Search Results

Search found 818 results on 33 pages for 'jay prakash singh'.

Page 18/33 | < Previous Page | 14 15 16 17 18 19 20 21 22 23 24 25  | Next Page >

  • php switch statement error on int = 0

    - by Jagdeep Singh
    I am having a problem in php switch case. When i set $number=0 it should run very first case but here this code returns 10-20K that is in second case. I checked comparison operators, tested them in if else case they return correct values but here first case do not run on $number=0 Why is this happening ? php consider 0 as false or something wrong in code ? Link to codepad paste http://codepad.org/2glDh39K also here is the code <?php $number = 0; switch ($number) { case ($number <= 10000): echo "0-10K"; break; case ($number > 10000 && $number <= 20000): echo "10-20K"; break; case ($number > 20000 && $number <= 30000): echo "20-30K"; break; case ($number > 30000 && $number <= 40000): echo "30-40K"; break; case ($number > 40000 && $number <= 50000): echo "40-50K"; break; case ($number > 50000 && $number <= 60000): echo "50-60K"; break; case ($number > 60000 && $number <= 70000): echo "60-70K"; break; case ($number > 70000 && $number <= 80000): echo "70-80K"; break; case ($number > 80000 && $number <= 90000): echo "80-90K"; break; case ($number > 90000): echo "90K+"; break; default: //default echo "N/A"; break; } ?>

    Read the article

  • Silverlight Application

    - by Avijit Singh
    I have prepared a Silverlight application and my database is in the server. Its running smoothly for small set of data but for large data set giving an error : Remote Serve returned an error:notFound. How can i resolve it,please any one solve this problem. I have build it in ASP.NET with C#. So kindly provide the solution in C# if possible.

    Read the article

  • Help needed regarding CLCorelocation

    - by yogendra singh
    Hello everybody, i am developing a GPS application in which i needs to track the speed of the device/iphone ,i am using the CLCorelocation API's Locate me referral code provided by Apple my problem is that the LocationManager does not updates the current latitude and longitudes thus i am unable to calculate the distance as well as the speed of the device/iphone. Any kinds of suggestions/code will be highly appreciated please suggest me if i can do something with the Mapkit framework introduced in the sdk 3.0. thanks in advance

    Read the article

  • check only one checkbox in gridview using jquery

    - by Gurbax Singh Bhangal
    i have a grid view in which i have placed the checkbox in itemtemplate i want only the one checkbox is selected from Gridview to select that perticular row so that i can use that id to edit or delete the row aspx page code is <asp:TemplateField Visible="false"> <ItemTemplate> <asp:Label ID="lblId" runat="server" Text='<%#Eval("id") %>'></asp:Label> </ItemTemplate> </asp:TemplateField> <asp:TemplateField> <HeaderTemplate> Select </HeaderTemplate> <ItemTemplate> <asp:CheckBox ID="chkSelect" runat="server"/> </ItemTemplate> </asp:TemplateField> <asp:TemplateField> <HeaderTemplate> Branch Name </HeaderTemplate> <ItemTemplate> <asp:Label ID="lblBranch_Name" runat="server" Text='<%# Bind("Branch") %>'></asp:Label> </ItemTemplate> </asp:TemplateField> <asp:TemplateField> <HeaderTemplate> Address </HeaderTemplate> <ItemTemplate> <asp:Label ID="lblAddress" runat="server" Text='<%# Eval("Address") %>'></asp:Label> </ItemTemplate> </asp:TemplateField> <asp:TemplateField> <HeaderTemplate> City </HeaderTemplate> <ItemTemplate> <asp:Label ID="lblCity" runat="server" Text='<%# Bind("City") %>'></asp:Label> </ItemTemplate> </asp:TemplateField> </Columns> and i want when i click on the checkbox which is at first of each row only one check box is selected from all the rows thanks

    Read the article

  • search engine crawling frequency

    - by Aditya Pratap Singh
    I want to design a search engine for news websites ie. download various article pages from these websites, index the pages, and answer search queries on the index. I want a short pseudocode to find an appropriate crawling frequency -- i do not want to crawl too often because the website may not have changed, and do not want to crawl too infrequently because index would then be out of date. Assume that crawling code looks as follows while(1) { sleep(sleep_interval); // sleep for sleep_interval crawl(website); // crawls the entire website diff = diff(currently_crawled_website, previously_crawled_website); // returns a % value of difference between the latest and previous crawls of the website sleep_interval = infer_sleep_interval(diff, sleep_interval); } looking for a pseudocode for the infer_sleep_interval method: long sleep_interval infer_sleep_interval(int diff_percentage,long previous_sleep_interval) { ... ... ... } i want to design method which adaptively alters the sleeping interval based on the update frequency of the website.

    Read the article

  • Super class variables not printing through sub class

    - by Abhishek Singh
    Can u tell me why this code is not displaying any result on the console. class employee { protected String name; protected double salary; protected String dob; public employee(String name, double salary, String dob) { this.name = name; this.salary = salary; this.dob = dob; } public employee(String name, double salary) { this.name = name; this.salary = salary; } } public class Manage extends employee { String dept1; public Manage(String name, double salary, String dob, String dept1) { super(name, salary, dob); this.dept1 = dept1; } public Manage(String name, double salary, String dept1) { super(name, salary); this.dept1 = dept1; } public static void main(String args[]) { employee e = new employee("Vikas", 122345); employee e2 = new employee("Vikas", 122345, "12-2-1991"); Manage m = (Manage) new Manage("Vikas", 122345, "Sales"); Manage m2 = new Manage("Vikas", 122345, "12-2-1991", "sales"); m.display(); m2.display(); } public void display() { System.out.println("Name " + name); System.out.println("Salary " + salary); System.out.println("Birth " + dob); System.out.println("Department " + dept1); } }

    Read the article

  • Trying to insert a row using stored procedured with a parameter binded to an expression.

    - by Arvind Singh
    Environment: asp.net 3.5 (C# and VB) , Ms-sql server 2005 express Tables Table:tableUser ID (primary key) username Table:userSchedule ID (primary key) thecreator (foreign key = tableUser.ID) other fields I have created a procedure that accepts a parameter username and gets the userid and inserts a row in Table:userSchedule Problem: Using stored procedure with datalist control to only fetch data from the database by passing the current username using statement below works fine protected void SqlDataSourceGetUserID_Selecting(object sender, SqlDataSourceSelectingEventArgs e) { e.Command.Parameters["@CurrentUserName"].Value = Context.User.Identity.Name; } But while inserting using DetailsView it shows error Procedure or function OASNewSchedule has too many arguments specified. I did use protected void SqlDataSourceCreateNewSchedule_Selecting(object sender, SqlDataSourceSelectingEventArgs e) { e.Command.Parameters["@CreatedBy"].Value = Context.User.Identity.Name; } DetailsView properties: autogen fields: off, default mode: insert, it shows all the fields that may not be expected by the procedure like ID (primary key) not required in procedure and CreatedBy (user id ) field . So I tried removing the 2 fields from detailsview and shows error Cannot insert the value NULL into column 'CreatedBy', table 'D:\OAS\OAS\APP_DATA\ASPNETDB.MDF.dbo.OASTest'; column does not allow nulls. INSERT fails. The statement has been terminated. For some reason parameters value is not being set. Can anybody bother to understand this and help?

    Read the article

  • using internationalization on list data

    - by singh
    i am using Struts2 in application. <s:iterator value="listObject"> <s:component template="abc.vm"> <s:param name="text" value="listValue" /> <s:param name="prefix" value="listIndex" /> </s:component> </s:iterator> listValue is a values of list. i am using iterator to traverse the list. now on listValue, i want to put here internationalization concept.so that all the list value can be display based on Locale which store in a list. please suggest!

    Read the article

  • Cordova - Scrolling with a fixed header and footer (ios)

    - by Samu Singh
    Using Cordova (phonegap) & bootstrap to make a mobile application, testing on IOS for now. Getting an issue with a header and footer bar that are fixed with scrollable content in the middle. When tapping to scroll, the header/footer bar moves down or up with the content but then snaps back to place as soon as the scrolling completes. If I use -webkit-overflow-scrolling: touch; it works as expected, but it makes it really awkward to scroll through the content, and if you scroll passed the end, it only scrolls the header or footer (with elastic overflow) until you stop for a second. here's my html for the header/footer bars: <div id="headerBar"> <div class="container-fluid" style="background-color: #1569C7"> <div class="row"> <div class="col-xs-3 text-left"> <button id="logoutButton" type="button" class="btn btn-default"> Log Out </button> <button type="button" class="btn btn-default" id="restoreQuestionFeedButton"> <span class="glyphicon glyphicon-chevron-left"></span> </button> </div> <div class="col-xs-6 text-center" style="height: 55px"> <strong id="usernameText"></strong> </div> <div class="col-xs-3 text-right"> <button id="oldCreatQuestionButton" type="button" class="btn btn-default"> <span class="glyphicon glyphicon-plus"></span> </button> </div> </div> </div> </div> <div id="footerBar"> <div class="container-fluid" style="padding: 0"> <div class="row text-center"> <button id="createQuestionButton" type="button" class="btn btn-default footerButton"> <span class="glyphicon glyphicon-plus"></span> <strong>Ask a new free question!</strong> </button> </div> </div> </div> And here is the related CSS: #headerBar { position: fixed; z-index: 100; top: 0; left: 0; width: 100%; background-color: #1569C7; } #footerBar { position: fixed; z-index: 100; bottom: 0; left: 0; width: 100%; background-color: #1569C7 !important; }

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • Preloading and caching of images in silverlight

    - by Prabhjot Singh
    Hi there I have a silverlight application in vs2010 and iam using silverlight 4.0. I have to show a videoppt in which a video is synchronised with images and it runs as a video powerpoint presentation. Is it possible to preload the images or cache them, so that they get rendered as soon as the video starts. If there is a way out, plz guide me.

    Read the article

  • Sending URL as a parameter using javascript

    - by Prashant Singh
    I have to send a name and a link from client side to the server. I thought of using AJAX called by Javascript to do this. This is what I mean. I wished to make an ajax request to a file called abc.php with parameters :- 1. http://thumbs2.ebaystatic.com/m/m7dFgOtLUUUSpktHRspjhXw/140.jpg 2. Apple iPod touch, 3rd generation, 32GB To begin with, I encoded the URL and tried to send it. But the server says status Forbidden Any solution to this ? UPDATE :: It end up calling to http://abc.com/addToWishlist.php?rand=506075547542422&image=http://thumbs1.ebaystatic.com/m/mO64jQrMqam2jde9aKiXC9A/140.jpg&prod=Flat%20USB%20Data%20Sync%20Charging%20Charger%20Cable%20Apple%20iPhone%204G%204S%20iPod%20Touch%20Nano Javascript Code :: function addToWishlist(num) { var myurl = "addToWishlist.php"; var myurl1 = myurl; myRand = parseInt(Math.random()*999999999999999); var rand = "?rand="+myRand ; var modurl = myurl1+ rand + "&image=" + encodeURI(storeArray[num][1]) + "&prod=" + encodeURI(storeArray[num][0]); httpq2.open("GET", modurl, true); httpq2.onreadystatechange = useHttpResponseq2; httpq2.send(null); } function useHttpResponseq2() { if (httpq2.readyState == 4) { if(httpq2.status == 200) { var mytext = httpq2.responseText; document.getElementById('wish' + num).innerHTML = "Added to your wishlist."; } } } Server Code <?php include('/home/ankit/public_html/connect_db.php'); $image = $_GET['image']; $prod = $_GET['prod']; $id = $_GET['id']; echo $prod; echo $image; ?> As I mentioned, its pretty basics More Updates : On trying to send a POST request via AJAX to the server, it says :- Refused to set unsafe header "Content-length" Refused to set unsafe header "Connection"

    Read the article

  • how to reload the whole page through a button placed in a division in jsp

    - by ajeet singh
    when i tried to make web project, i placed the links on the left on one division and a bigger division on the right to load the jsp pages on clicking the links making the main page same... but when there is a need arises to load the whole page by clicking the button placed on the right division, i found that the only page is loaded on the right division jsp calling its action... please help me to sort out this problem..

    Read the article

  • How to get dynamically session object in struts2

    - by Sujeet Singh
    I am trying to get dynamically session object in struts2 application. <s:if test="%{#session['resToken'].bookingType == 1}"> resToken can be get by <s:property value="%{resToken}">.. But I can't write <s:property> within <s:if test=""> its giving me error of double quotes.. org.apache.jasper.JasperException: /WEB-INF/jsp/booking/banquet/guest-Info-View.jsp(150,40) Unterminated &lt;s:if tag

    Read the article

  • Non-Git Github?

    - by Mihir Singh
    This is probably a really weird question... but is there a non-git Github? I want a place to post my projects and share my code (like Github) but I don't want to have to works with versions, commits, etc. I don't like having to create a link between my folder and my git repo and then push the changes etc. In addition, I don't want to have to have a local copy to create or add files; I can edit existing files in Github, but to create or add files, I have to do it locally and then commit and push. I'm not sure if this is the best site to ask on, but I figured someone might have the answer. Thanks in advance.

    Read the article

  • Google Map key in Android?

    - by Amandeep singh
    I am developing an android app in which i have to show map view i have done it once in a previous app but the key i used in the previous is not working int his app . It is just showing a pin in the application with blank screen. Do i have to use a different Map key for each project , If not Kindly help me how can i use my previous Key in this. and also I tried generating a new key but gave the the same key back . Here is the code i used public void onCreate(Bundle savedInstanceState) { super.onCreate(savedInstanceState); setContentView(R.layout.map); btn=(Button)findViewById(R.id.mapbtn); str1=getIntent().getStringExtra("LATITUDE"); str2=getIntent().getStringExtra("LONGITUDE"); mapView = (MapView)findViewById(R.id.mapView1); //View zoomView = mapView.getZoomControls(); mapView.setBuiltInZoomControls(true); //mapView.setSatellite(true); mc = mapView.getController(); btn.setOnClickListener(this); MapOverlay mapOverlay = new MapOverlay(); List<Overlay> listOfOverlays = mapView.getOverlays(); listOfOverlays.clear(); listOfOverlays.add(mapOverlay); String coordinates[] = {str1, str2}; double lat = Double.parseDouble(coordinates[0]); double lng = Double.parseDouble(coordinates[1]); p = new GeoPoint( (int) (lat * 1E6), (int) (lng * 1E6)); mc.animateTo(p); mc.setZoom(17); mapView.invalidate(); //mp.equals(o); } @Override protected boolean isRouteDisplayed() { // TODO Auto-generated method stub return false; } class MapOverlay extends com.google.android.maps.Overlay { @Override public boolean draw(Canvas canvas, MapView mapView, boolean shadow, long when) { super.draw(canvas, mapView, shadow); Paint mPaint = new Paint(); mPaint.setDither(true); mPaint.setColor(Color.RED); mPaint.setStyle(Paint.Style.FILL_AND_STROKE); mPaint.setStrokeJoin(Paint.Join.ROUND); mPaint.setStrokeCap(Paint.Cap.ROUND); mPaint.setStrokeWidth(2); //---translate the GeoPoint to screen pixels--- Point screenPts = new Point(); mapView.getProjection().toPixels(p, screenPts); //---add the marker--- Bitmap bmp = BitmapFactory.decodeResource(getResources(), R.drawable.pin); canvas.drawBitmap(bmp, screenPts.x, screenPts.y-50, null); return true; } Thanks....

    Read the article

  • Need to open to two excel files and add numbers from them into a third file using vba.

    - by Harpyar Singh
    I have two excel files which has similar formatting and the data map each other from cell b15:h31. Row 15 is heading and so is the column B. I want to read file1 cell by cell and add that cell's content to the corresponding cell in File 2 i.e C16 in file 1 gets added to C16 in file 2, C17 in file 1 to C17 in file 2 and so on. The output goes in file 3 or anything. trying to implement through vba but of no success so far. Does anyone know how to go about it.

    Read the article

< Previous Page | 14 15 16 17 18 19 20 21 22 23 24 25  | Next Page >