4 and 5 are currently worthy of consideration. Hopefully, Microsoft will include tasks scheduling in the future as part of their PaaS offerings.

    Read the article

  • How to write files in specific order?

    - by Bernie
    Okay, here's a weird problem -- My wife just bought a 2014 Nissan Altima. So, I took her iTunes library and converted the .m4a files to .mp3, since the car audio system only supports .mp3 and .wma. So far so good. Then I copied the files to a DOS FAT-32 formatted USB thumb drive, and connected the drive to the car's USB port, only to find all of the tracks were out of sequence. All tracks begin with a two digit numeric prefix, i.e., 01, 02, 03, etc. So you would think they would be in order. So I called Nissan Connect support and the rep told me that there is a known problem with reading files in the correct order. He said the files are read in the same order they are written. So, I manually copied a few albums with the tracks in a predetermined order, and sure enough he was correct. So I copied about 6 albums for testing, then changed to the top level directory and did a "find . music.txt". Then I passed this file to rsync like this: rsync -av --files-from=music.txt . ../Marys\ Music\ Sequenced/ The files looked like they were copied in order, but when I listed the files in order of modified time, they were in the same sequence as the original files: ../Marys Music Sequenced/Air Supply/Air Supply Greatest Hits ls -1rt 01 Lost In Love.mp3 04 Every Woman In The World.mp3 03 Chances.mp3 02 All Out Of Love.mp3 06 Here I Am (Just When I Thought I Was Over You).mp3 05 The One That You Love.mp3 08 I Want To Give It All.mp3 07 Sweet Dreams.mp3 11 Young Love.mp3 So the question is, how can I copy files listed in a file named music.txt, and copy them to a destination, and ensure the modification times are in the same sequence as the files are listed?

    Read the article

  • rename files with the same name

    - by snorpey
    Hi. I use the following function to rename thumbnails. For example, if I upload a file called "image.png" to an upload folder, and this folder already has a file named "image.png" in it, the new file automatically gets renamed to "image-copy-1.png". If there also is a file called "image-copy-1.png" it gets renamed to "image-copy-2.png" and so on. The following function returns the new filename. At least that's what it is supposed to do... The renaming doesn't seeem to work correctly, though. Sometimes it produces strange results, like: 1.png 1-copy-1.png 1-copy-2.png 1-copy-2-copy-1.png 1-copy-2-copy-3.png I hope you understand my problem, despite my description being somewhat complex... Can you tell me what went wrong here? (bonus question: Is regular expressions the right tool for doing this kind of stuff?) <?php function renameDuplicates($path, $file) { $fileName = pathinfo($path . $file, PATHINFO_FILENAME); $fileExtension = "." . pathinfo($path . $file, PATHINFO_EXTENSION); if(file_exists($path . $file)) { $fileCopy = $fileName . "-copy-1"; if(file_exists($path . $fileCopy . $fileExtension)) { if ($contains = preg_match_all ("/.*?(copy)(-)(\\d+)/is", $fileCopy, $matches)) { $copyIndex = $matches[3][0]; $fileName = substr($fileCopy, 0, -(strlen("-copy-" . $copyIndex))) . "-copy-" . ($copyIndex + 1); } } else { $fileName .= "-copy-1"; } } $returnValue = $fileName . $fileExtension; return $returnValue; }?>

    Read the article

  • SQL SERVER – Subquery or Join – Various Options – SQL Server Engine Knows the Best – Part 2

    - by pinaldave
    This blog post is part 2 of the earlier written article SQL SERVER – Subquery or Join – Various Options – SQL Server Engine knows the Best by Paulo R. Pereira. Paulo has left excellent comment to earlier article once again proving the point that SQL Server Engine is smart enough to figure out the best plan itself and uses the same for the query. Let us go over his comment as he has posted. “I think IN or EXISTS is the best choice, because there is a little difference between ‘Merge Join’ of query with JOIN (Inner Join) and the others options (Left Semi Join), and JOIN can give more results than IN or EXISTS if the relationship is 1:0..N and not 1:0..1. And if I try use NOT IN and NOT EXISTS the query plan is different from LEFT JOIN too (Left Anti Semi Join vs. Left Outer Join + Filter). So, I found a case where EXISTS has a different query plan than IN or ANY/SOME:” USE AdventureWorks GO -- use of SOME SELECT * FROM HumanResources.Employee E WHERE E.EmployeeID = SOME ( SELECT EA.EmployeeID FROM HumanResources.EmployeeAddress EA UNION ALL SELECT EA.EmployeeID FROM HumanResources.EmployeeDepartmentHistory EA ) -- use of IN SELECT * FROM HumanResources.Employee E WHERE E.EmployeeID IN ( SELECT EA.EmployeeID FROM HumanResources.EmployeeAddress EA UNION ALL SELECT EA.EmployeeID FROM HumanResources.EmployeeDepartmentHistory EA ) -- use of EXISTS SELECT * FROM HumanResources.Employee E WHERE EXISTS ( SELECT EA.EmployeeID FROM HumanResources.EmployeeAddress EA UNION ALL SELECT EA.EmployeeID FROM HumanResources.EmployeeDepartmentHistory EA ) When looked into execution plan of the queries listed above indeed we do get different plans for queries and SQL Server Engines creates the best (least cost) plan for each query. Click on image to see larger images. Thanks Paulo for your wonderful contribution. Reference : Pinal Dave (http://blog.SQLAuthority.com) Filed under: Pinal Dave, Readers Contribution, SQL, SQL Authority, SQL Joins, SQL Optimization, SQL Performance, SQL Query, SQL Scripts, SQL Server, SQL Tips and Tricks, T SQL, Technology

    Read the article

  • How To Restore Firefox Options To Default Without Uninstalling

    - by Gopinath
    Firefox plugins are awesome and they are the pillars for the huge success of Firefox browser. Plugins vary from simple ones like changing color scheme of the browser to powerful ones likes changing the behavior of the browser itself. Recently I installed one of the powerful Firefox plugins and played around to tweak the behavior of the browser. At the end of my half an hour play, Firefox has completely become useless and stopped rending web pages properly. To continue using Firefox I had to restore it to default settings. But I don’t like to uninstall and then install it again as it’s a time consuming process and also I’ll loose all the plugins I’m using. How did I restore the default settings in a single click? Default Settings Restore Through Safe Mode Options It’s very easy to restore default settings of Firefox with the safe mode options. All we need to do is 1.  Close all the Firefox browser windows that are open 2. Launch Firefox in safe mode 3. Choose the option Reset all user preferences to Firefox defaults 4. Click on Make Changes and Restart button. Note: When Firefox restore the default settings, it erases all the stored passwords, browser history and other settings you have done. That’s all. This excellent feature of Firefox saved me from great pain and hope it’s going to help you too. Join us on Facebook to read all our stories right inside your Facebook news feed.

    Read the article

  • How To Restore Firefox Options To Default Without Uninstalling

    - by Gopinath
    Firefox plugins are awesome and they are the pillars for the huge success of Firefox browser. Plugins vary from simple ones like changing color scheme of the browser to powerful ones likes changing the behavior of the browser itself. Recently I installed one of the powerful Firefox plugins and played around to tweak the behavior of the browser. At the end of my half an hour play, Firefox has completely become useless and stopped rending web pages properly. To continue using Firefox I had to restore it to default settings. But I don’t like to uninstall and then install it again as it’s a time consuming process and also I’ll loose all the plugins I’m using. How did I restore the default settings in a single click? Default Settings Restore Through Safe Mode Options It’s very easy to restore default settings of Firefox with the safe mode options. All we need to do is 1.  Close all the Firefox browser windows that are open 2. Launch Firefox in safe mode 3. Choose the option Reset all user preferences to Firefox defaults 4. Click on Make Changes and Restart button. Note: When Firefox restore the default settings, it erases all the stored passwords, browser history and other settings you have done. That’s all. This excellent feature of Firefox saved me from great pain and hope it’s going to help you too. Join us on Facebook to read all our stories right inside your Facebook news feed.

    Read the article

< Previous Page | 14 15 16 17 18 19 20 21 22 23 24 25  | Next Page >