Search Results

Search found 45013 results on 1801 pages for 'example'.

Page 188/1801 | < Previous Page | 184 185 186 187 188 189 190 191 192 193 194 195  | Next Page >

• how to copy the results from a grep command to the bash clipboard?

  - by avilella

  If I type something in a Linux bash terminal with no X, and then use Ctrl+u, whatever I typed is stored in the bash "clipboard" (for lack of a better term), and I can type it again doing Ctrl+y. How can I copy the results from a grep command on a text file to such bash clipboard? For example, if I have an INSTALL file like this: ./installprocedure --do-some-long-and-complicated-operation-on-dir dir1 How can I copy the content of a grep command so that it's available doing Ctrl+y? For example: copy content to bash clipboard "grep installprocedure INSTALL" Ctrl+y ./installprocedure --do-some-long-and-complicated-operation-on-dir dir1 #cursor available here

  Read the article

• How do I get a PDF link in a Word document to open in the default browser?

  - by Tweek

  I'm trying to create a Word document with links to resources on the web. If I create a hyperlink to a regular HTML file, when I click on the link, it opens in my default browser (Google Chrome) as expected. However, if I click on a link to a PDF file on a website, it opens in Internet Explorer. Before it opens, I also get the following prompt: Microsoft Office Opening http://www.example.com/example.pdf Some files can contain viruses or otherwise be harmful to your computer. It is important to be certain that this file is from a trustworthy source. Would you like to open this file? OK Cancel I'm using Office 2010, but I'm asking for a user who is using Office 2007 and is experiencing the same issue. (His default browser is Firefox.) We're both on Windows 7.

  Read the article

• Excel Help: Fill Tool - Drag to the side (across columns) but increase the formula by Row Number.

  - by B-Ballerl

  There are answers out there to this question, but all of them have been under explianed so hence to difficult to coprehend and use them to my advantage. I want to do the seemingly simple (but not) task of Draging a Formula (Filling a series) across Column's while increasing the formula row number relativley. For Example to drag this formula: | =A1 | =A2 | =A3 Some other notes, Transposing by copy paste has proven too difficult for the amount of data. Offset and Indirect has been used by other people to do this but I don't get how they work at all so when I attempt to use them I don't know how to format it to my range. Here's a example photo Idealy we want the dragged section to continue on to fill the formula.

  Read the article

• linux + match only VALID IP from text file into other file

  - by yael

  please advice how to match only the valid IPs ( 255.255.255.255 ) from the file.txt and insert only the valid IP into VALID_IP.txt file ( see VALID_IP.txt for example ) the solution should be implemented in my ksh script ( so perl or sed or awk is fine also ) more file.txt e32)5.500.5.5*kjcdr ##@$1.1.1.1+++jmjh 1.1.1.1333 33331.1.1.1 @5.5.5.?????? ~3de.ede5.5.5.5 1.1.1.13444r54 192.9.30.174 &&^#%5.5.5.5 :5.5.5.5@%%^^&* :5.5.5.5: **22.22.22.22 172.78.0.1()*5.4.3.277 example of VALID_IP.txt file 1.1.1.1 192.9.30.174 5.5.5.5 5.5.5.5 5.5.5.5 22.22.22.22 172.78.0.1

  Read the article

• Apache: serving SSL only

  - by elect

  I have a website that I want to be access only by https://myurl.com. A normal typing myurl.com should be forwarded to the https. I tried different things such as: RewriteEngine On RewriteCond %{SERVER_PORT} 80 RewriteRule ^(.*)$ https://myurl.com/$1 [R,L] (rewrite mod ON) or NameVirtualHost *:80 <VirtualHost *:80> ServerName mysite.example.com DocumentRoot /usr/local/apache2/htdocs Redirect permanent /secure https://mysite.example.com/secure </VirtualHost> But they didnt work, which is the right way to do it? Debian & Apache 2

  Read the article

• How do you change color of gradient image found on the net?

  - by askmoo

  For example, I found this gradient image (randomly chosen) How do you change its color in Photoshop or GIMP? I tried overlay but it covers everything with that color. For example I want to have white-to-red gradient image. Possible to do it in a quick way via any of these tools or I have to make it from the scratch? This is the image before and after I use the tool suggested. You can see the horizontal striped on the after image.

  Read the article

• Is possible to arbitrarily register names to the same public IP?

  - by Alex. S.

  I registered a domain, lets say mysite.com (for example), then, results that somebody else has an A record from anotheraddress.com pointing to the same IP address of mine (in a VPS in linode.com) What can I do to avoid this???, I mean, I would prefer reject accesses from anotheraddress.com to my site. I just know only by casualty putting my genuine domain name on this http://www.domaintools.com/reverse-ip/ My DNS server is name.com, and the DNS server pointing to the my public IP is from GoDaddy. Is possible to register arbitrarily names to the same public IP? Can I use my DNS record with mysite.com to point to 209.85.133.147 (google.com), for example?

  Read the article

• How to reformat reStructuredText?

  - by wal-o-mat

  I'm writing reST in vim, which handles line breaks for me (after 80 chars). However, since I frequently go back and edit the text before, lines get ugly again. For example, in tables, it's sometimes annoying to re-format a complete table just because you need a line break in some place. So I wish I had a program that reads my ugly-but-correct reStructuredText and outputs it nicely formatted and wrapped. I found that pandoc in.rst -w rst mostly works, but it has some drawbacks. For example :author: John Doe becomes author John Doe and title formatting is changed as well. Sadly, there seems to be no rst2rst or something similar. Does anyone have some advice?

  Read the article

• How to re-arrange Excel database from 1 long row, into 3 short rows and automatically repeat the process?

  - by user326884

  I would appreciate help on the above-mentioned topic. I am unfamiliar with Visual Basic for Excel, so will need step-by-step guidance (if solution is via Visual Basic). For example :- Row 1, Sheet A: A1 B1 C1 D1 E1 F1 G1 H1 I1 To be re-arranged into Sheet B : Row 1 : A1, B1, C1 Row 2 : D1, E1, F1 Row 3 : G1, H1, I1 The Sheet A (database sheet) has a lot of rows (example 3,000 rows), hence the Sheet B is estimated to have 9,000 rows (i.e. 3 x 3,000). Thanking you in anticipation of your speedy response.

  Read the article

• rsync --link-dest behaviour when run as sudo

  - by fotNelton

  In order to create regular backups, I'm using rsync together with --link-dest so as to create hard-links for unchanged files. For example: rsync -ax \ --partial --delete --delete-excluded --inplace \ --exclude-from=/tmp/temp_excludes \ --link-dest=/Volumes/Backup/current \ /Users /Volumes/Backup/2012-06-25 This works very well as long as I start the process from my normal user account. Though as soon as I start the process using sudo it behaves erradically, meaning that rsync copies all the unchanged files instead of hard-linking them. Since sudo modifies the environment, I've already also tried sudo -E in conjunction with making sure that my sudoers file has the corresponding option set. Well, that didn't work either. So, the question is, how can I run rsync using sudo? Whereas the above example only shows a backup of the Users directory, I also need to backup some system files that I can only access as root.

  Read the article

• How can I lock a dictionary in debian server installed with ngix?

  - by Tin Aung Linn

  I tried so many methods and get stick hours with this.I edit /etc/nginx/nginx.conf and write these lines. location /home/user/domains/example.com/public_html/lockfolder/ { auth_basic "Restricted"; auth_basic_user_file /home/user/domains/example.com/.htpasswd; } and I use crypt(3) encryption to make passwd with the command mkpasswd.Then I did with the given procedure user:encryptedpasswd in .htpasswd. But things does not work as said.Let me know if anyone know how I can exactly make configure for my purpose! Thanks you.

  Read the article

• Keep ASP.NET site and content separate

  - by Nelson

  I have an ASP.NET site in folder x. Currently lots of other static content gets added to folder x and gets mixed in, making it one big mess. I would like to keep the ASP.NET site and the content separate somehow. I know you can create virtual directories in IIS, but there are LOTS and even some content in the root. The content people are not technical and really need an easy way to add it. I would stick everything in a subfolder (they don't touch anything outside, I don't touch their folder), but that would change their URLs (www.example.com/something to www.example.com/content/something). I almost need a way to "merge" two folders and have them act as one. I'm guessing that is impossible since there could be file conflicts, etc. Any other ways I can achieve this?

  Read the article

• How to measure that a host is good for users in Egypt ?

  - by Sherif Buzz

  Hi all, I currently have a site that's hosted in Texas. The majority of my users are from Egypt and I'm a bit concerned that the current hosting is not the optimal in terms of performance. The site is not slow but for how can I know if, for example, hosting it in Europe or Asia is better ? To clarify I need to know there is a way that I can test different hosting options - for example how can I test the average response time between Egypt and a host in Texas, the average response time between Egypt and a host in the UK ?

  Read the article

• Error page for OWA users on a different server?

  - by W_P

  We are getting ready to do a network-wide upgrade to Exchange 2010. The url for the old 2007 mailboxes is at https://mail.example.com and users who have had their mail box moved will have to go to https://Email.example.com If a user that has a 2010 mailbox attempts to login at the 2007 OWA location, they get a standard 403 Forbidden page. We would like to show them a page of our own making, that includes a link to the 2010 OWA login page. I assumed we could do this with an IIS Custom Error page, but setting the 403.4 error page in IIS on the Default web site doesn't seem to be working. Does anyone know how we could get around this? BTW, our OWA for the 2007 boxes in on Windows Server 2003, and IIS 6

  Read the article

• Fresh install of nginx causes browser to download index.html instead of opening it

  - by 010110110101

  When I view this in Chrome, http://localhost:90 the file is downloaded instead of displayed in Chrome. This question has been asked a lot of times on SO, but about index.php files. My problem is a plain jane HTML file, not a PHP file. That hasn't been asked yet. I was hoping the solution would be similar, but I haven't been able to figure it out. Here's my example.com.conf: server { server_name localhost; listen 90; root /var/www/example.com/html index index.html location / { try_file $uri $uri/ =404; } } My index.html file contains only two words, no markup Hello World I think it's the mime.types. The mime.types file has the entry for html in it. This is a fresh nginx install. nginx -t reports "test is successful"

  Read the article

• emacs does not open a file from argument and syntax highlight does not work

  - by Jus

  In my latest ubuntu box, When I type for example emacs ~/.bashrc, Emacs will start but not open .bashrc. This is true for any file I pass in. I've used Emacs for several years, and have never experienced this problem before. I added (global-font-lock-mode 1);; to my .emacs file, and Emacs does recognize it, for example. "(C++/; Abbrev)", but it won't do syntax highlighting. If you can solve any of these problems, it will be very appreciated. The following is my machine's configuration: uname -a Linux 2.6.35-28-generic-pae #49-Ubuntu SMP Tue Mar 1 14:58:06 UTC 2011 i686 GNU/Linux ~/.emacs (global-font-lock-mode 1);;

  Read the article

• Are you able to specify a the profile you want to use in pfexec?

  - by jigjig

  Are you able to specify which profile you want to use for a given user when using pfexec who has been assigned multiple profiles? One example for this use is so that we can execute a command as a different user within the same process. In exec_attr, you are able to specify the uid/gid that will be used to execute a particular command as in the following example entry: Name Service Security:suser:cmd:::/usr/sbin/rpc.nsid:uid=0;gid=0 The above profile will use the super user (uid=0) to execute the rpc.nsid command. In user_attr, you can specify multiple profiles as below: testuser::::type=normal;profiles=Name Service Security,Object Access Management Can you then specify directly to use the Object Access Management profile to pfexec?

  Read the article

• Disqus cache of unposted posts

  - by user129107

  Some webpages implement Disqus and also have the rather bad policy of adding auto refresh to the page. This result in for example one writing a long answer in a debate and then a refresh comes along – and everything is gone. Is the comments, written, but not posted, cached somewhere? Is it possible to retrieve? I have experienced this on various pages. In the current case the debate page was reloaded and a rather lengthy post with a lot of references and long thought out sentences vanished. This page closes the debate during night time, and do a auto refresh of the page when one pass midnight – as such I'm not able to retrieve the debate for another 8 hours. Other pages implement for example an auto refresh after 20 minutes. Linux, Google Chrome.

  Read the article

• Send request body data when running siege

  - by qui

  I am trying to use the command line utility Siege to load test a service. The service recieves json in the request body via a POST. I have a file called example-data.json with the json inside. I will eventually turn this into a tiny service which creates random json for testing, but this should do for now I have another file called hit-qa.siege with http://www.qa-url.com POST < example-data.json and i try and run siege -c10 -d1 -r1 -f ops/perf/hammer-dev.siege When I check the logs of the service, it is not recieving anything in the request body. My googles have been fruitless, does anyone know how to accomplish this?

  Read the article

• I can see markup characters in vim `:help`

  - by Relax

  I just created a .txt file inside .vim/doc for documenting one little function of my .vimrc, ran :helptags ~/.vim/doc and apparently the whole vim help system went wild. Now, if I open for example :help help, I see things like: This also works together with other characters, for example to find help for CTRL-V in Insert mode: > :help i^V < (notice the < and characters). I can also see the ~ at the end of headlines and the modeline at the end of the help page (thinks like vim:tw=78:ts=8:ft=help:norl:). I have no idea about what happens or how to fix it. Any clue? Thanks in advance!

  Read the article

• Convert text to table

  - by Quattro

  I would like convert text into a table. Here is a link to the text http://www.tcdb.org/public/tcdb Short example: >gnl|TC-DB|A0CIB0|1.A.17.3.1 Chromosome undetermined scaffold_19, whole genome shotgun sequence OS=Paramecium tetraurelia GN=GSPATT00007662001 PE=4 SV=1 MDDQNQPILQEQPKPKQKKPLLNTKMVKKQKMQNKKEENLREILNFYTNQVDARKFLQKM KAVVDSNQQEKKYQDDFLNPNEYNEMQDIYEDYNMGDLVIVFPNPDADGVKNPPITYKEA PLTKTNFYSKIGNVSYENDIDELCVDEMEYLRNMRNVDGEHMDQDHVKEEI >gnl|TC-DB|A0CS82|9.B.82.1.5 Chromosome undetermined scaffold_26, whole genome shotgun sequence - Paramecium tetraurelia. MIIEEQIEEKMIYKAIHRVKVNYQKKIDRYILYKKSRWFFNLLLMLLYAYRIQNIGGFYI VTYIYCVYQLQLLIDYFTPLGLPPVNLEDEEEDDDQFQNDFSELPTTLSNKNELNDKEFR PLLRTTSEFKVWQKSVFSVIFAYFCTYIPIWDIPVYWPFLFCYFFVIVGMSIRKYIKHMK KYGYTILDFTKKK I wanted to have columns for example delimited with pipe | or ; |>gnl|TC-DB|A0CIB0|1.A.17.3.1| Chromosome undetermined scaffold_19, whole genome shotgun sequence OS=Paramecium tetraurelia GN=GSPATT00007662001 PE=4 SV=1| MDDQNQPILQEQPKPKQKKPLLNTKMVKKQKMQNKKEENLREILNFYTNQVDARKFLQKM KAVVDSNQQEKKYQDDFLNPNEYNEMQDIYEDYNMGDLVIVFPNPDADGVKNPPITYKEA PLTKTNFYSKIGNVSYENDIDELCVDEMEYLRNMRNVDGEHMDQDHVKEEI I am working with Windows and I don't know how to do it I just know every row starts with > I want to substitute the first whitespace in a row with a delimiter like | or ; after the first regular expression new line in a row, I want also a delimiter everything between the regular expression first new line and > should go into a new column (it's a sequence of a protein)

  Read the article

• How to get the Host value inside ~/.ssh/config

  - by iconoclast

  Within a ~/.ssh/config or ssh_config file, %h will give you the HostName value, but how do you get the Host ("alias") value? Why would I want to do that? Well, here's an example Host some_host_alias HostName 1.2.3.4 User my_user_name PasswordAuthentication no IdentityFile ~/.ssh/some_host_alias.rsa.id LocalCommand some_script.sh %h # <---- this is the critical line If I pass %h to the script, then it uses 1.2.3.4, which fails to give it all the options it needs to connect to that machine. I need to pass some_host_alias, but I can't find the % variable for that. (And: yes! I'm aware of the risk of recursion. That's solved inside the script.) UPDATE: Kenster pointed out that I could just hard-code the Host value as an argument to the script. Of course this will work in the example I gave, but it won't work if I'm using pattern matching for the Host.

  Read the article

• All HTTPS, or is it OK to accept HTTP and redirect (secure vs. user friendly)

  - by tharrison

  Our site currently redirects requests sent to http://example.com to https://example.com -- everything beyond this is served over SSL. For now, the redirect is done with an Apache rewrite rule. Our site is dealing with money, however, so security is pretty important. Does allowing HTTP in this way pose any greater security risk than just not opening or listening on port 80? Ideally, it's a little more user-friendly to redirect. (I am aware that SSL is only one of a large set of security considerations, so please make the generous assumption that we have done at least a "very good" job of covering various security bases.)

  Read the article

• VLC stream with trickplay

  - by marjasin

  The idea is to start a video stream from one computer and watch it on another with the ability to start/stop the stream. I think I could do this with VLC but i haven't been able to figure out how. I've tried the following: (From the official forum) Stream with RTSP and RTP: on the server, run: % vlc -vvv input_stream --sout '#rtp{dst=192.168.0.12,port=1234,sdp=rtsp://server.example.org:8080/test.sdp}' on the client(s), run: % vlc rtsp://server.example.org:8080/test.sdp But this doesn't give me the ability to start/stop the stream from the client. According to the VLC release note something called "Trick play" was added in version 1.0. This seems to be what I'm looking for but i can't find any documentation that descibes how to use it.

  Read the article

• Is there a way to get Postfix to both forward an e-mail *and* reject it via recipient_address_rejected

  - by Mac

  In postfix, I'd like a way to deal with e-mail accounts that are no longer active by having postfix send the standard "Recipient address rejected" type message, but still forwarding the e-mail to another user. Thus, if someone sends an e-mail to [email protected], it will bounce the message back to the sender for future reference, but the mail will still get forwarded to [email protected] to deal with. .vacation and / or .forward files let me down because they will either reply or forward, but not both. Any tips?

  Read the article

< Previous Page | 184 185 186 187 188 189 190 191 192 193 194 195  | Next Page >