bharat bonde - Page 2 - Developer IT

Calling member function declared in another dll

- by bharat

I have created CMyClass,in which defined one method CallMe().when I build this project MyProject.dll is generated. Now in some another project, I want to call CallMe of CMyClass . can anybody tell me how to do it ? Thanks in advance....

Read the article

Converting LogFont height to Font size in points

- by Bharat

Hi I have a LOGFONT structure. Now all i'd like to do is get the associated font size in points from the LOGFONT height. Thanks in advance

Read the article

nHibernate <one-to-one> mapping

- by bharat

Please help me out I am trying to do this but nHibernate not allowing can any one help me out how to do this?

Read the article

nHibernate Key Column Attribute Insert=false

- by bharat

How do i do an insert false on key attribute like the way we do for join

Read the article

ruby restrict attr_accessor in subclass

- by Arivarasan

I want restrict the access of superclass's method in subclass class Parent attr_accessor :first_name, :last_name def initialize(first_name, last_name) @first_name, @last_name = first_name, last_name end def full_name @first_name + " " + @last_name end end class Son < Parent attr_accessor :first_name def initialize(parent, first_name) @first_name = first_name @last_name = parent.last_name end def full_name @first_name + " " + @last_name end end p = Parent.new("Bharat", "Chipli") puts p.full_name s = Son.new(p, "Harry") s.last_name= "Smith" puts s.full_name here i am getting son's full name as "Harry Smith", but i want "Harry Chipli"

Read the article

Json Traverse Problem, not able to traverse values

- by Jos

I m getting the below return from ajax call but not able to traverse it please please help. { "1": { "tel1": null, "status": "1", "fax": "", "tel2": null, "name": "sh_sup1", "country": "Anguilla", "creation_time": "2010-06-02 14:09:40", "created_by": "0", "Id": "85", "fk_location_id": "3893", "address": "Noida", "email": "[email protected]", "website_url": "http://www.noida.in", "srk_main_id": "0" }, "0": { "tel1": "Ahemdabad", "status": "1", "fax": "", "tel2": "Gujrat", "name": "Bharat Petro", "country": "India", "creation_time": "2010-05-31 15:36:53", "created_by": "0", "Id": "82", "fk_location_id": "3874", "address": "THIS is test address", "email": "[email protected]", "website_url": "http://www.bp.com", "srk_main_id": "0" }, "count": 2 }

Read the article

Test your internet connection - Emtel Mobile Internet

After yesterday's report on Emtel Fixed Broadband (I'm still wondering where the 'fixed' part is), I did the same tests on Emtel Mobile Internet. For this I'm using the Huawei E169G HSDPA USB stick, connected to the same machine. Actually, this is my fail-safe internet connection and the system automatically switches between them if a problem, let's say timeout, etc. has been detected on the main line. For better comparison I used exactly the same servers on Speedtest.net. The results Following are the results of Rose Hill (hosted by Emtel) and respectively Frankfurt, Germany (hosted by Vodafone DE): Speedtest.net result of 31.05.2013 between Flic en Flac and Rose Hill, Mauritius (Emtel - Mobile Internet) Speedtest.net result of 31.05.2013 between Flic en Flac and Frankfurt, Germany (Emtel - Mobile Internet) As you might easily see, there is a big difference in speed between national and international connections. More interestingly are the results related to the download and upload ratio. I'm not sure whether connections over Emtel Mobile Internet are asymmetric or symmetric like the Fixed Broadband. Might be interesting to find out. The first test result actually might give us a clue that the connection could be asymmetric with a ratio of 3:1 but again I'm not sure. I'll find out and post an update on this. It depends on network coverage Later today I was on tour with my tablet, a Samsung Galaxy Tab 10.1 (model GT-P7500) running on Android 4.0.4 (Ice Cream Sandwich), and did some more tests using the Speedtest.net app. The results are actually as expected and in areas with better network coverage you will get better results after all. At least, as long as you stay inside the national networks. For anything abroad, it doesn't really matter. But see for yourselves: Speedtest.net result of 31.05.2013 between Cascavelle and servers in Rose Hill, Mauritius (Emtel - Mobile Internet), Port Louis, Mauritius and Kuala Lumpur, Malaysia It's rather shocking and frustrating to see how the speed on international destinations goes down. And the full capability of the tablet's integrated modem (HSDPA: 21 Mbps; HSUPA: 5.76 Mbps) isn't used, too. I guess, this demands more tests in other areas of the island, like Ebene, Pailles or Port Louis. I'll keep you updated... The question remains: Alternatives? After the publication of the test results on Fixed Broadband I had some exchange with others on Facebook. Sadly, it seems that there are really no alternatives to what Emtel is offering at the moment. There are the various internet packages by Mauritius Telecom feat. Orange, like ADSL, MyT and Mobile Internet, and there is Bharat Telecom with their Bees offer which is currently limited to Ebene and parts of Quatre Bornes.

Read the article

Parse a text file into multiple text file

- by Vijay Kumar Singh

I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

Developer IT