Search Results

Search found 36 results on 2 pages for 'bharat pawar'.

facebook twitter digg google delicious technorati stumbleupon myspace wordpress linkedin gmail igoogle windows live tumblr viadeo yahoo buzz yahoo mail yahoo bookmarks favorites email print

Page 2/2 | < Previous Page | 1 2 

  • ruby restrict attr_accessor in subclass

    - by Arivarasan
    I want restrict the access of superclass's method in subclass class Parent attr_accessor :first_name, :last_name def initialize(first_name, last_name) @first_name, @last_name = first_name, last_name end def full_name @first_name + " " + @last_name end end class Son < Parent attr_accessor :first_name def initialize(parent, first_name) @first_name = first_name @last_name = parent.last_name end def full_name @first_name + " " + @last_name end end p = Parent.new("Bharat", "Chipli") puts p.full_name s = Son.new(p, "Harry") s.last_name= "Smith" puts s.full_name here i am getting son's full name as "Harry Smith", but i want "Harry Chipli"

    Read the article

  • Json Traverse Problem, not able to traverse values

    - by Jos
    I m getting the below return from ajax call but not able to traverse it please please help. { "1": { "tel1": null, "status": "1", "fax": "", "tel2": null, "name": "sh_sup1", "country": "Anguilla", "creation_time": "2010-06-02 14:09:40", "created_by": "0", "Id": "85", "fk_location_id": "3893", "address": "Noida", "email": "[email protected]", "website_url": "http://www.noida.in", "srk_main_id": "0" }, "0": { "tel1": "Ahemdabad", "status": "1", "fax": "", "tel2": "Gujrat", "name": "Bharat Petro", "country": "India", "creation_time": "2010-05-31 15:36:53", "created_by": "0", "Id": "82", "fk_location_id": "3874", "address": "THIS is test address", "email": "[email protected]", "website_url": "http://www.bp.com", "srk_main_id": "0" }, "count": 2 }

    Read the article

  • ArchBeat Link-o-Rama for November 15, 2012

    - by Bob Rhubart
    WLST Starting and Stopping a WebLogic Environment | Rene van Wijk Oracle ACE Rene van Wijk explores how to start a server with as little input as possible. Developing and Enforcing a BYOD Policy | Darin Pendergraft Darin Pendergraft's post includes links to a recent Mobile Access Policy Survey by SANS as well as registration information for a Nov 15 webcast featuring security expert Tony DeLaGrange from Secure Ideas, SANS instructor, attorney and technology law expert Ben Wright, and Oracle IDM product manager Lee Howarth. Cloud Integration White Paper Now Available |Bruce Tierney Bruce Tierney shares an overview of Cloud Integration - A Comprehensive Solution, a new white paper he co-authored with David Baum, Rajesh Raheja, Bruce Tierney, and Vijay Pawar. My iPad & This Cloud Thing | Floyd Teter Oracle ACE Director Floyd Teter explains why the Cloud is making it possible for him to use his iPad for tasks previously relegated to his laptop, and why this same scenario is likely to play out for a great many people. 3 steps to a cloud database strategy that works | InfoWorld "Every day, cloud-based databases add more features, decrease in cost, and become better at handling prime-time business," says InfoWorld blogger David Linthicum. "However, enterprise IT is reluctant to move data to public clouds, citing the tried-and-true excuses of security, privacy, and compliance. Although some have valid points, their reasons often boil down to 'I don't wanna.'" Oracle VM Templates for EBS 12.1.3 for Exalogic Now Available | Elke Phelps "The templates contain all the required elements to create an Oracle E-Business Suite R12 demonstration system on an Exalogic server," says Elke Phelps. "You can use these templates to quickly build an EBS 12.1.3 demonstration environment, bypassing the operating system and the software install (via the EBS Rapid Install)." Thought for the Day "A good plan executed today always beats a perfect plan executed tomorrow." — George S. Patton (November 11, 1885 - December 21, 1945) Source: SoftwareQuotes.com

    Read the article

  • ArchBeat Top 10 for November 11-17, 2012

    - by Bob Rhubart
    The Top 10 most popular items shared on the OTN ArchBeat Facebook page for the week of November 11-17, 2012. Developing and Enforcing a BYOD Policy Darin Pendergraft's post includes links to a recent Mobile Access Policy Survey by SANS as well as registration information for a Nov 15 webcast featuring security expert Tony DeLaGrange from Secure Ideas, SANS instructor, attorney and technology law expert Ben Wright, and Oracle IDM product manager Lee Howarth. This Week on the OTN Architect Community Homepage Make time to check out this week's features on the OTN Solution Architect Homepage, including: SOA Practitioner Guide: Identifying and Discovering Services Technical article by Yuli Vasiliev on Setting Up, Configuring, and Using an Oracle WebLogic Server Cluster The conclusion of the 3-part OTN ArchBeat Podcast on Future-Proofing your career. WLST Starting and Stopping a WebLogic Environment | Rene van Wijk Oracle ACE Rene van Wijk explores how to start a server with as little input as possible. Cloud Integration White Paper | Bruce Tierney Bruce Tierney shares an overview of Cloud Integration - A Comprehensive Solution, a new white paper he co-authored with David Baum, Rajesh Raheja, Bruce Tierney, and Vijay Pawar. X.509 Certificate Revocation Checking Using OCSP protocol with Oracle WebLogic Server 12c | Abhijit Patil Abhijit Patil's article focuses on how to use X.509 Certificate Revocation Checking Functionality with the OCSP protocol to validate in-bound certificates. Although this article focuses on inbound OCSP validation using OCSP, Oracle WebLogic Server 12c also supports outbound OCSP validation. Update on My OBIEE / Exalytics Books | Mark Rittman Oracle ACE Director Mark Rittman shares several resources related to his books Oracle Business Intelligence 11g Developers Guide and Oracle Exalytics Revealed, including a podcast interview with Oracle's Paul Rodwick. E-Business Suite 12.1.3 Data Masking Certified with Enterprise Manager 12c | Elke Phelps "You can use the Oracle Data Masking Pack with Oracle Enterprise Manager Grid Control 12c to scramble sensitive data in cloned E-Business Suite environments," reports Elke Phelps. There's a lot more information about this announcement in Elke's post. WebLogic Application Server: free for developers! | Bruno Borges Java blogger Bruno Borges shares news about important changes in the license agreement for Oracle WebLogic Server. Agile Architecture | David Sprott "There is ample evidence that Agile Architecture is a primary contributor to business agility, yet we do not have a well understood architecture management system that integrates with Agile methods," observes David Sprott in this extensive post. My iPad & This Cloud Thing | Floyd Teter Oracle ACE Director Floyd Teter explains why the Cloud is making it possible for him to use his iPad for tasks previously relegated to his laptop, and why this same scenario is likely to play out for a great many people. Thought for the Day "In programming, the hard part isn't solving problems, but deciding what problems to solve." — Paul Graham Source: SoftwareQuotes.com

    Read the article

  • Test your internet connection - Emtel Mobile Internet

    After yesterday's report on Emtel Fixed Broadband (I'm still wondering where the 'fixed' part is), I did the same tests on Emtel Mobile Internet. For this I'm using the Huawei E169G HSDPA USB stick, connected to the same machine. Actually, this is my fail-safe internet connection and the system automatically switches between them if a problem, let's say timeout, etc. has been detected on the main line. For better comparison I used exactly the same servers on Speedtest.net. The results Following are the results of Rose Hill (hosted by Emtel) and respectively Frankfurt, Germany (hosted by Vodafone DE): Speedtest.net result of 31.05.2013 between Flic en Flac and Rose Hill, Mauritius (Emtel - Mobile Internet) Speedtest.net result of 31.05.2013 between Flic en Flac and Frankfurt, Germany (Emtel - Mobile Internet) As you might easily see, there is a big difference in speed between national and international connections. More interestingly are the results related to the download and upload ratio. I'm not sure whether connections over Emtel Mobile Internet are asymmetric or symmetric like the Fixed Broadband. Might be interesting to find out. The first test result actually might give us a clue that the connection could be asymmetric with a ratio of 3:1 but again I'm not sure. I'll find out and post an update on this. It depends on network coverage Later today I was on tour with my tablet, a Samsung Galaxy Tab 10.1 (model GT-P7500) running on Android 4.0.4 (Ice Cream Sandwich), and did some more tests using the Speedtest.net app. The results are actually as expected and in areas with better network coverage you will get better results after all. At least, as long as you stay inside the national networks. For anything abroad, it doesn't really matter. But see for yourselves: Speedtest.net result of 31.05.2013 between Cascavelle and servers in Rose Hill, Mauritius (Emtel - Mobile Internet), Port Louis, Mauritius and Kuala Lumpur, Malaysia It's rather shocking and frustrating to see how the speed on international destinations goes down. And the full capability of the tablet's integrated modem (HSDPA: 21 Mbps; HSUPA: 5.76 Mbps) isn't used, too. I guess, this demands more tests in other areas of the island, like Ebene, Pailles or Port Louis. I'll keep you updated... The question remains: Alternatives? After the publication of the test results on Fixed Broadband I had some exchange with others on Facebook. Sadly, it seems that there are really no alternatives to what Emtel is offering at the moment. There are the various internet packages by Mauritius Telecom feat. Orange, like ADSL, MyT and Mobile Internet, and there is Bharat Telecom with their Bees offer which is currently limited to Ebene and parts of Quatre Bornes.

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

facebook twitter digg google delicious technorati stumbleupon myspace wordpress linkedin gmail igoogle windows live tumblr viadeo yahoo buzz yahoo mail yahoo bookmarks favorites email print

< Previous Page | 1 2