Search Results

Search found 75614 results on 3025 pages for 'file location'.

Page 20/3025 | < Previous Page | 16 17 18 19 20 21 22 23 24 25 26 27  | Next Page >

  • Unable to access Java-created file -- sometimes

    - by BlairHippo
    In Java, I'm working with code running under WinXP that creates a file like this: public synchronized void store(Properties props, byte[] data) { try { File file = filenameBasedOnProperties(props); if ( file.exists() ) { return; } File temp = File.createTempFile("tempfile", null); FileOutputStream out = new FileOutputStream(temp); out.write(data); out.flush(); out.close(); file.getParentFile().mkdirs(); temp.renameTo(file); } catch (IOException ex) { // Complain and whine and stuff } } Sometimes, when a file is created this way, it's just about totally inaccessible from outside the code (though the code responsible for opening and reading the file has no problem), even when the application isn't running. When accessed via Windows Explorer, I can't move, rename, delete, or even open the file. Under Cygwin, I get the following when I ls -l the directory: ls: cannot access [big-honkin-filename] total 0 ?????????? ? ? ? ? ? [big-honkin-filename] As implied, the filenames are big, but under the 260-character max for XP (though they are slightly over 200 characters). To further add to the sense the my computer just wants me to feel stupid, sometimes the files created by this code are perfectly normal. The only pattern I've spotted is that once one file in the directory "locks", the rest are screwed. Anybody ever run into something like this before, or have any insights into what's going on here?

    Read the article

  • How to compare two file structures in PHP?

    - by OM The Eternity
    I have a function which gives me the complete file structure upto n-level, function getDirectory($path = '.', $ignore = '') { $dirTree = array (); $dirTreeTemp = array (); $ignore[] = '.'; $ignore[] = '..'; $dh = @opendir($path); while (false !== ($file = readdir($dh))) { if (!in_array($file, $ignore)) { if (!is_dir("$path/$file")) { //display of file and directory name with their modification time $stat = stat("$path/$file"); $statdir = stat("$path"); $dirTree["$path"][] = $file. " === ". date('Y-m-d H:i:s', $stat['mtime']) . " Directory == ".$path."===". date('Y-m-d H:i:s', $statdir['mtime']) ; } else { $dirTreeTemp = getDirectory("$path/$file", $ignore); if (is_array($dirTreeTemp))$dirTree = array_merge($dirTree, $dirTreeTemp); } } } closedir($dh); return $dirTree; } $ignore = array('.htaccess', 'error_log', 'cgi-bin', 'php.ini', '.ftpquota'); //function call $dirTree = getDirectory('.', $ignore); //file structure array print print_r($dirTree); Now here my requirement is , I have two sites The Development/Test Site- where i do testing of all the changes The Production Site- where I finally post all the changes as per test in development site Now, for example, I have tested an image upload in the Development/test site, and i found it appropriate to publish on Production site then i will completely transfer the Development/Test DB detail to Production DB, but now I want to compare the files structure as well to transfer the corresponding image file to Production folder. There could be the situation when I update the image by editing the image and upload it with same name, now in this case the image file would be already present there, which will restrict the use of "file_exist" logic, so for these type of situations....HOW CAN I COMPARE THE TWO FILE STRUCTURE TO GET THE SYNCHRONIZATION DONE AS PER REQUIREMENT??

    Read the article

  • Modifying File while in use using Java

    - by Marquinio
    Hi all, I have this recurrent Java JAR program tasks that tries to modify a file every 60seconds. Problem is that if user is viewing the file than Java program will not be able to modify the file. I get the typical IOException. Anyone knows if there is a way in Java to modify a file currently in use? Or anyone knows what would be the best way to solve this problem? I was thinking of using the File canRead(), canWrite() methods to check if file is in use. If file is in use then I'm thinking of making a backup copy of data that could not be written. Then after 60 seconds add some logic to check if backup file is empty or not. If backup file is not empty then add its contents to main file. If empty then just add new data to main file. Of course, the first thing I will always do is check if file is in use. Thanks for all your ideas.

    Read the article

  • File mkdirs() method not working in android/java

    - by Leif Andersen
    I've been pulling out my hair on this for a while now. The following method is supposed to download a file, and save it to the location specified on the hard drive. private static void saveImage(Context context, boolean backgroundUpdate, URL url, File file) { if (!Tools.checkNetworkState(context, backgroundUpdate)) return; // Get the image try { // Make the file file.getParentFile().mkdirs(); // Set up the connection URLConnection uCon = url.openConnection(); InputStream is = uCon.getInputStream(); BufferedInputStream bis = new BufferedInputStream(is); // Download the data ByteArrayBuffer baf = new ByteArrayBuffer(50); int current = 0; while ((current = bis.read()) != -1) { baf.append((byte) current); } // Write the bits to the file OutputStream os = new FileOutputStream(file); os.write(baf.toByteArray()); os.close(); } catch (Exception e) { // Any exception is probably a newtork faiilure, bail return; } } Also, if the file doesn't exist, it is supposed to make the directory for the file. (And if there is another file already in that spot, it should just not do anything). However, for some reason, the mkdirs() method never makes the directory. I've tried everything from explicit parentheses, to explicitly making the parent file class, and nothing seems to work. I'm fairly certain that the drive is writable, as it's only called after that has already been determined, also that is true after running through it while debugging. So the method fails because the parent directories aren't made. Can anyone tell me if there is anything wrong with the way I'm calling it? Also, if it helps, here is the source for the file I'm calling it in: https://github.com/LeifAndersen/NetCatch/blob/master/src/net/leifandersen/mobile/android/netcatch/services/RSSService.java Thank you

    Read the article

  • Unset the system immutable bit in Mac OS X

    - by skylarking
    In theory I believe you can unlock and remove the system immutable bit with: chflags noschg /Path/To/File But how can you do this when you've set the bit as root? I have a file that is locked, and even running this command as root will not work as the operation is not permitted. I tried logging in as Single-User mode to no avail. I seem to remember that even though you are in as root you are in at level '1'. And to be able to remove the system-immutable flag you need to be logged in at level '0'. Does this have something to do with this issue?

    Read the article

  • Location Services are always disabled in Mac OS X Lion

    - by rplusg
    A simple location services program was working fine on my machine and suddenly stopped working. Upon further exploring the problem, I realized that some process has disabled location services in System Preferences » Security & Privacy » Privacy. I checked Enable Location Services, but again it got disabled automatically. After some research I found that it's not just my program, even built-in system functions are also failing because of this problem for example System Preferences » Date & Time » Time Zone failed to get the current location. Every time I check Enable Location Services, I see the following error in the console logs: 16/10/12 11:23:15.636 AM [0x0-0x42042].com.apple.systempreferences: ERROR,Time,372059595.636,Function,"CLInternalSetLocationServicesEnabled",CLInternalSetLocationServicesEnabled failed 16/10/12 11:23:15.638 AM [0x0-0x42042].com.apple.systempreferences: STACK,Time,372059595.636,1 CoreLocation 0x00007fff8f9957be CLInternalSetLocationServicesEnabled + 110 Notes: WiFi is on I didn't install iOS Simulator I use Xcode Version 4.5 (4G182) I use Boot Camp and made my MacBook Pro dual boot (Mac OS X Lion and Windows 7) I do only Mac development but not iOS

    Read the article

  • Reliable file copy (move) process - mostly Unix/Linux

    - by mfinni
    Short story : We have a need for a rock-solid reliable file mover process. We have source directories that are often being written to that we need to move files from. The files come in pairs - a big binary, and a small XML index. We get a CTL file that defines these file bundles. There is a process that operates on the files once they are in the destination directory; that gets rid of them when it's done. Would rsync do the best job, or do we need to get more complex? Long story as follows : We have multiple sources to pull from : one set of directories are on a Windows machine (that does have Cygwin and an SSH daemon), and a whole pile of directories are on a set of SFTP servers (Most of these are also Windows.) Our destinations are a list of directories on AIX servers. We used to use a very reliable Perl script on the Windows/Cygwin machine when it was our only source. However, we're working on getting rid of that machine, and there are other sources now, the SFTP servers, that we cannot presently run our own scripts on. For security reasons, we can't run the copy jobs on our AIX servers - they have no access to the source servers. We currently have a homegrown Java program on a Linux machine that uses SFTP to pull from the various new SFTP source directories, copies to a local tmp directory, verifies that everything is present, then copies that to the AIX machines, and then deletes the files from the source. However, we're finding any number of bugs or poorly-handled error checking. None of us are Java experts, so fixing/improving this may be difficult. Concerns for us are: With a remote source (SFTP), will rsync leave alone any file still being written? Some of these files are large. From reading the docs, it seems like rysnc will be very good about not removing the source until the destination is reliably written. Does anyone have experience confirming or disproving this? Additional info We will be concerned about the ingestion process that operates on the files once they are in the destination directory. We don't want it operating on files while we are in the process of copying them; it waits until the small XML index file is present. Our current copy job are supposed to copy the XML file last. Sometimes the network has problems, sometimes the SFTP source servers crap out on us. Sometimes we typo the config files and a destination directory doesn't exist. We never want to lose a file due to this sort of error. We need good logs If you were presented with this, would you just script up some rsync? Or would you build or buy a tool, and if so, what would it be (or what technologies would it use?) I (and others on my team) are decent with Perl.

    Read the article

  • Oracle pl\sql question for my homework in oracle 11G class [migrated]

    - by Bjolds
    I am new to oracle 11G programming and i have run into a tough situation with pl\sql funtions and automation. I ame unsure how to create the function for the automation of Registration system for a College registration system. Here is what i want to do. I want to automate the registrations system so that it automaticly registers students. Then I want a procedure to automate the grading system. I have included the code that i am written to make most of this assignment work which it does but unsure how to incorporate Pl\SQL automated fuctions for the registrations system, and the grading system. So Any help or Ideas I would greatly appreciate please. set Linesize 250 set pagesize 150 drop table student; drop table faculty; drop table Course; drop table Section; drop table location; DROP TABLE courseInstructor; DROP TABLE Registration; DROP TABLE grade; create table student( studentid number(10), Lastname varchar2(20), Firstname Varchar2(20), MI Char(1), address Varchar2(20), city Varchar2(20), state Char(2), zip Varchar2(10), HomePhone Varchar2(10), Workphone Varchar2(10), DOB Date, Pin VARCHAR2(10), Status Char(1)); ALTER TABLE Student Add Constraint Student_StudentID_pk Primary Key (studentID); Insert into student values (1,'xxxxxxxx','xxxxxxxxxx','x','xxxxxxxxxxxxxxx','Columbus','oh','44159','xxx-xxx-xxxx','xxx-xxx-xxxx','06-Mar-1957','1211','c'); create table faculty( FacultyID Number(10), FirstName Varchar2(20), Lastname Varchar2(20), MI Char(1), workphone Varchar2(10), CellPhone Varchar2(10), Rank Varchar2(20), Experience Varchar2(10), Status Char(1)); ALTER TABLE Faculty ADD Constraint Faculty_facultyId_PK PRIMARY KEY (FacultyID); insert into faculty values (1,'xxx','xxxxxxxxxxxx',xxx-xxx-xxxx','xxx-xxx-xxxx','professor','20','f'); create table Course( CourseId number(10), CourseNumber Varchar2(20), CourseName Varchar(20), Description Varchar(20), CreditHours Number(4), Status Char(1)); ALTER TABLE Course ADD Constraint Course_CourseID_pk PRIMARY KEY(CourseID); insert into course values (1,'cit 100','computer concepts','introduction to PCs','3.0','o'); insert into course values (2,'cit 101','Database Program','Database Programming','4.0','o'); insert into course values (3,'Math 101','Algebra I','Algebra I Concepts','5.0','o'); insert into course values (4,'cit 102a','Pc applications','Aplications 1','3.0','o'); insert into course values (5,'cit 102b','pc applications','applications 2','3.0','o'); insert into course values (6,'cit 102c','pc applications','applications 3','3.0','o'); insert into course values (7,'cit 103','computer concepts','introduction systems','3.0','c'); insert into course values (8,'cit 110','Unified language','UML design','3.0','o'); insert into course values (9,'cit 165','cobol','cobol programming','3.0','o'); insert into course values (10,'cit 167','C++ Programming 1','c++ programming','4.0','o'); insert into course values (11,'cit 231','Expert Excel','spreadsheet apps','3.0','o'); insert into course values (12,'cit 233','expert Access','database devel.','3.0','o'); insert into course values (13,'cit 169','Java Programming I','Java Programming I','3.0','o'); insert into course values (14,'cit 263','Visual Basic','Visual Basic Prog','3.0','o'); insert into course values (15,'cit 275','system analysis 2','System Analysis 2','3.0','o'); create table Section( SectionID Number(10), CourseId Number(10), SectionNumber VarChar2(10), Days Varchar2(10), StartTime Date, EndTime Date, LocationID Number(10), SeatAvailable Number(3), Status Char(1)); ALTER TABLE Section ADD Constraint Section_SectionID_PK PRIMARY KEY(SectionID); insert into section values (1,1,'18977','r','21-Sep-2011','10-Dec-2011','1','89','o'); create table Location( LocationId Number(10), Building Varchar2(20), Room Varchar2(5), Capacity Number(5), Satus Char(1)); ALTER TABLE Location ADD Constraint Location_LocationID_pk PRIMARY KEY (LocationID); insert into Location values (1,'Clevleand Hall','cl209','35','o'); insert into Location values (2,'Toledo Circle','tc211','45','o'); insert into Location values (3,'Akron Square','as154','65','o'); insert into Location values (4,'Cincy Hall','ch100','45','o'); insert into Location values (5,'Springfield Dome','SD','35','o'); insert into Location values (6,'Dayton Dorm','dd225','25','o'); insert into Location values (7,'Columbus Hall','CB354','15','o'); insert into Location values (8,'Cleveland Hall','cl204','85','o'); insert into Location values (9,'Toledo Circle','tc103','75','o'); insert into Location values (10,'Akron Square','as201','46','o'); insert into Location values (11,'Cincy Hall','ch301','73','o'); insert into Location values (12,'Dayton Dorm','dd245','57','o'); insert into Location values (13,'Springfield Dome','SD','65','o'); insert into Location values (14,'Cleveland Hall','cl241','10','o'); insert into Location values (15,'Toledo Circle','tc211','27','o'); insert into Location values (16,'Akron Square','as311','28','o'); insert into Location values (17,'Cincy Hall','ch415','73','o'); insert into Location values (18,'Toledo Circle','tc111','67','o'); insert into Location values (19,'Springfield Dome','SD','69','o'); insert into Location values (20,'Dayton Dorm','dd211','45','o'); Alter Table Student Add Constraint student_Zip_CK Check(Rtrim (Zip,'1234567890-') is null); Alter Table Student ADD Constraint Student_Status_CK Check(Status In('c','t')); Alter Table Student ADD Constraint Student_MI_CK2 Check(RTRIM(MI,'abcdefghijklmnopqrstuvwxyz')is Null); Alter Table Student Modify pin not Null; Alter table Faculty Add Constraint Faculty_Status_CK Check(Status In('f','a','i')); Alter table Faculty ADD Constraint Faculty_Rank_CK Check(Rank In ('professor','doctor','instructor','assistant','tenure')); Alter table Faculty ADD Constraint Faculty_MI_CK2 Check(RTRIM(MI,'abcdefghijklmnopqrstuvwxyz')is Null); Update Section Set Starttime = To_date('09-21-2011 6:00 PM', 'mm-dd-yyyy hh:mi pm'); Update Section Set Endtime = To_date('12-10-2011 9:50 PM', 'mm-dd-yyyy hh:mi pm'); alter table Section Add Constraint StartTime_Status_CK Check (starttime < Endtime); Alter Table Section Add Constraint Section_StartTime_ck check (StartTime < EndTime); Alter Table Section ADD Constraint Section_CourseId_FK FOREIGN KEY (CourseID) References Course(CourseId); Alter Table Section ADD Constraint Section_LocationID_FK FOREIGN KEY (LocationID) References Location (LocationId); Alter Table Section ADD Constraint Section_Days_CK Check(RTRIM(Days,'mtwrfsu')IS Null); update section set seatavailable = '99'; Alter Table Section ADD Constraint Section_SeatsAvailable_CK Check (SeatAvailable < 100); Alter Table Course Add Constraint Course_CreditHours_ck check(CreditHours < = 6.0); update location set capacity = '99'; Alter Table Location Add Constraint Location_Capacity_CK Check(Capacity < 100); Create Table Registration ( StudentID Number(10), SectionID Number(10), Constraint Registration_pk Primary key (studentId, Sectionid)); Insert into registration values (1, 2); Insert into Registration values (2, 3); Insert into registration values (3, 4); Insert into registration values (4, 5); Insert into registration values (5, 6); Insert into registration values (6, 7); Insert into registration values (7, 8); Insert into registration values (8, 9); insert into registration values (9, 10); insert into registration values (10, 11); insert into registration values (9, 12); insert into registration values (8, 13); insert into registration values (7, 14); insert into registration values (6, 15); insert into registration values (5, 17); insert into registration values (4, 18); insert into registration values (3, 19); insert into registration values (2, 20); insert into registration values (1, 21); insert into registration values (2, 22); insert into registration values (3, 23); insert into registration values (4, 24); insert into registration values (5, 25); Insert into registration values (6, 24); insert into registration values (7, 23); insert into registration values (8, 22); insert into registration values (9, 21); insert into registration values (10, 20); insert into registration values (9, 19); insert into registration values (8, 17); Create Table courseInstructor( FacultyID Number(10), SectionID Number(10), Constraint CourseInstructor_pk Primary key (FacultyId, SectionID)); insert into courseInstructor values (1, 1); insert into courseInstructor values (2, 2); insert into courseInstructor values (3, 3); insert into courseInstructor values (4, 4); insert into courseInstructor values (5, 5); insert into courseInstructor values (5, 6); insert into courseInstructor values (4, 7); insert into courseInstructor values (3, 8); insert into courseInstructor values (2, 9); insert into courseInstructor values (1, 10); insert into courseInstructor values (5, 11); insert into courseInstructor values (4, 12); insert into courseInstructor values (3, 13); insert into courseInstructor values (2, 14); insert into courseInstructor values (1, 15); Create table grade( StudentID Number(10), SectionID Number(10), Grade Varchar2(1), Constraint grade_pk Primary key (StudentID, SectionID)); CREATE OR REPLACE TRIGGER TR_CreateGrade AFTER INSERT ON Registration FOR EACH ROW BEGIN INSERT INTO grade (SectionID,StudentID,Grade) VALUES(:New.SectionID,:New.StudentID,NULL); END TR_createGrade; / CREATE OR REPLACE FORCE VIEW V_reg_student_course AS SELECT Registration.StudentID, student.LastName, student.FirstName, course.CourseName, Registration.SectionID, course.CreditHours, section.Days, TO_CHAR(StartTime, 'MM/DD/YYYY') AS StartDate, TO_CHAR(StartTime, 'HH:MI PM') AS StartTime, TO_CHAR(EndTime, 'MM/DD/YYYY') AS EndDate, TO_CHAR(EndTime, 'HH:MI PM') AS EndTime, location.Building, location.Room FROM registration, student, section, course, location WHERE registration.StudentID = student.StudentID AND registration.SectionID = section.SectionID AND section.LocationID = location.LocationID AND section.CourseID = course.CourseID; CREATE OR REPLACE FORCE VIEW V_teacher_to_course AS SELECT courseInstructor.FacultyID, faculty.FirstName, faculty.LastName, courseInstructor.SectionID, section.Days, TO_CHAR(StartTime, 'MM/DD/YYYY') AS StartDate, TO_CHAR(StartTime, 'HH:MI PM') AS StartTime, TO_CHAR(EndTime, 'MM/DD/YYYY') AS EndDate, TO_CHAR(EndTime, 'HH:MI PM') AS EndTime, location.Building, location.Room FROM courseInstructor, faculty, section, course, location WHERE courseInstructor.FacultyID = faculty.FacultyID AND courseInstructor.SectionID = section.SectionID AND section.LocationID = location.LocationID AND section.CourseID = course.CourseID; SELECT * FROM V_reg_student_course; SELECT * FROM V_teacher_to_course;

    Read the article

  • E-Business Tax Release 12 Setup - US Location Based Taxes Part 1, Prerequisities & Regimes

    - by Robert Story
    Upcoming WebcastTitle: E-Business Tax Release 12 Setup - US Location Based Taxes Part 1, Prerequisities & RegimesDate: April 28, 2010 Time: 12:00 pm EDT Product Family: Receivables Community Summary This one-hour session is part one of two on setting up a fresh implementation of US Location Based Taxes in Oracle E-Business Tax.  It is recommended for functional users who wish to understand the steps involved in setting up E-Business Tax in Release 12. Topics will include: Overview of E-Business TaxLocation setupRegime to Rate FlowTax RegimesTaxesTax StatusesTax JurisdictionsTax Recovery RatesTax RatesSubscribing the Operation Unit to a Regime to Rate FlowBrief Demonstration A short, live demonstration (only if applicable) and question and answer period will be included. Click here to register for this session....... ....... ....... ....... ....... ....... .......The above webcast is a service of the E-Business Suite Communities in My Oracle Support.For more information on other webcasts, please reference the Oracle Advisor Webcast Schedule.Click here to visit the E-Business Communities in My Oracle Support Note that all links require access to My Oracle Support.

    Read the article

  • Oracle Enterprise Data Quality Adds Global Address Verification Capabilities for Greater Accuracy and Broader Location Coverage

    - by Mala Narasimharajan
    Data quality – has many flavors to it.  Product, Customer – you name the data domain and there’s data quality associated with it.  Address verification and data quality are a little different.  in that there is a tremendous amount of variation as well as nuance attached to it.  Specifically, what makes address verification challenging is that more often than not, addresses are incomplete, riddled with misspellings, incorrect postal codes are assigned to locations or non-address items are present.  Almost all data has locations, and accurate locations power a wealth of business processes: Customer Relationship Management, data quality, delivery of materials, goods or services, fraud detection, insurance risk assessment, data analytics, store and territory planning, and much more. Oracle Address Verification Server provides location-based services as well as deeper parsing and analysis capabilities for Oracle Enterprise Data Quality.  Specifically, Pre-integrated with the EDQ platform, Oracle Address Verification Server provides robust parsing, validation, as well as specialized location information for over 240 countries – all populated countries on Earth.  Oracle Enterprise Data Quality (EDQ) is a data quality platform, dedicated to address the distinct challenges of customer and product data quality, and performs advanced data profiling to identify and measure poor quality data and identify rule requirements, as well as semantic and pattern-based recognition to accurately parse and standardize data that is poorly structured.   EDQ is integrated with Oracle Master Data Management, including Oracle Customer Hub and Oracle Product Hub, as well as Oracle Data Integrator Enterprise Edition and Oracle CRM.  Address Verification Server provides key address verification services for Oracle CRM and Oracle Customer Hub.  In addition, Address Verification Server provides greater accuracy when handling address data due to its expanded sources and extensible knowledge repository, solid parsing across locales and countries as well as  adept handling of extraneous data in address fields.  For more information on Oracle Address Verification Server visit:  http://bit.ly/GMUE4H and http://bit.ly/GWf7U6

    Read the article

  • Updating an ADF Web Service Data Control When Service Structure or Location Change

    - by Shay Shmeltzer
    The web service data control in Oracle ADF gives you a simplified approach to consuming services in ADF applications, and now with ADF Mobile the usage of this service seems to be growing. A frequent question we get is what happens if the service that I'm consuming changes - how do I update my data control? Well, first we should mention that if you do a good design of your application before you actually code - then things like Web service method signature shouldn't change. The signature is the contract between the publisher and the consumer, and contracts shouldn't be broken. But in reality things do change during development stages, so here is how you can update both method signatures and service location with the Web service data control: After watching this video you might be tempted to not copy the WSDLs to your project - which lets you use the right click update on a data control. However there is a reason why the copy is on by default, it reduces network traffic when you are actually running your application since ADF doesn't need to go to the server to find out the service structure. So for runtime performance, you probably should keep the WSDL local.  I encourage you to further look into both the connections.xml file where your service location is saved, and the datacontrols.dcx file where its definition is kept to get an even deeper understanding of how ADF works underneath the declarative layers.

    Read the article

  • Optimising website IP for location

    - by Liam Sorsby
    From my understanding of SEO, websites are optimised for the current location of their IP address. For example if xxx.xxx.xxx.xx resolves to the UK then you are more likely to get higher rankings in the UK then you are in the USA. However, my query is when you use a CDN you are storing a cached version of your website across multiple servers at strategic locations across the globe to reduce load time in locations that your trying to target. Now if you use a CDN and geo-locate the website URL then it only resolves back to the USA (where our IP address resolves too) but it doesn't say it resolves to any other countries. As far as I know you can have multiple IP address resolving to one domain (from different countries). Do CDN's really help to optimise the location of your website or are they soley meant to optimise load time? Is there a better way to optimise for multiple countries with regards to the resolution of the IP address? Are VPN's as per this post here relevant to this? Any advice would be helpful.

    Read the article

  • Changing the Default Install Location of an MSI

    - by PSteele
    A few months ago, I had to tweak an MSI installer.  It was installing into a specific directory (named the same as the application) underneath Program Files.  Since the location of Program Files can change from machine to machine, the MSI has a special token you can use for Program Files (as well as for the application name).  So the current value for “DefaultLocation” of the Application Folder was: [ProgramFilesFolder]\[ProductName] During installation, these tokens would be replaced by the actual location based on the current machine. I needed to change this to a specific folder underneath the users My Documents directory.  I poked around the help file and I could not find where these special tokens (like “[ProgramFilesFolder]”) were defined.  Obviously, there must be some specific set of values that are available and I’m sure My Documents is one of them. I finally found them documented so I’m posting the link here.  Hopefully, it will help someone else out.  Not sure where I found this link… System Folder Properties For me, it was as easy as changing the DefaultLocation to: [PersonalFolder]\MyToolName\Application Technorati Tags: .NET,MSI

    Read the article

  • Location-Based redirection and duplication in sub-directories affecting SEO

    - by Joshua
    I currently own the website www.xyz.com. The website has a sub-directory for each of the 3 target countries: .../en-US/ (United States), .../es-MX/ (Mexico), and .../es-DO/ (Dominican Republic). I have two main questions about this setup: Currently, the main domain/root (xyz.com) contains a blank index.php file, but I would like for a user to be redirected to one of the sub-directories based on their regional location. What is the best way to accomplish this? I have looked at using browser language-based redirection, but how would I know whether to direct a user to the MX or DO site if the browser language is set to spanish? Is there a way to detect a user's geographic location? Also, the 3 websites are practically identical except they all have 3 unique color schemes and the US site is in english while the MX and DO sites are in spanish. My problem is that I believe GoogleBot is penalizing/banning my site because the spanish text on the MX and DO pages are nearly identical and are thus marked as duplicates/spam. Is there a way to avoid this?

    Read the article

  • Copy mdf file and use it in run time

    - by Anibas
    After I copy mdf file (and his log file) I tries to Insert data. I receive the following message: "An attempt to attach an auto-named database for file [fileName].mdf failed. A database with the same name exists, or specified file cannot be opened, or it is located on UNC share. When I copied the file manual everything worked normally. Is it correct the order File.Copy leaves the file engaged?

    Read the article

  • Designing a database file format

    - by RoliSoft
    I would like to design my own database engine for educational purposes, for the time being. Designing a binary file format is not hard nor the question, I've done it in the past, but while designing a database file format, I have come across a very important question: How to handle the deletion of an item? So far, I've thought of the following two options: Each item will have a "deleted" bit which is set to 1 upon deletion. Pro: relatively fast. Con: potentially sensitive data will remain in the file. 0x00 out the whole item upon deletion. Pro: potentially sensitive data will be removed from the file. Con: relatively slow. Recreating the whole database. Pro: no empty blocks which makes the follow-up question void. Con: it's a really good idea to overwrite the whole 4 GB database file because a user corrected a typo. I will sell this method to Twitter ASAP! Now let's say you already have a few empty blocks in your database (deleted items). The follow-up question is how to handle the insertion of a new item? Append the item to the end of the file. Pro: fastest possible. Con: file will get huge because of all the empty blocks that remain because deleted items aren't actually deleted. Search for an empty block exactly the size of the one you're inserting. Pro: may get rid of some blocks. Con: you may end up scanning the whole file at each insert only to find out it's very unlikely to come across a perfectly fitting empty block. Find the first empty block which is equal or larger than the item you're inserting. Pro: you probably won't end up scanning the whole file, as you will find an empty block somewhere mid-way; this will keep the file size relatively low. Con: there will still be lots of leftover 0x00 bytes at the end of items which were inserted into bigger empty blocks than they are. Rigth now, I think the first deletion method and the last insertion method are probably the "best" mix, but they would still have their own small issues. Alternatively, the first insertion method and scheduled full database recreation. (Probably not a good idea when working with really large databases. Also, each small update in that method will clone the whole item to the end of the file, thus accelerating file growth at a potentially insane rate.) Unless there is a way of deleting/inserting blocks from/to the middle of the file in a file-system approved way, what's the best way to do this? More importantly, how do databases currently used in production usually handle this?

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • Reading data from text file in C

    - by themake
    I have a text file which contains words separated by space. I want to take each word from the file and store it. So i have opened the file but am unsure how to assign the word to a char. FILE *fp; fp = fopen("file.txt", "r"); //then i want char one = the first word in the file char two = the second word in the file

    Read the article

  • opening and viewing a file in php

    - by Christian Burgos
    how do i open/view for editing an uploaded file in php? i have tried this but it doesn't open the file. $my_file = 'file.txt'; $handle = fopen($my_file, 'r'); $data = fread($handle,filesize($my_file)); i've also tried this but it wont work. $my_file = 'file.txt'; $handle = fopen($my_file, 'w') or die('Cannot open file: '.$my_file); $data = 'This is the data'; fwrite($handle, $data); what i have in mind is like when you want to view an uploaded resume,documents or any other ms office files like .docx,.xls,.pptx and be able to edit them, save and close the said file. edit: latest tried code... <?php // Connects to your Database include "configdb.php"; //Retrieves data from MySQL $data = mysql_query("SELECT * FROM employees") or die(mysql_error()); //Puts it into an array while($info = mysql_fetch_array( $data )) { //Outputs the image and other data //Echo "<img src=localhost/uploadfile/images".$info['photo'] ."> <br>"; Echo "<b>Name:</b> ".$info['name'] . "<br> "; Echo "<b>Email:</b> ".$info['email'] . " <br>"; Echo "<b>Phone:</b> ".$info['phone'] . " <hr>"; //$file=fopen("uploadfile/images/".$info['photo'],"r+"); $file=fopen("Applications/XAMPP/xamppfiles/htdocs/uploadfile/images/file.odt","r") or exit("unable to open file");; } ?> i am getting the error: Warning: fopen(Applications/XAMPP/xamppfiles/htdocs/uploadfile/images/file.odt): failed to open stream: No such file or directory in /Applications/XAMPP/xamppfiles/htdocs/uploadfile/view.php on line 17 unable to open file the file is in that folder, i don't know it wont find it.

    Read the article

  • Copied a file with winscp; only winscp can see it

    - by nilbus
    I recently copied a 25.5GB file from another machine using WinSCP. I copied it to C:\beth.tar.gz, and WinSCP can still see the file. However no other app (including Explorer) can see the file. What might cause this, and how can I fix it? The details that might or might not matter WinSCP shows the size of the file (C:\beth.tar.gz) correctly as 27,460,124,080 bytes, which matches the filesize on the remote host Neither explorer, cmd (command line prompt w/ dir C:\), the 7Zip archive program, nor any other File Open dialog can see the beth.tar.gz file under C:\ I have configured Explorer to show hidden files I can move the file to other directories using WinSCP If I try to move the file to Users/, UAC prompts me for administrative rights, which I grant, and I get this error: Could not find this item The item is no longer located in C:\ When I try to transfer the file back to the remote host in a new directory, the transfer starts successfully and transfers data The transfer had about 30 minutes remaining when I left it for the night The morning after the file transfer, I was greeted with a message saying that the connection to the server had been lost. I don't think this is relevant, since I did not tell it to disconnect after the file was done transferring, and it likely disconnected after the file transfer finished. I'm using an old version of WinSCP - v4.1.8 from 2008 I can view the file properties in WinSCP: Type of file: 7zip (.gz) Location: C:\ Attributes: none (Ready-only, Hidden, Archive, or Ready for indexing) Security: SYSTEM, my user, and Administrators group have full permissions - everything other than "special permissions" is checked under Allow for all 3 users/groups (my user, Administrators, SYSTEM) What's going on?!

    Read the article

  • C++, Ifstream opens local file but not file on HTTP Server

    - by fammi
    Hi, I am using ifstream to open a file and then read from it. My program works fine when i give location of the local file on my system. for eg /root/Desktop/abc.xxx works fine But once the location is on the http server the file fails to open. for eg http://192.168.0.10/abc.xxx fails to open. Is there any alternate for ifstream when using a URL address? thanks. part of the code where having problem: bool readTillEof = (endIndex == -1) ? true : false; // Open the file in binary mode and seek to the end to determine file size ifstream file ( fileName.c_str ( ), ios::in|ios::ate|ios::binary ); if ( file.is_open ( ) ) { long size = (long) file.tellg ( ); long numBytesRead; if ( readTillEof ) { numBytesRead = size - startIndex; } else { numBytesRead = endIndex - startIndex + 1; } // Allocate a new buffer ptr to read in the file data BufferSptr buf (new Buffer ( numBytesRead ) ); mpStreamingClientEngine->SetResponseBuffer ( nextRequest, buf ); // Seek to the start index of the byte range // and read the data file.seekg ( startIndex, ios::beg ); file.read ( (char *)buf->GetData(), numBytesRead ); // Pass on the data to the SCE // and signal completion of request mpStreamingClientEngine->HandleDataReceived( nextRequest, numBytesRead); mpStreamingClientEngine->MarkRequestCompleted( nextRequest ); // Close the file file.close ( ); } else { // Report error to the Streaming Client Engine // as unable to open file AHS_ERROR ( ConnectionManager, " Error while opening file \"%s\"\n", fileName.c_str ( ) ); mpStreamingClientEngine->HandleRequestFailed( nextRequest, CONNECTION_FAILED ); } }

    Read the article

  • How do I open a file in such a way that if the file doesn't exist it will be created and opened automatically?

    - by snakile
    Here's how I open a file for writing+ : if( fopen_s( &f, fileName, "w+" ) !=0 ) { printf("Open file failed\n"); return; } fprintf_s(f, "content"); If the file doesn't exist the open operation fails. What's the right way to fopen if I want to create the file automatically if the file doesn't already exist? EDIT: If the file does exist, I would like fprintf to overwrite the file, not to append to it.

    Read the article

  • Problem with File uplolad in javascript.

    - by Nikhil
    I have used javascript to upload more than one file. when user clicks on 'add more' javascript appends new object to older div using innerHTML. Now the problem is if I select a file and then click on "add more" then new file button exist but older selected file removes and two blank file buttons display. I want this old file must be selected when user add new file button. If anybody can, Help Plz!!! tnX.

    Read the article

< Previous Page | 16 17 18 19 20 21 22 23 24 25 26 27  | Next Page >