Search Results

Search found 11629 results on 466 pages for 'cloud solutions'.

Page 195/466 | < Previous Page | 191 192 193 194 195 196 197 198 199 200 201 202  | Next Page >

  • Virtual session on windows xp

    - by dotnet-practitioner
    What is the easiest way to install , setup, and run virtual session on my fresh install on my windows xp computer? I want to be able to browse , install a new software in a new virtual session instead of machine itself. What is available out there? What kind of software it would take and are there any free solutions out there? Easiest solution would be very helpful for me.

    Read the article

  • Hardware for multipurpose home server

    - by Michael Dmitry Azarkevich
    Hi guys, I'm looking to set up a multipurpose home server and hoped you could help me with the hardware selection. First of all, the services it will provide: Hosting a MySQL database (for training and testing purposes) FTP server Personal Mail Server Home media server So with this in mind I've done some research, and found some viable solutions: A standard PC with the appropriate software (Either second hand or new) A non-solid state mini-ITX system A solid state, fanless mini-ITX system I've also noted the pros and cons of each system: A standard second hand PC with old hardware would be the cheapest option. It could also have lacking processing power, not enough RAM and generally faulty hardware. Also, huge power consumption heat generation and noise levels. A standard new PC would have top-notch hardware and will stay that way for quite some time, so it's a good investment. But again, the main problem is power consumption, heat generation and noise levels. A non-solid state mini-ITX system would have the advantages of lower power consumption, lower cost (as far as I can see) and long lasting hardware. But it will generate noise and heat which will be even worse because of the size. A solid state, fanless mini-ITX system would have all the advantages of a non-solid state mini-ITX but with minimal noise and heat. The main disadvantage is the read\write problems of flash memory. All in all I'm leaning towards a non-solid state mini-ITX because of the read\write issues of flash memory. So, after this overview of what I do know, my questions are: Are all these services even providable from a single server? To my best understanding they are, but then again, I might be wrong. Is any of these solutions viable? If yes, which one is the best for my purposes? If not, what would you suggest? Also, on a more software oriented note: OS wise, I'm planning to run Linux. I'm currently thinking of four options I've been recommended: CentOS, Gentoo, DSL (Damn Small Linux) and LFS (Linux From Scratch). Any thoughts on this? Any other distro you would recomend? Regarding FTP services, I've herd good things about FileZila. Anyone has any experience with that? Do you recommend it? Do you recommend something else? Regarding the Mail service, I know nothing about this except that it exists. Any software you recommend for this task? Home media, same as mail service. Any recommended software? Thank you very much.

    Read the article

  • How to prevent dual booted OSes from damaging each other?

    - by user1252434
    For better compatibility and performance in games I'm thinking about installing Windows additionally to Linux. I have security concerns about this, though. Note: "Windows" in the remaining text includes not only the OS but also any software running on it. Regardless of whether it comes included or is additionally installed, whether it is started intentionally or unintentionally (virus, malware). Is there an easy way to achieve the following requirements: Windows MUST NOT be able to kill my linux partition or my data disk neither single files (virus infection) nor overwriting the whole disk Windows MUST NOT be able to read data disk (- extra protection against spyware) Linux may or may not have access to the windows partition both Linux and Windows should have full access to the graphics card this rules out desktop VM solutions for gaming I want the manufacturer's windows graphics card driver Regarding Windows to be unable to destroy my linux install: this is not just the usual paranoia, that has happened to me in the past. So I don't accept "no ext4 driver" as an argument. Once bitten, twice shy. And even if destruction targeted at specific (linux) files is nearly impossible, there should be no way to shred the whole partition. I may accept the risk of malware breaking out of a barrier (e.g. VM) around the whole windows box, though. Currently I have a system disk (SSD) and a data disk (HDD), both SATA. I expect I have to add another disk. If i don't: even better. My CPU is a Intel Core i5, with VT-x and VT-d available, though untested. Ideas I've had so far: deactivate or hide other HDs until reboot at low level possible? can the boot loader (grub) do this for me? tiny VM layer: load windows in a VM that provides access to almost all hardware, except the HDs any ready made software solution for this? Preferably free. as I said: the main problem seems to be to provide full access to the graphics card hardware switch to cut power to disks commercial products expensive and lots of warnings against cheap home built solutions preferably all three hard disks with one switch (one push) mobile racks - won't wear of daily swapping be a problem?

    Read the article

  • sed or grep or awk to match very very long lines

    - by yael
    more file param1=" 1,deerfntjefnerjfntrjgntrjnvgrvgrtbvggfrjbntr*rfr4fv*frfftrjgtrignmtignmtyightygjn 2,3,4,5,6,7,8, rfcmckmfdkckemdio8u548384omxc,mor0ckofcmineucfhcbdjcnedjcnywedpeodl40fcrcmkedmrikmckffmcrffmrfrifmtrifmrifvysdfn" need to match the content of $param1 in the file but its not work for example sed -n "/$param1/p" file or any grep $param1 file etc... any other solutions? maybe with perl?

    Read the article

  • unable to type in web browser ubuntu 64bit

    - by mononym
    Hi Guys, I upgraded to 64bit ubuntu and every now and again (quite often though) i am unable to to type into the search box for google in chrome and firefox, i havent tried other browsers as these are the 2 i primarily use. Has anyone else experienced this? any solutions? also i'm unable to drag the slider in youtube (in firefox) to scan through videos.

    Read the article

  • How do you monitor and react when some scheduled job fails? - general question

    - by Dzida
    Hi, In many projects my team faced problems with 'silent fails' of some important components. There are lot of tasks executed behind the scenes and if somethings fails (either by errors in logic or hardware problems) in most cases responsible person is not notified (or not notified instantly). I know about heavy-weight monitoring tools that could solve some of that problems but there over-complicated and too expensive for our team. I am interested what are your solutions for such problems.

    Read the article

  • Circumvent proxy filter that disables the download of EXE files

    - by elgrego
    Do you know of a way to download exe files although the web proxy has a filter in place not to allow this? I have searched for a feature web site that does automatic file renaming. That should certainly make it possible. The solution would take a URL and then change the extension so that it would look to my proxy as I was downloading a .dat file (or similar). There are perhaps other solutions to this problem.

    Read the article

  • Website & Forum sharing the same login credentials ?

    - by Brian
    I am going to be running a small site (100 hits a week maybe) and I am looking for a quick and easy way to share login information between the main website, a control panel (webmin, cpanel, or something), and the forum. One login needed to access any of the three. The website won't have use for the login, per say. But it will display "logged in" when you are on the website. Any custom solutions, any thoughts, logic, examples?

    Read the article

  • Any way to Sync Google Bookmarks to iPhone OTA?

    - by BenA
    Does anybody know if its possible to sync Google Bookmarks over the air to my iPhone? Either natively or with an App? Googling it only seems to yield solutions involving importing my bookmarks to IE, and then syncing through iTunes. I'd like to skip both of these middlemen if thats at all possible.

    Read the article

  • Any free Exchange hosts out there?

    - by Pure.Krome
    Hi folks, Are there any free Microsoft Exchange hosted solutions? I understand that Microsoft Exchange is a paid/licensed product, but I was curious if there might be a host that has a free hosting model (e.g. for <= 3 mailboxes per domain)? Larger mail boxes per domain == cost. ?? Finally, please refrain from suggesting other mail services (eg. sendmail, etc).

    Read the article

  • ffdshow h.264 audio desync

    - by Core Xii
    When I encode video with ffdshow with h.264, the audio is out of sync. At the very beginning of the video, the picture freezes for about 1 second, while the audio plays fine, resulting in the audio being that 1 second ahead of the picture throughout the entire video. Any ideas on possible causes or, obviously, solutions?

    Read the article

  • Free web gallery installation that can use existing directory hierarchy in filesystem?

    - by user1338062
    There are several different free software gallery projects (Gallery, Coppermine, etc), but as far as I know each of those creates a copy of imported images in their internal storage, be it directory structure or database). Is there any gallery software that would allow keeping existing directory hierarchy of media files (images, videos), as-is, and just store the meta-data of them in a database? I guess at least various NAS solutions ship with software like this.

    Read the article

  • How to prevent Vista from entering Sleep mode when certain conditions exist?

    - by idyllhands
    Mainly, I would like to prevent my laptop from entering Sleep mode when I am playing music or streaming video. This is on my laptop, so another option that would work would be to prevent sleep mode whenever the laptop is plugged into my tv via HDMI (ie when HDMI port is in use). Or prevent sleep mode whenever there is audio playing.. I am soon upgrading to Windows 7, so solutions using 7 would be great also/instead. Thanks!

    Read the article

  • Virtualization Solution

    - by Xeross
    I have a home server I use for various things, and have recently switched over to using VMs, however I can't seem to find a decent VM solution that does what I want. Xen Connection keeps dropping every few minutes (So this means it's practically unusable), but with ParaVirtOps faster than VMWare ESXi, and I can use software RAID VMWare ESXi Works fine, no connection drops, but I have to run it from USB stick, modify some archive file and I can't use software RAID -- So are there any other solutions out there that do allow me to use software raid, that have a stable network connection, and that also offer paravirtualization

    Read the article

  • Mercurial repositories hosting with different user access levels

    - by kender
    I want to set a few Mercurial 'central' repositories on one machine. There are few things I need to have working though: Each repository should have its own ACL, with different users allowed to push/pull It shouldn't be ssh-based (it shouldn't require users to have shell accounts on that machine) So, I guess that leaves me with some https with basic authentication, right? Are there any working solutions that provide this kind of functions?

    Read the article

  • Making many network shares appear as one

    - by jimbojw
    Givens: disk is cheap, and there's plenty lying around on various computers around the corporate intranet redundant contiguous large storage volumes are expensive Problem: It would be fantastic to have a single entry point (drive letter, network path) that presents all this space as one contiguous filesystem, effectively abstracting the disk and network architecture from the paths presented to users. Does anyone know how to implement such a solution? I'm open to Windows and non-windows solutions, free and proprietary.

    Read the article

  • How can I make vim show the current class and method I'm editing

    - by dcrosta
    Does anyone know if it's possible (or know of an existing vim script or plugin) that can create a "status bar" that shows the name of the current class and method (or function) I'm editing? I'm imagining that it would plug into the syntax parser for the filetype of the current buffer, and display a breadcrumb trail to show you what you're currently editing. I don't know vimscript well enough to suggest any more than that, but if there aren't any good solutions already, I may begin to hack on one, so suggestions as to where to start are welcome, too!

    Read the article

  • There are currently no logon servers available

    - by linganna
    we are using free-ipaserver(192.168.0.200) on fedora, clients are windows xp. we are successfully added two xp clients(m01(192.168.0.60, m02(192.168.0.61) on test environment. and also our server name is ipaserver & domain name is xyz.com , samba has been configured working fine. problem is whenever we access from one xp machine another xp machine we are getting this error, There are currently no logon servers available to service the logon request, please give the solutions.

    Read the article

  • Secure Standalone Server Plus Firewall Unit [closed]

    - by orbitron
    We need to send a 2U server, 1U UPS and 1U firewall to a third-party. The thing is, it needs to be a secured case (locked unit) that has proper airflow and we can have power and networking cables coming out of the back. We've googled far and wide and have only been able to find 'hard case' units that offer some level of security but they are extremely bulky and require freight delivery. Thank you for any insight or solutions.

    Read the article

  • How to read verbose VC++ linker output

    - by Assaf Lavie
    Trying to debug some linker errors, I turned on /VERBOSE and I'm trying to make sense of the output. It occurs to me that I really don't know how to read it. For example: 1>Compiling version info 1>Linking... 1>Starting pass 1 1>Processed /DEFAULTLIB:mfc80.lib 1>Processed /DEFAULTLIB:mfcs80.lib 1>Processed /DEFAULTLIB:msvcrt.lib 1>Processed /DEFAULTLIB:kernel32.lib 1>Processed /DEFAULTLIB:user32.lib .... 1>Processed /DEFAULTLIB:libgslcblasMD.lib 1>Searching libraries 1> Searching V:\Src\Solutions\\..\..\\Common\Win32\Lib\PlxApi.lib: 1> Searching ..\..\..\..\out\win32\release\lib\camerageometry.lib: 1> Searching ..\..\..\..\out\win32\release\lib\geometry.lib: 1> Found "public: __thiscall VisionMap::Geometry::Box2d::operator class VisionMap::Geometry::Box2DInt(void)const " (??BBox2d@Geometry@VisionMap@@QBE?AVBox2DInt@12@XZ) 1> Referenced in FocusDlg.obj 1> Loaded geometry.lib(Box2d.obj) 1>Processed /DEFAULTLIB:CGAL-vc80-mt.lib 1>Processed /DEFAULTLIB:boost_thread-vc80-mt-1_33_1.lib What's going on here? I think I understand this bit: 1>Processed /DEFAULTLIB:libgslcblasMD.lib 1>Searching libraries 1> Searching V:\Src\Solutions\\..\..\\Common\Win32\Lib\PlxApi.lib: 1> Searching ..\..\..\..\out\win32\release\lib\camerageometry.lib: 1> Searching ..\..\..\..\out\win32\release\lib\geometry.lib: 1> Found "public: __thiscall VisionMap::Geometry::Box2d::operator class VisionMap::Geometry::Box2DInt(void)const " (??BBox2d@Geometry@VisionMap@@QBE?AVBox2DInt@12@XZ) 1> Referenced in FocusDlg.obj 1> Loaded geometry.lib(Box2d.obj) It's trying to find the implementation of the above operator, which is used somewhere in FocusDlg.cpp, and it finds it in geometry.lib. But what does 1>Processed /DEFAULTLIB:libgslcblasMD.lib mean? What determines the order of symbol resolution? Why is it loading this particular symbol while processing libgslcblasMD.lib which is a 3rd party library? Or am I reading it wrong? It seems that the linker is going through the symbols referenced in the project's various object files, but I have no idea in what order. It then searches the static libraries the project uses - by project reference, explicit import and automatic default library imports; but it does so in an order that, again, seems arbitrary to me. When it finds a symbol, for example in geometry.lib, it then continues to find a bunch of other symbols from the same lib: 1> Searching V:\Src\Solutions\\..\..\\Common\Win32\Lib\PlxApi.lib: 1> Searching ..\..\..\..\out\win32\release\lib\camerageometry.lib: 1> Searching ..\..\..\..\out\win32\release\lib\geometry.lib: 1> Found "public: __thiscall VisionMap::Geometry::Box2d::operator class VisionMap::Geometry::Box2DInt(void)const " (??BBox2d@Geometry@VisionMap@@QBE?AVBox2DInt@12@XZ) 1> Referenced in FocusDlg.obj 1> Loaded geometry.lib(Box2d.obj) 1>Processed /DEFAULTLIB:CGAL-vc80-mt.lib 1>Processed /DEFAULTLIB:boost_thread-vc80-mt-1_33_1.lib 1> Found "public: __thiscall VisionMap::Geometry::Box2DInt::Box2DInt(int,int,int,int)" (??0Box2DInt@Geometry@VisionMap@@QAE@HHHH@Z) 1> Referenced in FocusDlg.obj 1> Referenced in ImageView.obj 1> Referenced in geometry.lib(Box2d.obj) 1> Loaded geometry.lib(Box2DInt.obj) 1> Found "public: virtual __thiscall VisionMap::Geometry::Point3d::~Point3d(void)" (??1Point3d@Geometry@VisionMap@@UAE@XZ) 1> Referenced in GPSFrm.obj 1> Referenced in MainFrm.obj 1> Loaded geometry.lib(Point3d.obj) 1> Found "void __cdecl VisionMap::Geometry::serialize<class boost::archive::binary_oarchive>(class boost::archive::binary_oarchive &,class VisionMap::Geometry::Point3d &,unsigned int)" (??$serialize@Vbinary_oarchive@archive@boost@@@Geometry@VisionMap@@YAXAAVbinary_oarchive@archive@boost@@AAVPoint3d@01@I@Z) 1> Referenced in GPSFrm.obj 1> Referenced in MainFrm.obj 1> Loaded geometry.lib(GeometrySerializationImpl.obj) But then, for some reason, it goes on to find symbols that are defined in other libs, and returns to geometry later on (a bunch of times). So clearly it's not doing "look in geometry and load every symbol that's references in the project, and then continue to other libraries". But it's not clear to me what is the order of symbol lookup. And what's the deal with all those libraries being processed at the beginning of the linker's work, but not finding any symbols to load from them? Does this project really not use anything from msvcrt.lib, kernel32.lib? Seems unlikely. So basically I'm looking to decipher the underlying order in the linker's operation.

    Read the article

  • Embedding mercurial revision information in Visual Studio c# projects automatically

    - by Mark Booth
    Original Problem In building our projects, I want the mercurial id of each repository to be embedded within the product(s) of that repository (the library, application or test application). I find it makes it so much easier to debug an application ebing run by custiomers 8 timezones away if you know precisely what went into building the particular version of the application they are using. As such, every project (application or library) in our systems implement a way of getting at the associated revision information. I also find it very useful to be able to see if an application has been compiled with clean (un-modified) changesets from the repository. 'Hg id' usefully appends a + to the changeset id when there are uncommitted changes in a repository, so this allows is to easily see if people are running a clean or a modified version of the code. My current solution is detailed below, and fulfills the basic requirements, but there are a number of problems with it. Current Solution At the moment, to each and every Visual Studio solution, I add the following "Pre-build event command line" commands: cd $(ProjectDir) HgID I also add an HgID.bat file to the Project directory: @echo off type HgId.pre > HgId.cs For /F "delims=" %%a in ('hg id') Do <nul >>HgID.cs set /p = @"%%a" echo ; >> HgId.cs echo } >> HgId.cs echo } >> HgId.cs along with an HgId.pre file, which is defined as: namespace My.Namespace { /// <summary> Auto generated Mercurial ID class. </summary> internal class HgID { /// <summary> Mercurial version ID [+ is modified] [Named branch]</summary> public const string Version = When I build my application, the pre-build event is triggered on all libraries, creating a new HgId.cs file (which is not kept under revision control) and causing the library to be re-compiled with with the new 'hg id' string in 'Version'. Problems with the current solution The main problem is that since the HgId.cs is re-created at each pre-build, every time we need to compile anything, all projects in the current solution are re-compiled. Since we want to be able to easily debug into our libraries, we usually keep many libraries referenced in our main application solution. This can result in build times which are significantly longer than I would like. Ideally I would like the libraries to compile only if the contents of the HgId.cs file has actually changed, as opposed to having been re-created with exactly the same contents. The second problem with this method is it's dependence on specific behaviour of the windows shell. I've already had to modify the batch file several times, since the original worked under XP but not Vista, the next version worked under Vista but not XP and finally I managed to make it work with both. Whether it will work with Windows 7 however is anyones guess and as time goes on, I see it more likely that contractors will expect to be able to build our apps on their Windows 7 boxen. Finally, I have an aesthetic problem with this solution, batch files and bodged together template files feel like the wrong way to do this. My actual questions How would you solve/how are you solving the problem I'm trying to solve? What better options are out there than what I'm currently doing? Rejected Solutions to these problems Before I implemented the current solution, I looked at Mercurials Keyword extension, since it seemed like the obvious solution. However the more I looked at it and read peoples opinions, the more that I came to the conclusion that it wasn't the right thing to do. I also remember the problems that keyword substitution has caused me in projects at previous companies (just the thought of ever having to use Source Safe again fills me with a feeling of dread *8'). Also, I don't particularly want to have to enable Mercurial extensions to get the build to complete. I want the solution to be self contained, so that it isn't easy for the application to be accidentally compiled without the embedded version information just because an extension isn't enabled or the right helper software hasn't been installed. I also thought of writing this in a better scripting language, one where I would only write HgId.cs file if the content had actually changed, but all of the options I could think of would require my co-workers, contractors and possibly customers to have to install software they might not otherwise want (for example cygwin). Any other options people can think of would be appreciated. Update Partial solution Having played around with it for a while, I've managed to get the HgId.bat file to only overwrite the HgId.cs file if it changes: @echo off type HgId.pre > HgId.cst For /F "delims=" %%a in ('hg id') Do <nul >>HgId.cst set /p = @"%%a" echo ; >> HgId.cst echo } >> HgId.cst echo } >> HgId.cst fc HgId.cs HgId.cst >NUL if %errorlevel%==0 goto :ok copy HgId.cst HgId.cs :ok del HgId.cst Problems with this solution Even though HgId.cs is no longer being re-created every time, Visual Studio still insists on compiling everything every time. I've tried looking for solutions and tried checking "Only build startup projects and dependencies on Run" in Tools|Options|Projects and Solutions|Build and Run but it makes no difference. The second problem also remains, and now I have no way to test if it will work with Vista, since that contractor is no longer with us. If anyone can test this batch file on a Windows 7 and/or Vista box, I would appreciate hearing how it went. Finally, my aesthetic problem with this solution, is even strnger than it was before, since the batch file is more complex and this there is now more to go wrong. If you can think of any better solution, I would love to hear about them.

    Read the article

< Previous Page | 191 192 193 194 195 196 197 198 199 200 201 202  | Next Page >