Search Results

Search found 5136 results on 206 pages for 'comment bot'.

Page 201/206 | < Previous Page | 197 198 199 200 201 202 203 204 205 206  | Next Page >

  • strange problem when placing UILabels on UITableView and calling reloadData

    - by user262325
    Hello everyone I hope to list all files in a directory to an UITableView atableview There are files in Document directory a.txt b.txt F (folder) c.txt in folder F, there are 2 files M.exe N.exe When I change to folder F, it should display on atableview M.exe N.exe but Result is in F, it displayed b.txt F the codes are shown as below -(void) removeACell:(NSInteger)row; { NSUInteger _lastSection = 0;//[self numberOfSectionsInTableView:atableview]; NSUInteger _lastRow =row;// [atableview numberOfRowsInSection:_lastSection] - 1; NSUInteger _path[2] = {_lastSection, _lastRow}; NSIndexPath *_indexPath = [[NSIndexPath alloc] initWithIndexes:_path length:2]; NSArray *_indexPaths = [[NSArray alloc] initWithObjects:_indexPath, nil]; [_indexPath release]; [atableview deleteRowsAtIndexPaths:_indexPaths withRowAnimation:UITableViewRowAnimationBottom]; [_indexPaths release]; } -(void) reloadDirectory { if([fileArray count]>0) { NSInteger n=fileArray.count; for(int i=n-1;i>=0;i--) { [fileArray removeObjectAtIndex: i]; [self removeACell:i]; } } NSFileManager *manager = [NSFileManager defaultManager]; NSLog(@"*******************" ); NSLog(@"ffff%@",[self appDelegate].gCurrentPath_AppDelegate); for(NSString *path in [manager contentsOfDirectoryAtPath:[self appDelegate].gCurrentPath_AppDelegate error:nil]) { NSDictionary *modData= [manager attributesOfItemAtPath: [appDelegate.gCurrentPath_AppDelegate //directory of files stringByAppendingPathComponent:path ] error:nil ]; NSDate * dateModified=(NSDate *) [modData objectForKey:NSFileModificationDate]; NSNumber *fileSize=[modData objectForKey:NSFileSize] ; if(dateModified) { FileObj *newobj=[[FileObj alloc] init ]; [ newobj seta:1]; NSString *ss=[[NSString alloc] initWithFormat:@"%@",path] ; [newobj setfileName:ss]; NSLog(@"---------------%@",ss); BOOL isDir; [manager fileExistsAtPath:[appDelegate.gCurrentPath_AppDelegate stringByAppendingPathComponent:path ] isDirectory:&isDir]; [newobj setisDirectory: isDir ]; [newobj setfilePath:@"1"]; NSDateFormatter *formatter = [[NSDateFormatter alloc] init]; [formatter setDateFormat:@"EEE MMM dd HH:mm:ss zzz yyyy"]; NSString *stringFromDate =[[NSString alloc] initWithString: [formatter stringFromDate:dateModified]]; [newobj setfileDate:stringFromDate]; [formatter release]; NSString * fileSize1= [[NSString alloc] initWithFormat:@"%d",[fileSize integerValue] ]; [newobj setfileSize: fileSize1]; [ fileArray addObject:newobj]; [newobj release]; }; [atableview reloadData]; } - (UITableViewCell *)tableView:(UITableView *)tableView cellForRowAtIndexPath:(NSIndexPath *)indexPath { NSInteger row=[indexPath row]; NSInteger section=[indexPath section]; static NSString *SimpleTableIdentifier1 = @"CellTableIdentifier"; UITableViewCell *cell=[tableView dequeueReusableCellWithIdentifier: SimpleTableIdentifier1 ]; int newRow = [indexPath row]; selectIndex=newRow; if(cell==nil) { //**breakpoint AAA here** CGRect cellframe=CGRectMake(0, 0, 300, 60); cell=[[[UITableViewCell alloc] initWithFrame:cellframe reuseIdentifier:SimpleTableIdentifier1] autorelease]; if ([[fileArray objectAtIndex:row] getisDirectory]) { UIImage *image = [UIImage imageNamed:@"folder.png"]; cell.imageView.image = image; } else { UIImage *image = [UIImage imageNamed:@"files.png"]; cell.imageView.image = image; } cell.accessoryType=UITableViewCellAccessoryDetailDisclosureButton; ///-------------------------------------------------------- UILabel *b1 =[ [UILabel alloc]init]; b1.frame = CGRectMake(40.9f,8.0f,250.0f,20.0f) ; [b1 setBackgroundColor:[UIColor clearColor]]; [b1 setTag:(row+15000)]; //------------------------------------------------------- UILabel *b2 =[ [UILabel alloc]init]; b2.frame = CGRectMake(40.9f,30.0f,250.0f,13.0f) ; [b2 setBackgroundColor:[UIColor clearColor]]; [b2 setTag:row+16000]; [b2 setFont:[UIFont systemFontOfSize:10.0]]; //------------------------------------------------ UILabel *b3 =[ [UILabel alloc]init]; b3.frame = CGRectMake(40.9f,45.0f,250.0f,13.0f) ; [b3 setBackgroundColor:[UIColor clearColor]]; [b3 setFont:[UIFont systemFontOfSize:10.0]]; [b3 setTag:row+17000]; [cell.contentView addSubview:b1]; [cell.contentView addSubview:b2]; [cell.contentView addSubview:b3]; [b1 release]; [b2 release]; [b3 release]; }; if([fileArray count]>0) //check if fileArray is correct { NSLog(@"___________________" ); for (int i=0;i<[fileArray count];i++) { NSLog(@"->%@",[[fileArray objectAtIndex:i] getfileName] ); } } UILabel *tem1UILabel=(UILabel*)[cell.contentView viewWithTag:row+15000]; NSString *s1=[[NSString alloc] initWithFormat: [[fileArray objectAtIndex:row] getfileName] ]; NSLog(@"--->%@",s1 ); tem1UILabel.text=s1; [s1 release]; UILabel *tem2UILabel=(UILabel*)[cell.contentView viewWithTag:row+16000]; NSString *s2=[[NSString alloc] initWithFormat: [[fileArray objectAtIndex:row] getfileDate] ]; tem2UILabel.text=s2; [s2 release]; UILabel *tem3UILabel=(UILabel*)[cell.contentView viewWithTag:row+17000]; NSString *s3=[[NSString alloc] initWithFormat: [[fileArray objectAtIndex:row] getfileSize]]; tem3UILabel.text=s3; [s3 release]; return cell; } I set the breakpoint at AAA and found that when I loaded folder F, my application did stop at the breakpoint. But I have removed all cells in atableview before call 'reloadData'. I checked the content of fileArray which is the data source of atableview and found that everything is correct except the display on atableview. Welcome any comment. Thanks interdev

    Read the article

  • Mixing inheritance mapping strategies in NHibernate

    - by MylesRip
    I have a rather large inheritance hierarchy in which some of the subclasses add very little and others add quite a bit. I don't want to map the entire hierarchy using either "table per class hierarchy" or "table per subclass" due to the size and complexity of the hierarchy. Ideally I'd like to mix mapping strategies such that portions of the hierarchy where the subclasses add very little are combined into a common table a la "table per class hierarchy" and subclasses that add a lot are broken out into a separate table. Using this approach, I would expect to have 2 or 3 tables with very little wasted space instead of either 1 table with lots of fields that don't apply to most of the objects, or 20+ tables, several of which would have only a couple of columns. In the NHibernate Reference Documentation version 2.1.0, I found section 8.1.4 "Mixing table per class hierarchy with table per subclass". This approach switches strategies partway down the hierarchy by using: ... <subclass ...> <join ...> <property ...> ... </join> </subclass> ... This is great in theory. In practice, though, I found that the schema was too restrictive in what was allowed inside the "join" element for me to be able to accomplish what I needed. Here is the related part of the schema definition: <xs:element name="join"> <xs:complexType> <xs:sequence> <xs:element ref="subselect" minOccurs="0" /> <xs:element ref="comment" minOccurs="0" /> <xs:element ref="key" /> <xs:choice minOccurs="0" maxOccurs="unbounded"> <xs:element ref="property" /> <xs:element ref="many-to-one" /> <xs:element ref="component" /> <xs:element ref="dynamic-component" /> <xs:element ref="any" /> <xs:element ref="map" /> <xs:element ref="set" /> <xs:element ref="list" /> <xs:element ref="bag" /> <xs:element ref="idbag" /> <xs:element ref="array" /> <xs:element ref="primitive-array" /> </xs:choice> <xs:element ref="sql-insert" minOccurs="0" /> <xs:element ref="sql-update" minOccurs="0" /> <xs:element ref="sql-delete" minOccurs="0" /> </xs:sequence> <xs:attribute name="table" use="required" type="xs:string" /> <xs:attribute name="schema" type="xs:string" /> <xs:attribute name="catalog" type="xs:string" /> <xs:attribute name="subselect" type="xs:string" /> <xs:attribute name="fetch" default="join"> <xs:simpleType> <xs:restriction base="xs:string"> <xs:enumeration value="join" /> <xs:enumeration value="select" /> </xs:restriction> </xs:simpleType> </xs:attribute> <xs:attribute name="inverse" default="false" type="xs:boolean"> </xs:attribute> <xs:attribute name="optional" default="false" type="xs:boolean"> </xs:attribute> </xs:complexType> </xs:element> As you can see, this allows the use of "property" child elements or "component" child elements, but not both. It also doesn't allow for "subclass" child elements to continue the hierarchy below the point at which the strategy was changed. Is there a way to accomplish this?

    Read the article

  • Why is android:FLAG_BLUR_BEHIND creating a gradient background in my new activity instead of bluring

    - by nderraugh
    Hi, I've got two activities. One is supposed to be a blur in front of the other. The background activity has several ImageViews which are set up as thin gradients extending across most of the screen and 10dip high. When I start the second activity it sets the background as a gradient occupying the entire window space, that is it appears to be fill_parent'd for both height and width. If I comment out the ImageViews then it blurs and looks as expected. Any thoughts? Here's the code doing the blur. import android.app.Activity; import android.os.Bundle; import android.view.View; import android.view.WindowManager; import android.view.View.OnClickListener; public class TransluscentBlurSummaryB extends Activity { @Override protected void onCreate(Bundle icicle) { super.onCreate(icicle); getWindow().setFlags(WindowManager.LayoutParams.FLAG_BLUR_BEHIND, WindowManager.LayoutParams.FLAG_BLUR_BEHIND); getWindow().getAttributes().dimAmount = 0.5f; getWindow().setFlags(WindowManager.LayoutParams.FLAG_DIM_BEHIND, WindowManager.LayoutParams.FLAG_DIM_BEHIND); setContentView(R.layout.sheetbdetails); OnClickListener clickListener = new OnClickListener() { public void onClick(View v) { TransluscentBlurSummaryB.this.finish(); } }; findViewById(R.id.sheetbdetailstable).setOnClickListener(clickListener); } } And here's the layout with the ImageView gradients. <?xml version="1.0" encoding="utf-8"?> <RelativeLayout xmlns:android="http://schemas.android.com/apk/res/android" android:layout_width="fill_parent" android:layout_height="fill_parent" android:id="@+id/summarysparent" > <!-- view1 goes on top --> <RelativeLayout xmlns:android="http://schemas.android.com/apk/res/android" android:id="@+id/view2" android:layout_width="fill_parent" android:layout_height="wrap_content" android:layout_alignParentBottom="true"> <Button android:layout_height="wrap_content" android:id="@+id/ButtonBack" android:layout_width="wrap_content" android:text="Back" android:width="100dp"></Button> <Button android:layout_height="wrap_content" android:id="@+id/ButtonNext" android:layout_width="wrap_content" android:layout_alignParentRight="true" android:text="Start Over" android:width="100dp"></Button> </RelativeLayout> <TextView android:id="@+id/view1" android:layout_height="wrap_content" android:layout_alignParentTop="true" android:layout_width="wrap_content" android:layout_centerHorizontal="true" android:textSize="10pt" android:text="Summary"/> <ScrollView xmlns:android="http://schemas.android.com/apk/res/android" android:layout_width="fill_parent" android:layout_height="wrap_content" android:id="@+id/summaryscrollview" android:layout_below="@+id/view1" android:layout_above="@+id/view2"> <RelativeLayout xmlns:android="http://schemas.android.com/apk/res/android" android:layout_width="fill_parent" android:layout_height="wrap_content" android:id="@+id/summarydetails" > <!-- view2 goes on the bottom --> <TextView android:id="@+id/textview2" android:layout_height="wrap_content" android:layout_width="wrap_content" android:layout_below="@+id/view1" android:layout_centerHorizontal="true" android:text="Recommended Child Support Order" android:layout_marginTop="10dip" /> <ImageView android:id="@+id/horizontalLine1" android:layout_width="fill_parent" android:layout_marginLeft="5dip" android:layout_marginRight="5dip" android:layout_height="10dip" android:src="@drawable/black_white_gradient" android:layout_below="@+id/textview2" android:layout_marginTop="10dip" /> <TextView android:id="@+id/textview3" android:layout_height="wrap_content" android:layout_width="wrap_content" android:layout_below="@+id/horizontalLine1" android:layout_centerHorizontal="true" android:text="You" android:layout_marginTop="10dip" /> <TextView android:id="@+id/textview10" android:layout_height="wrap_content" android:layout_width="150dp" android:layout_below="@+id/textview3" android:layout_centerHorizontal="true" android:layout_marginTop="10dip" android:gravity="center_horizontal" /> <ImageView android:id="@+id/horizontalLine2" android:layout_width="fill_parent" android:layout_marginLeft="5dip" android:layout_marginRight="5dip" android:layout_height="10dip" android:src="@drawable/black_white_gradient" android:layout_below="@+id/textview10" android:layout_marginTop="10dip" /> <TextView android:id="@+id/textview4" android:layout_height="wrap_content" android:layout_width="wrap_content" android:layout_below="@+id/horizontalLine2" android:layout_centerHorizontal="true" android:text="Other Parent" android:layout_marginTop="10dip" /> <TextView android:id="@+id/textview11" android:layout_height="wrap_content" android:layout_width="150dp" android:layout_below="@+id/textview4" android:layout_centerHorizontal="true" android:layout_marginTop="10dip" android:text="$536.18" android:gravity="center_horizontal" /> <ImageView android:id="@+id/horizontalLine3" android:layout_width="fill_parent" android:layout_marginLeft="5dip" android:layout_marginRight="5dip" android:layout_height="10dip" android:src="@drawable/black_white_gradient" android:layout_below="@+id/textview11" android:layout_marginTop="10dip" /> <TextView android:id="@+id/textview5" android:layout_height="wrap_content" android:layout_width="wrap_content" android:layout_below="@+id/horizontalLine3" android:layout_centerHorizontal="true" android:text="Calculation Details" android:layout_marginTop="15dip" /> <ImageView android:id="@+id/infoButton" android:src="@drawable/ic_menu_info_details" android:layout_height="wrap_content" android:layout_width="wrap_content" android:layout_below="@+id/horizontalLine3" android:layout_toRightOf="@+id/textview5" android:clickable="true" /> <ImageView android:id="@+id/horizontalLine4" android:layout_width="fill_parent" android:layout_marginLeft="5dip" android:layout_marginRight="5dip" android:layout_height="10dip" android:src="@drawable/black_white_gradient" android:layout_below="@+id/textview5" android:layout_marginTop="18dip" /> </RelativeLayout> </ScrollView> </RelativeLayout> The gradient drawable is this. <?xml version="1.0" encoding="utf-8"?> <shape xmlns:android="http://schemas.android.com/apk/res/android" android:shape="rectangle"> <gradient android:startColor="#FFFFFF" android:centerColor="#000000" android:endColor="#FFFFFF" android:angle="270"/> <padding android:left="7dp" android:top="7dp" android:right="7dp" android:bottom="7dp" /> <corners android:radius="8dp" /> </shape> And here's the layout from the activity doing the blurring on top. <?xml version="1.0" encoding="utf-8"?> <ScrollView xmlns:android="http://schemas.android.com/apk/res/android" android:id="@+id/sheetbdetails" android:layout_width="fill_parent" android:layout_height="fill_parent" android:clickable="true" > <TableLayout xmlns:android="http://schemas.android.com/apk/res/android" android:layout_width="fill_parent" android:layout_height="fill_parent" android:scrollbars="vertical" android:shrinkColumns="0" android:id="@+id/sheetbdetailstable" > <TableRow> <TextView android:padding="3dip" /> <TextView android:text="You" android:padding="3dip" /> <TextView android:text="@string/otherparent" android:padding="3dip" /> <TextView android:text="Combined" android:padding="3dip" /> </TableRow> </TableLayout> </ScrollView> The transparent windows are themed from styles.xml in the apidemos using @style/Theme.Transparent.

    Read the article

  • nhibernate fatal error

    - by Afif Lamloumi
    i have an error ( System.InvalidCastException: Unable to cast object of type 'AccountProxy' to type 'System.String'.) when i did this code i mapped the tables( Account,AccountString,EventData,...) of the the database opengts ( open source) i have this error when i called a function from EventData.cs IQuery query = session.CreateQuery("FROM Eventdata"); IList pets = query.List(); return pets; the Stack Trace: [InvalidCastException: Impossible d'effectuer un cast d'un objet de type 'AccountProxy' en type 'System.String'.] (Object , Object[] , SetterCallback ) +431 NHibernate.Bytecode.Lightweight.AccessOptimizer.SetPropertyValues(Object target, Object[] values) +20 NHibernate.Tuple.Component.PocoComponentTuplizer.SetPropertyValues(Object component, Object[] values) +49 NHibernate.Type.ComponentType.SetPropertyValues(Object component, Object[] values, EntityMode entityMode) +34 NHibernate.Type.ComponentType.ResolveIdentifier(Object value, ISessionImplementor session, Object owner) +150 NHibernate.Type.ComponentType.NullSafeGet(IDataReader rs, String[] names, ISessionImplementor session, Object owner) +42 NHibernate.Loader.Loader.GetKeyFromResultSet(Int32 i, IEntityPersister persister, Object id, IDataReader rs, ISessionImplementor session) +93 NHibernate.Loader.Loader.GetRowFromResultSet(IDataReader resultSet, ISessionImplementor session, QueryParameters queryParameters, LockMode[] lockModeArray, EntityKey optionalObjectKey, IList hydratedObjects, EntityKey[] keys, Boolean returnProxies) +92 NHibernate.Loader.Loader.DoQuery(ISessionImplementor session, QueryParameters queryParameters, Boolean returnProxies) +675 NHibernate.Loader.Loader.DoQueryAndInitializeNonLazyCollections(ISessionImplementor session, QueryParameters queryParameters, Boolean returnProxies) +129 NHibernate.Loader.Loader.DoList(ISessionImplementor session, QueryParameters queryParameters) +116 [GenericADOException: could not execute query [ select eventdata0_.deviceID as deviceID5_, eventdata0_.timestamp as timestamp5_, eventdata0_.statusCode as statusCode5_, eventdata0_.accountID as accountID5_, eventdata0_.latitude as latitude5_, eventdata0_.longitude as longitude5_, eventdata0_.gpsAge as gpsAge5_, eventdata0_.speedKPH as speedKPH5_, eventdata0_.heading as heading5_, eventdata0_.altitude as altitude5_, eventdata0_.transportID as transpo11_5_, eventdata0_.inputMask as inputMask5_, eventdata0_.outputMask as outputMask5_, eventdata0_.address as address5_, eventdata0_.DataSource as DataSource5_, eventdata0_.rawdata as rawdata5_, eventdata0_.distanceKM as distanceKM5_, eventdata0_.odometerKM as odometerKM5_, eventdata0_.geozoneIndex as geozone19_5_, eventdata0_.geozoneID as geozoneID5_, eventdata0_.creationTime as creatio21_5_ from eventdata eventdata0_ ] [SQL: select eventdata0_.deviceID as deviceID5_, eventdata0_.timestamp as timestamp5_, eventdata0_.statusCode as statusCode5_, eventdata0_.accountID as accountID5_, eventdata0_.latitude as latitude5_, eventdata0_.longitude as longitude5_, eventdata0_.gpsAge as gpsAge5_, eventdata0_.speedKPH as speedKPH5_, eventdata0_.heading as heading5_, eventdata0_.altitude as altitude5_, eventdata0_.transportID as transpo11_5_, eventdata0_.inputMask as inputMask5_, eventdata0_.outputMask as outputMask5_, eventdata0_.address as address5_, eventdata0_.DataSource as DataSource5_, eventdata0_.rawdata as rawdata5_, eventdata0_.distanceKM as distanceKM5_, eventdata0_.odometerKM as odometerKM5_, eventdata0_.geozoneIndex as geozone19_5_, eventdata0_.geozoneID as geozoneID5_, eventdata0_.creationTime as creatio21_5_ from eventdata eventdata0_]] NHibernate.Loader.Loader.DoList(ISessionImplementor session, QueryParameters queryParameters) +213 NHibernate.Loader.Loader.ListIgnoreQueryCache(ISessionImplementor session, QueryParameters queryParameters) +18 NHibernate.Loader.Loader.List(ISessionImplementor session, QueryParameters queryParameters, ISet`1 querySpaces, IType[] resultTypes) +79 NHibernate.Hql.Ast.ANTLR.Loader.QueryLoader.List(ISessionImplementor session, QueryParameters queryParameters) +51 NHibernate.Hql.Ast.ANTLR.QueryTranslatorImpl.List(ISessionImplementor session, QueryParameters queryParameters) +231 NHibernate.Engine.Query.HQLQueryPlan.PerformList(QueryParameters queryParameters, ISessionImplementor session, IList results) +369 NHibernate.Impl.SessionImpl.List(String query, QueryParameters queryParameters, IList results) +317 NHibernate.Impl.SessionImpl.List(String query, QueryParameters parameters) +282 NHibernate.Impl.QueryImpl.List() +163 DATA1.EventdataExtensions.GetEventdata() in C:\Users\HP\Desktop\our_project\DATA1\Queries\Eventdata.cs:33 MvcApplication7.Controllers.HistoriqueController.Index() in C:\Users\HP\Desktop\our_project\MvcApplication7\Controllers\HistoriqueController.cs:17 lambda_method(Closure , ControllerBase , Object[] ) +62 System.Web.Mvc.ActionMethodDispatcher.Execute(ControllerBase controller, Object[] parameters) +17 System.Web.Mvc.ReflectedActionDescriptor.Execute(ControllerContext controllerContext, IDictionary`2 parameters) +208 System.Web.Mvc.ControllerActionInvoker.InvokeActionMethod(ControllerContext controllerContext, ActionDescriptor actionDescriptor, IDictionary`2 parameters) +27 System.Web.Mvc.<>c__DisplayClass15.<InvokeActionMethodWithFilters>b__12() +55 System.Web.Mvc.ControllerActionInvoker.InvokeActionMethodFilter(IActionFilter filter, ActionExecutingContext preContext, Func`1 continuation) +263 System.Web.Mvc.<>c__DisplayClass17.<InvokeActionMethodWithFilters>b__14() +19 System.Web.Mvc.ControllerActionInvoker.InvokeActionMethodWithFilters(ControllerContext controllerContext, IList`1 filters, ActionDescriptor actionDescriptor, IDictionary`2 parameters) +191 System.Web.Mvc.ControllerActionInvoker.InvokeAction(ControllerContext controllerContext, String actionName) +343 System.Web.Mvc.Controller.ExecuteCore() +116 System.Web.Mvc.ControllerBase.Execute(RequestContext requestContext) +97 System.Web.Mvc.ControllerBase.System.Web.Mvc.IController.Execute(RequestContext requestContext) +10 System.Web.Mvc.<>c__DisplayClassb.<BeginProcessRequest>b__5() +37 System.Web.Mvc.Async.<>c__DisplayClass1.<MakeVoidDelegate>b__0() +21 System.Web.Mvc.Async.<>c__DisplayClass8`1.<BeginSynchronous>b__7(IAsyncResult _) +12 System.Web.Mvc.Async.WrappedAsyncResult`1.End() +62 System.Web.Mvc.<>c__DisplayClasse.<EndProcessRequest>b__d() +50 System.Web.Mvc.SecurityUtil.<GetCallInAppTrustThunk>b__0(Action f) +7 System.Web.Mvc.SecurityUtil.ProcessInApplicationTrust(Action action) +22 System.Web.Mvc.MvcHandler.EndProcessRequest(IAsyncResult asyncResult) +60 System.Web.Mvc.MvcHandler.System.Web.IHttpAsyncHandler.EndProcessRequest(IAsyncResult result) +9 System.Web.CallHandlerExecutionStep.System.Web.HttpApplication.IExecutionStep.Execute() +8841105 System.Web.HttpApplication.ExecuteStep(IExecutionStep step, Boolean& completedSynchronously) +184 Any suggestions? how can correct this error Data entity class (outtake from comment): public class MyClass { public virtual string DeviceID { get; set; } public virtual int Timestamp { get; set; } public virtual string Account { get; set; } public virtual int StatusCode { get; set; } public virtual double Latitude { get; set; } public virtual double Longitude { get; set; } public virtual int GpsAge { get; set; } public virtual double SpeedKPH { get; set; } public virtual double Heading { get; set; } public override bool Equals(object obj) { return true; } public override int GetHashCode() { return 0; } }

    Read the article

  • regular expression to read the string between <title> and </title>

    - by user262325
    Hello every one I hope to read the contents between and in a html string. I think it should be in objective-c @"<title([\\s\\S]*)</title>" below are the codes that rewrited for regular expression //source of NSStringCategory.h #import <Foundation/Foundation.h> #import <regex.h> @interface NSStringCategory:NSObject { regex_t preg; } -(id)initWithPattern:(NSString *)pattern options:(int)options; -(void)dealloc; -(BOOL)matchesString:(NSString *)string; -(NSString *)matchedSubstringOfString:(NSString *)string; -(NSArray *)capturedSubstringsOfString:(NSString *)string; +(NSStringCategory *)regexWithPattern:(NSString *)pattern options:(int)options; +(NSStringCategory *)regexWithPattern:(NSString *)pattern; +(NSString *)null; +(void)initialize; @end @interface NSString (NSStringCategory) -(BOOL)matchedByPattern:(NSString *)pattern options:(int)options; -(BOOL)matchedByPattern:(NSString *)pattern; -(NSString *)substringMatchedByPattern:(NSString *)pattern options:(int)options; -(NSString *)substringMatchedByPattern:(NSString *)pattern; -(NSArray *)substringsCapturedByPattern:(NSString *)pattern options:(int)options; -(NSArray *)substringsCapturedByPattern:(NSString *)pattern; -(NSString *)escapedPattern; @end and .m file #import "NSStringCategory.h" static NSString *nullstring=nil; @implementation NSStringCategory -(id)initWithPattern:(NSString *)pattern options:(int)options { if(self=[super init]) { int err=regcomp(&preg,[pattern UTF8String],options|REG_EXTENDED); if(err) { char errbuf[256]; regerror(err,&preg,errbuf,sizeof(errbuf)); [NSException raise:@"CSRegexException" format:@"Could not compile regex \"%@\": %s",pattern,errbuf]; } } return self; } -(void)dealloc { regfree(&preg); [super dealloc]; } -(BOOL)matchesString:(NSString *)string { if(regexec(&preg,[string UTF8String],0,NULL,0)==0) return YES; return NO; } -(NSString *)matchedSubstringOfString:(NSString *)string { const char *cstr=[string UTF8String]; regmatch_t match; if(regexec(&preg,cstr,1,&match,0)==0) { return [[[NSString alloc] initWithBytes:cstr+match.rm_so length:match.rm_eo-match.rm_so encoding:NSUTF8StringEncoding] autorelease]; } return nil; } -(NSArray *)capturedSubstringsOfString:(NSString *)string { const char *cstr=[string UTF8String]; int num=preg.re_nsub+1; regmatch_t *matches=calloc(sizeof(regmatch_t),num); if(regexec(&preg,cstr,num,matches,0)==0) { NSMutableArray *array=[NSMutableArray arrayWithCapacity:num]; int i; for(i=0;i<num;i++) { NSString *str; if(matches[i].rm_so==-1&&matches[i].rm_eo==-1) str=nullstring; else str=[[[NSString alloc] initWithBytes:cstr+matches[i].rm_so length:matches[i].rm_eo-matches[i].rm_so encoding:NSUTF8StringEncoding] autorelease]; [array addObject:str]; } free(matches); return [NSArray arrayWithArray:array]; } free(matches); return nil; } +(NSStringCategory *)regexWithPattern:(NSString *)pattern options:(int)options { return [[[NSStringCategory alloc] initWithPattern:pattern options:options] autorelease]; } +(NSStringCategory *)regexWithPattern:(NSString *)pattern { return [[[NSStringCategory alloc] initWithPattern:pattern options:0] autorelease]; } +(NSString *)null { return nullstring; } +(void)initialize { if(!nullstring) nullstring=[[NSString alloc] initWithString:@""]; } @end @implementation NSString (NSStringCategory) -(BOOL)matchedByPattern:(NSString *)pattern options:(int)options { NSStringCategory *re=[NSStringCategory regexWithPattern:pattern options:options|REG_NOSUB]; return [re matchesString:self]; } -(BOOL)matchedByPattern:(NSString *)pattern { return [self matchedByPattern:pattern options:0]; } -(NSString *)substringMatchedByPattern:(NSString *)pattern options:(int)options { NSStringCategory *re=[NSStringCategory regexWithPattern:pattern options:options]; return [re matchedSubstringOfString:self]; } -(NSString *)substringMatchedByPattern:(NSString *)pattern { return [self substringMatchedByPattern:pattern options:0]; } -(NSArray *)substringsCapturedByPattern:(NSString *)pattern options:(int)options { NSStringCategory *re=[NSStringCategory regexWithPattern:pattern options:options]; return [re capturedSubstringsOfString:self]; } -(NSArray *)substringsCapturedByPattern:(NSString *)pattern { return [self substringsCapturedByPattern:pattern options:0]; } -(NSString *)escapedPattern { int len=[self length]; NSMutableString *escaped=[NSMutableString stringWithCapacity:len]; for(int i=0;i<len;i++) { unichar c=[self characterAtIndex:i]; if(c=='^'||c=='.'||c=='['||c=='$'||c=='('||c==')' ||c=='|'||c=='*'||c=='+'||c=='?'||c=='{'||c=='\\') [escaped appendFormat:@"\\%C",c]; else [escaped appendFormat:@"%C",c]; } return [NSString stringWithString:escaped]; } @end I use the codes below to get the string between "" and "" NSStringCategory *a=[[NSStringCategory alloc] initWithPattern:@"<title([\s\S]*)</title>" options:0];// Unfortunately [a matchedSubstringOfString:response]] always returns nil I do not if the regular expression is wrong or any other reason. Welcome any comment Thanks interdev

    Read the article

  • PHP Email Form Sending Random Text

    - by Doug
    Hi, I did a webpage for a client that involved a series of text boxes asking for specific information such as a person's name, e-mail address, company, etc. Along with a button that would e-mail the information to my client. Whenever I tested the button it seemed to work perfectly, I uploaded the page and thought I was done. But, the other day my client got this email from the site: Name: rfhopzdgmx rfhopzdgmx Email: [email protected] Company: zUDXatAfoDvQrdH Mailing Address: AaSsXklqpHIsoCNcei gXsimMPRBYZqq vGLvZraZNdpOAV, ChsmuibE PoKzaSCubXPRI Home Phone: CIJbIfjMfjIaTqAlD Work Phone: JFLZBOvru Cell Phone: XlFJTTFGiTTiiFQfy Fax: UEJMOVZodWPkKxew Comments: sPvSCE hgetwoguderu,* [url=http://atyktjlxcznl.com/]atyktjlxcznl[/url], [link=http://nudvfcehwpyg.com/]nudvfcehwpyg[/link], http://lvvwkbzbhnzp.com/ Note: The * line contained HTML link code, I just don't know how to get this site to show it. Here is the PHP code in the site for the e-mail button. <?php //This Sends A Formatted Text Email Using The Text Boxes if ($_POST['submit']){ //This Gets The Form Data $fname = $_POST['fName']; $lname = $_POST['lName']; $email = $_POST['email']; $company = $_POST['co']; $address1 = $_POST['address1']; $address2 = $_POST['address2']; $city = $_POST['city']; $state = $_POST['state']; $zip = $_POST['zip']; $homep = $_POST['homeP']; $workp = $_POST['workP']; $cellp = $_POST['cellP']; $fax = $_POST['fax']; $comments = $_POST['txaOutputField']; //echo "<script language = 'javascript'>alert('YAY');</script>"; if ($fname && $lname && $email && $comments){ //Check If Required Fields Are Filled //This Sets The SMTP Configuration In php.ini ini_set("SMTP", "smtp.2ndsourcewire.com"); //This Replaces Any Blank Fields With 'None's if ($company == ""){ $company = "None"; } if ($address1 == ""){ $address1 = "None"; } if ($city == ""){ $city = "None"; } if ($state == ""){ $state = "None"; } if ($zip == ""){ $zip = "None"; } if ($homep == ""){ $homep = "None"; } if ($workp == ""){ $workp = "None"; } if ($cellp == ""){ $cellp = "None"; } if ($fax == ""){ $fax = "None"; } //This Creates The Variables Necessary For The Email $to = "CLIENT EMAIL WHICH I'M CENSORING"; $subject = "Email from 2ndSourceWire.com"; $from = "From: [email protected]"; $secondEmail = "MY EMAIL WHICH I'M ALSO CENSORING"; if ($address2 == ""){ $body = "Name: $fname $lname\n". "Email: $email\n". "Company: $company\n\n". "Mailing Address:\n". "$address1\n". "$city, $state $zip\n\n". "Home Phone: $homep\n". "Work Phone: $workp\n". "Cell Phone: $cellp\n". "Fax: $fax\n\n". "Comments:\n". "$comments"; } else { $body = "Name: $fname $lname\n". "Email: $email\n". "Company: $company\n\n". "Mailing Address:\n". "$address1\n". "$address2\n". "$city, $state $zip\n\n". "Home Phone: $homep\n". "Work Phone: $workp\n". "Cell Phone: $cellp\n". "Fax: $fax\n\n". "Comments:\n". "$comments"; } //This Sends The Email mail($to, $subject, $body, $from); mail($secondEmail, $subject, $body, $from); echo "<script language = 'javascript'>alert('The email was sent successfully.');</script>"; } else { //The Required Fields Are Not Filled echo "<script language = 'javascript'>alert('Please fill your first name, last name, email address, and your comment or question.');</script>"; } } ? I'm a little dumbfounded on how this happened, the client mentioned a couple e-mails of this, so I don't think it is a random glitch. Also, the e-mail address was formatted like an e-mail address, so someone or some program was interpreting the labels next to each text box. I also noticed that the first and last names entered are the same word, even though they were in different text boxes, I'm thinking its some spam program, but wouldn't they try to advertise something and make money, rather than just spouting out random text? Also, the comments section makes no sense to me at all, the links goto nowhere and they're all perfectly formatted, a random person just screwing around wouldn't know those tags, and a programmer doing it wouldn't bother with it, but also neither would a program. I have no idea what caused this or how to fix it, I'm drawing a blank here. Anyone have any ideas?

    Read the article

  • Arduino - AdHoc Network Setup

    - by methodMan
    I`m currently working with an arduino trying to build an adhoc network to which a device can connect to and send web request to. The problem I am currently having is that I can only set up one connection and then when that connection is terminated (client.stop()) all subsequent connections are not picked up by the server, even a curl command just sits there spinning. The first connection I start when I reset the server works fine and I am able to talk to the server; but after that, the arduino can no longer find new clients (even though it's trying with the library given). I`m using the sparkfun library for the wifly shield cloned from github, along with an Arduino Uno. My current code is based off their default example 'WiFly_AdHoc_Example' but I had to remove a few things to get the network to start up which might be the cause of this problem. Here is the .ino file that I am running. #include <SPI.h> #include <WiFly.h> //#include <SoftwareSerial.h> //SoftwareSerial mySerial( 5, 4); //Part from example not used(see below) WiFlyServer server(80); void setup() { Serial.begin(9600); //The code below is from the example but when I run it the WiFly will hang // on Wifly.begin(). Without it the WiFly starts up fine but only works for // one request. //mySerial.begin(9600); //WiFly.setUart(&mySerial); // Tell the WiFly library that we are not //using the SPIUart Serial.println("**************Starting WiFly**************"); // Enable Adhoc mod WiFly.begin(true); Serial.println("WiFly started, creating network."); if (!WiFly.createAdHocNetwork("wifly")) { Serial.print("Failed to create ad hoc network."); while (1) { // Hang on failure. } } Serial.println("Network created"); Serial.print("IP: "); Serial.println(WiFly.ip()); Serial.println("Starting Server..."); server.begin(); Serial.print("Server started, waiting for client."); } void loop() { delay(200); WiFlyClient client = server.available(); if (client) { Serial.println("Client Found."); // a string to store received commands String current_command = ""; while (client.connected()) { if (client.available()) { //Gets a character from the sent request. char c = client.read(); if (c=='#' || c=='\n') //End of extraneous output { current_command = ""; } else if(c!= '\n') { current_command+=c; } if (current_command== "get") { // output the value of each analog input pin for (int i = 0; i < 6; i++) { client.print("analog input "); client.print(i); client.print(" is "); client.print(analogRead(i)); client.println("<br />"); } } else if(current_command== "hello") { client.println("Hello there, I'm still here."); } else if (current_command== "quit") { client.println("Goodbye..."); client.stop(); current_command == ""; break; } else if (current_command == "*OPEN*") { current_command == ""; } } } // give the web browser time to receive the data delay(200); // close the connection client.stop(); } } If anyone understands this better then I (I`m new to arduino) please leave some helpful comments. Or just help me out on getting this little web server up and running so that I can hit it with more then one request. If there is any other helpful information I can provide please let me know. Thanks for reading and hope you can help. EDIT: Using telnet I can successfully connect (the first time) and send commands to the arduino including one to terminate the connection (calls the client.stop() method). But when I try to reconnect though telnet, it says the connection was successful but on the arduino it's still looping thinking the client is still false. WHAT??? I know right, I'm getting mixed messages from telnet vs arduino. None of the commands work obviously since the ardunio is still looping waiting for a client that evaluates to true. I'm gonna take a look at WiFlyServer from the library I imported and see if I can dig up the problem because somehow that server.available() method isn't finding new clients. Noticing a lot of TODO's in the library code.... EDIT: So I found the reason for the problem, it was in WiFlyServer.cpp file from the sparkfun library. The code that was causing the reconnect issue was infact in the server.availible() method. Right at the top of the method, there is a check: // TODO: Ensure no active non-server client connection. if (!WiFly.serverConnectionActive) { activeClient._port = 0; } For some reason when I comment this out, I can reconnect fine and everything works as it should. I will now dive into the library and see if I can fix this, I'm not exactly sure what this is doing but it gets called when the server connection is not active and is somehow blocking subsequent connections. Does anyone have any ideas how I might get to the root of this problem without using this commenting hack? Please help, no-one has commented or answered yet! Don't you want to join in on the fun???

    Read the article

  • How to get javascript object references or reference count?

    - by Tauren
    How to get reference count for an object Is it possible to determine if a javascript object has multiple references to it? Or if it has references besides the one I'm accessing it with? Or even just to get the reference count itself? Can I find this information from javascript itself, or will I need to keep track of my own reference counters. Obviously, there must be at least one reference to it for my code access the object. But what I want to know is if there are any other references to it, or if my code is the only place it is accessed. I'd like to be able to delete the object if nothing else is referencing it. If you know the answer, there is no need to read the rest of this question. Below is just an example to make things more clear. Use Case In my application, I have a Repository object instance called contacts that contains an array of ALL my contacts. There are also multiple Collection object instances, such as friends collection and a coworkers collection. Each collection contains an array with a different set of items from the contacts Repository. Sample Code To make this concept more concrete, consider the code below. Each instance of the Repository object contains a list of all items of a particular type. You might have a repository of Contacts and a separate repository of Events. To keep it simple, you can just get, add, and remove items, and add many via the constructor. var Repository = function(items) { this.items = items || []; } Repository.prototype.get = function(id) { for (var i=0,len=this.items.length; i<len; i++) { if (items[i].id === id) { return this.items[i]; } } } Repository.prototype.add = function(item) { if (toString.call(item) === "[object Array]") { this.items.concat(item); } else { this.items.push(item); } } Repository.prototype.remove = function(id) { for (var i=0,len=this.items.length; i<len; i++) { if (items[i].id === id) { this.removeIndex(i); } } } Repository.prototype.removeIndex = function(index) { if (items[index]) { if (/* items[i] has more than 1 reference to it */) { // Only remove item from repository if nothing else references it this.items.splice(index,1); return; } } } Note the line in remove with the comment. I only want to remove the item from my master repository of objects if no other objects have a reference to the item. Here's Collection: var Collection = function(repo,items) { this.repo = repo; this.items = items || []; } Collection.prototype.remove = function(id) { for (var i=0,len=this.items.length; i<len; i++) { if (items[i].id === id) { // Remove object from this collection this.items.splice(i,1); // Tell repo to remove it (only if no other references to it) repo.removeIndxe(i); return; } } } And then this code uses Repository and Collection: var contactRepo = new Repository([ {id: 1, name: "Joe"}, {id: 2, name: "Jane"}, {id: 3, name: "Tom"}, {id: 4, name: "Jack"}, {id: 5, name: "Sue"} ]); var friends = new Collection( contactRepo, [ contactRepo.get(2), contactRepo.get(4) ] ); var coworkers = new Collection( contactRepo, [ contactRepo.get(1), contactRepo.get(2), contactRepo.get(5) ] ); contactRepo.items; // contains item ids 1, 2, 3, 4, 5 friends.items; // contains item ids 2, 4 coworkers.items; // contains item ids 1, 2, 5 coworkers.remove(2); contactRepo.items; // contains item ids 1, 2, 3, 4, 5 friends.items; // contains item ids 2, 4 coworkers.items; // contains item ids 1, 5 friends.remove(4); contactRepo.items; // contains item ids 1, 2, 3, 5 friends.items; // contains item ids 2 coworkers.items; // contains item ids 1, 5 Notice how coworkers.remove(2) didn't remove id 2 from contactRepo? This is because it was still referenced from friends.items. However, friends.remove(4) causes id 4 to be removed from contactRepo, because no other collection is referring to it. Summary The above is what I want to do. I'm sure there are ways I can do this by keeping track of my own reference counters and such. But if there is a way to do it using javascript's built-in reference management, I'd like to hear about how to use it.

    Read the article

  • Flex/bison, error: undeclared

    - by Imran
    hallo, i have a problem, the followed program gives back an error, error:: Undeclared(first use in function), why this error appears all tokens are declared, but this error comes, can anyone help me, here are the lex and yac files.thanks lex: %{ int yylinenu= 1; int yycolno= 1; %} %x STR DIGIT [0-9] ALPHA [a-zA-Z] ID {ALPHA}(_?({ALPHA}|{DIGIT}))*_? GROUPED_NUMBER ({DIGIT}{1,3})(\.{DIGIT}{3})* SIMPLE_NUMBER {DIGIT}+ NUMMER {GROUPED_NUMBER}|{SIMPLE_NUMBER} %% <INITIAL>{ [\n] {++yylinenu ; yycolno=1;} [ ]+ {yycolno=yycolno+yyleng;} [\t]+ {yycolno=yycolno+(yyleng*8);} "*" {return MAL;} "+" {return PLUS;} "-" {return MINUS;} "/" {return SLASH;} "(" {return LINKEKLAMMER;} ")" {return RECHTEKLAMMER;} "{" {return LINKEGESCHWEIFTEKLAMMER;} "}" {return RECHTEGESCHEIFTEKLAMMER;} "=" {return GLEICH;} "==" {return GLEICHVERGLEICH;} "!=" {return UNGLEICH;} "<" {return KLEINER;} ">" {return GROSSER;} "<=" {return KLEINERGLEICH;} ">=" {return GROSSERGLEICH;} "while" {return WHILE;} "if" {return IF;} "else" {return ELSE;} "printf" {return PRINTF;} ";" {return SEMIKOLON;} \/\/[^\n]* { ;} {NUMMER} {return NUMBER;} {ID} {return IDENTIFIER;} \" {BEGIN(STR);} . {;} } <STR>{ \n {++yylinenu ;yycolno=1;} ([^\"\\]|"\\t"|"\\n"|"\\r"|"\\b"|"\\\"")+ {return STRING;} \" {BEGIN(INITIAL);} } %% yywrap() { } YACC: %{ #include stdio.h> #include string.h> #include "lex.yy.c" void yyerror(char *err); int error=0,linecnt=1; %} %token IDENTIFIER NUMBER STRING COMMENT PLUS MINUS MAL SLASH LINKEKLAMMER RECHTEKLAMMER LINKEGESCHWEIFTEKLAMMER RECHTEGESCHEIFTEKLAMMER GLEICH GLEICHVERGLEICH UNGLEICH GROSSER KLEINER GROSSERGLEICH KLEINERGLEICH IF ELSE WHILE PRINTF SEMIKOLON %start Stmts %% Stmts : Stmt {puts("\t\tStmts : Stmt");} |Stmt Stmts {puts("\t\tStmts : Stmt Stmts");} ; //NEUE REGEL---------------------------------------------- Stmt : LINKEGESCHWEIFTEKLAMMER Stmts RECHTEGESCHEIFTEKLAMMER {puts("\t\tStmt : '{' Stmts '}'");} |IF LINKEKLAMMER Cond RECHTEKLAMMER Stmt {puts("\t\tStmt : '(' Cond ')' Stmt");} |IF LINKEKLAMMER Cond RECHTEKLAMMER Stmt ELSE Stmt {puts("\t\tStmt : '(' Cond ')' Stmt 'ELSE' Stmt");} |WHILE LINKEKLAMMER Cond RECHTEKLAMMER Stmt {puts("\t\tStmt : 'PRINTF' Expr ';'");} |PRINTF Expr SEMIKOLON {puts("\t\tStmt : 'PRINTF' Expr ';'");} |IDENTIFIER GLEICH Expr SEMIKOLON {puts("\t\tStmt : 'IDENTIFIER' '=' Expr ';'");} |SEMIKOLON {puts("\t\tStmt : ';'");} ;//NEUE REGEL --------------------------------------------- Cond: Expr GLEICHVERGLEICH Expr {puts("\t\tCond : '==' Expr");} |Expr UNGLEICH Expr {puts("\t\tCond : '!=' Expr");} |Expr KLEINER Expr {puts("\t\tCond : '<' Expr");} |Expr KLEINERGLEICH Expr {puts("\t\tCond : '<=' Expr");} |Expr GROSSER Expr {puts("\t\tCond : '>' Expr");} |Expr GROSSERGLEICH Expr {puts("\t\tCond : '>=' Expr");} ;//NEUE REGEL -------------------------------------------- Expr:Term {puts("\t\tExpr : Term");} |Term PLUS Expr {puts("\t\tExpr : Term '+' Expr");} |Term MINUS Expr {puts("\t\tExpr : Term '-' Expr");} ;//NEUE REGEL -------------------------------------------- Term:Factor {puts("\t\tTerm : Factor");} |Factor MAL Term {puts("\t\tTerm : Factor '*' Term");} |Factor SLASH Term {puts("\t\tTerm : Factor '/' Term");} ;//NEUE REGEL -------------------------------------------- Factor:SimpleExpr {puts("\t\tFactor : SimpleExpr");} |MINUS SimpleExpr {puts("\t\tFactor : '-' SimpleExpr");} ;//NEUE REGEL -------------------------------------------- SimpleExpr:LINKEKLAMMER Expr RECHTEKLAMMER {puts("\t\tSimpleExpr : '(' Expr ')'");} |IDENTIFIER {puts("\t\tSimpleExpr : 'IDENTIFIER'");} |NUMBER {puts("\t\tSimpleExpr : 'NUMBER'");} |STRING {puts("\t\tSimpleExpr : 'String'");} ;//ENDE ------------------------------------------------- %% void yyerror(char *msg) { error=1; printf("Line: %d , Column: %d : %s \n", yylinenu, yycolno,yytext, msg); } int main(int argc, char *argv[]) { int val; while(yylex()) { printf("\n",yytext); } return yyparse(); }

    Read the article

  • How to create a SOAP REQUEST using ASP.NET (VB) without using Visual

    - by user311691
    Hi all , I urgently need your help . I am new to consuming a web service using SOAP protocol. I have been given a demo webservice URL which ends in .WSDL and NOT .asml?WSDL. The problem is I cannot add a web reference using Visual studio OR Disco.exe or Wsdl.exe - This webservice has been created on a java platform and for security reasons the only way to make a invoke the webservice is at runtime using SOAP protocol IN asp.net (VB). I I have created some code but cannot seem to send the soap object to the receiving web service. If I could get a solution with step by step instructions on how I can send a SOAP REQUEST. Below is my code and all am trying to do is send a SOAP REQUEST and receive a SOAP RESPONSE which I will display in my browser. <%@ page language="vb" %> <%@ Import Namespace="System.Data"%> <%@ Import Namespace="System.Xml"%> <%@ Import Namespace="System.Net"%> <%@ Import Namespace="System.IO"%> <%@ Import Namespace="System.Text"%> <script runat=server> Private Sub Page_Load() Dim objHTTPReq As HttpWebRequest Dim WebserviceUrl As String = "http://xx.xx.xx:8084/asy/wsdl/asy.wsdl" objHTTPReq = CType(WebRequest.Create(WebserviceUrl), HttpWebRequest) Dim soapXML As String soapXML = "<?xml version='1.0' encoding='utf-8'?>" & _ " <soap:Envelope xmlns:xsi='http://www.w3.org/2001/XMLSchema-instance'" & _ " xmlns:xsd='http://www.w3.org/2001/XMLSchema'"& _ " xmlns:soap='http://schemas.xmlsoap.org/soap/envelope/' >"& _ " <soap:Body> "& _ " <validatePaymentData xmlns='http://asybanks.webservices.asycuda.org'> " & _ " <bankCode>"& bankCode &"</bankCode> " & _ " <PaymentDataType>" & _ " <paymentType>"& payment_type &"</paymentType> " & _ " <amount>"& ass_amount &"</amount> " & _ " <ReferenceType>" & _ " <year>"& year &"</year> " & _ " <customsOfficeCode>"& station &"</customsOfficeCode> " & _ " </ReferenceType>" & _ " <accountNumber>"& zra_account &"</accountNumber> " & _ " </PaymentDataType> " & _ " </validatePaymentData> " & _ " </soap:Body> " & _ " </soap:Envelope> " objHTTPReq.Headers.Add("SOAPAction", "http://asybanks.webservices.asycuda.org") objHTTPReq.ContentType = "text/xml; charset=utf-8" objHTTPReq.ContentLength = soapXML.Length objHTTPReq.Accept = "text/xml" objHTTPReq.Method = "POST" Dim objHTTPRes As HttpWebResponse = CType(objHTTPReq.GetResponse(), HttpWebResponse) Dim dataStream As Stream = objHTTPRes.GetResponseStream() Dim reader As StreamReader = new StreamReader(dataStream) Dim responseFromServer As String = reader.ReadToEnd() OurXml.text = responseFromServer End Sub </script> <html xmlns="http://www.w3.org/1999/xhtml"> <head runat="server"> <title> XML TRANSACTION SIMULATION - N@W@ TJ </title> </head> <body> <form id="form1" runat="server"> <div> <p>ZRA test Feedback:</p> <asp:label id="OurXml" runat="server"/> </div> </form> </body> </html> the demo webservice looks like this: <?xml version="1.0" encoding="UTF-8" ?> - <!-- WEB SERVICE JAVA DEMO --> - <definitions targetNamespace="http://asybanks.webservices.asycuda.org" xmlns="http://schemas.xmlsoap.org/wsdl/" xmlns:apachesoap="http://xml.apache.org/xml-soap" xmlns:soap="http://schemas.xmlsoap.org/wsdl/soap/" xmlns:xs="http://www.w3.org/2001/XMLSchema" xmlns:y="http://asybanks.webservices.asycuda.org"> - <types> - <xs:schema elementFormDefault="qualified" targetNamespace="http://asybanks.webservices.asycuda.org" xmlns="http://www.w3.org/2001/XMLSchema"> SOME OTHER INFORMATION AT THE BOTTOM <soap:address location="http://xx.xx.xx:8084/asy/services/asy" /> </port> </service> </definitions> From the above excerpt of the wsdl url webservice, I am not sure which namespace to use for soapACTION - please advise.... Please if you could comment every stage of a soap request and provide a working demo - I would be most grateful as I would be learning rather than just assuming stuff :)

    Read the article

  • How can I further optimize this color difference function?

    - by aLfa
    I have made this function to calculate color differences in the CIE Lab colorspace, but it lacks speed. Since I'm not a Java expert, I wonder if any Java guru around has some tips that can improve the speed here. The code is based on the matlab function mentioned in the comment block. /** * Compute the CIEDE2000 color-difference between the sample color with * CIELab coordinates 'sample' and a standard color with CIELab coordinates * 'std' * * Based on the article: * "The CIEDE2000 Color-Difference Formula: Implementation Notes, * Supplementary Test Data, and Mathematical Observations,", G. Sharma, * W. Wu, E. N. Dalal, submitted to Color Research and Application, * January 2004. * available at http://www.ece.rochester.edu/~gsharma/ciede2000/ */ public static double deltaE2000(double[] lab1, double[] lab2) { double L1 = lab1[0]; double a1 = lab1[1]; double b1 = lab1[2]; double L2 = lab2[0]; double a2 = lab2[1]; double b2 = lab2[2]; // Cab = sqrt(a^2 + b^2) double Cab1 = Math.sqrt(a1 * a1 + b1 * b1); double Cab2 = Math.sqrt(a2 * a2 + b2 * b2); // CabAvg = (Cab1 + Cab2) / 2 double CabAvg = (Cab1 + Cab2) / 2; // G = 1 + (1 - sqrt((CabAvg^7) / (CabAvg^7 + 25^7))) / 2 double CabAvg7 = Math.pow(CabAvg, 7); double G = 1 + (1 - Math.sqrt(CabAvg7 / (CabAvg7 + 6103515625.0))) / 2; // ap = G * a double ap1 = G * a1; double ap2 = G * a2; // Cp = sqrt(ap^2 + b^2) double Cp1 = Math.sqrt(ap1 * ap1 + b1 * b1); double Cp2 = Math.sqrt(ap2 * ap2 + b2 * b2); // CpProd = (Cp1 * Cp2) double CpProd = Cp1 * Cp2; // hp1 = atan2(b1, ap1) double hp1 = Math.atan2(b1, ap1); // ensure hue is between 0 and 2pi if (hp1 < 0) { // hp1 = hp1 + 2pi hp1 += 6.283185307179586476925286766559; } // hp2 = atan2(b2, ap2) double hp2 = Math.atan2(b2, ap2); // ensure hue is between 0 and 2pi if (hp2 < 0) { // hp2 = hp2 + 2pi hp2 += 6.283185307179586476925286766559; } // dL = L2 - L1 double dL = L2 - L1; // dC = Cp2 - Cp1 double dC = Cp2 - Cp1; // computation of hue difference double dhp = 0.0; // set hue difference to zero if the product of chromas is zero if (CpProd != 0) { // dhp = hp2 - hp1 dhp = hp2 - hp1; if (dhp > Math.PI) { // dhp = dhp - 2pi dhp -= 6.283185307179586476925286766559; } else if (dhp < -Math.PI) { // dhp = dhp + 2pi dhp += 6.283185307179586476925286766559; } } // dH = 2 * sqrt(CpProd) * sin(dhp / 2) double dH = 2 * Math.sqrt(CpProd) * Math.sin(dhp / 2); // weighting functions // Lp = (L1 + L2) / 2 - 50 double Lp = (L1 + L2) / 2 - 50; // Cp = (Cp1 + Cp2) / 2 double Cp = (Cp1 + Cp2) / 2; // average hue computation // hp = (hp1 + hp2) / 2 double hp = (hp1 + hp2) / 2; // identify positions for which abs hue diff exceeds 180 degrees if (Math.abs(hp1 - hp2) > Math.PI) { // hp = hp - pi hp -= Math.PI; } // ensure hue is between 0 and 2pi if (hp < 0) { // hp = hp + 2pi hp += 6.283185307179586476925286766559; } // LpSqr = Lp^2 double LpSqr = Lp * Lp; // Sl = 1 + 0.015 * LpSqr / sqrt(20 + LpSqr) double Sl = 1 + 0.015 * LpSqr / Math.sqrt(20 + LpSqr); // Sc = 1 + 0.045 * Cp double Sc = 1 + 0.045 * Cp; // T = 1 - 0.17 * cos(hp - pi / 6) + // + 0.24 * cos(2 * hp) + // + 0.32 * cos(3 * hp + pi / 30) - // - 0.20 * cos(4 * hp - 63 * pi / 180) double hphp = hp + hp; double T = 1 - 0.17 * Math.cos(hp - 0.52359877559829887307710723054658) + 0.24 * Math.cos(hphp) + 0.32 * Math.cos(hphp + hp + 0.10471975511965977461542144610932) - 0.20 * Math.cos(hphp + hphp - 1.0995574287564276334619251841478); // Sh = 1 + 0.015 * Cp * T double Sh = 1 + 0.015 * Cp * T; // deltaThetaRad = (pi / 3) * e^-(36 / (5 * pi) * hp - 11)^2 double powerBase = hp - 4.799655442984406; double deltaThetaRad = 1.0471975511965977461542144610932 * Math.exp(-5.25249016001879 * powerBase * powerBase); // Rc = 2 * sqrt((Cp^7) / (Cp^7 + 25^7)) double Cp7 = Math.pow(Cp, 7); double Rc = 2 * Math.sqrt(Cp7 / (Cp7 + 6103515625.0)); // RT = -sin(delthetarad) * Rc double RT = -Math.sin(deltaThetaRad) * Rc; // de00 = sqrt((dL / Sl)^2 + (dC / Sc)^2 + (dH / Sh)^2 + RT * (dC / Sc) * (dH / Sh)) double dLSl = dL / Sl; double dCSc = dC / Sc; double dHSh = dH / Sh; return Math.sqrt(dLSl * dLSl + dCSc * dCSc + dHSh * dHSh + RT * dCSc * dHSh); }

    Read the article

  • Cascading S3 Sink Tap not being deleted with SinkMode.REPLACE

    - by Eric Charles
    We are running Cascading with a Sink Tap being configured to store in Amazon S3 and were facing some FileAlreadyExistsException (see [1]). This was only from time to time (1 time on around 100) and was not reproducable. Digging into the Cascading codem, we discovered the Hfs.deleteResource() is called (among others) by the BaseFlow.deleteSinksIfNotUpdate(). Btw, we were quite intrigued with the silent NPE (with comment "hack to get around npe thrown when fs reaches root directory"). From there, we extended the Hfs tap with our own Tap to add more action in the deleteResource() method (see [2]) with a retry mechanism calling directly the getFileSystem(conf).delete. The retry mechanism seemed to bring improvement, but we are still sometimes facing failures (see example in [3]): it sounds like HDFS returns isDeleted=true, but asking directly after if the folder exists, we receive exists=true, which should not happen. Logs also shows randomly isDeleted true or false when the flow succeeds, which sounds like the returned value is irrelevant or not to be trusted. Can anybody bring his own S3 experience with such a behavior: "folder should be deleted, but it is not"? We suspect a S3 issue, but could it also be in Cascading or HDFS? We run on Hadoop Cloudera-cdh3u5 and Cascading 2.0.1-wip-dev. [1] org.apache.hadoop.mapred.FileAlreadyExistsException: Output directory s3n://... already exists at org.apache.hadoop.mapreduce.lib.output.FileOutputFormat.checkOutputSpecs(FileOutputFormat.java:132) at com.twitter.elephantbird.mapred.output.DeprecatedOutputFormatWrapper.checkOutputSpecs(DeprecatedOutputFormatWrapper.java:75) at org.apache.hadoop.mapred.JobClient$2.run(JobClient.java:923) at org.apache.hadoop.mapred.JobClient$2.run(JobClient.java:882) at java.security.AccessController.doPrivileged(Native Method) at javax.security.auth.Subject.doAs(Subject.java:396) at org.apache.hadoop.security.UserGroupInformation.doAs(UserGroupInformation.java:1278) at org.apache.hadoop.mapred.JobClient.submitJobInternal(JobClient.java:882) at org.apache.hadoop.mapred.JobClient.submitJob(JobClient.java:856) at cascading.flow.hadoop.planner.HadoopFlowStepJob.internalNonBlockingStart(HadoopFlowStepJob.java:104) at cascading.flow.planner.FlowStepJob.blockOnJob(FlowStepJob.java:174) at cascading.flow.planner.FlowStepJob.start(FlowStepJob.java:137) at cascading.flow.planner.FlowStepJob.call(FlowStepJob.java:122) at cascading.flow.planner.FlowStepJob.call(FlowStepJob.java:42) at java.util.concurrent.FutureTask$Sync.innerRun(FutureTask.java:303) at java.util.concurrent.FutureTask.run(FutureTask.java:138) at java.util.concurrent.ThreadPoolExecutor$Worker.runTask(ThreadPoolExecutor.java:886) at java.util.concurrent.ThreadPoolExecutor$Worker.run(ThreadPoolExecutor.java:908) at java.lang.Thread.run(Thread.j [2] @Override public boolean deleteResource(JobConf conf) throws IOException { LOGGER.info("Deleting resource {}", getIdentifier()); boolean isDeleted = super.deleteResource(conf); LOGGER.info("Hfs Sink Tap isDeleted is {} for {}", isDeleted, getIdentifier()); Path path = new Path(getIdentifier()); int retryCount = 0; int cumulativeSleepTime = 0; int sleepTime = 1000; while (getFileSystem(conf).exists(path)) { LOGGER .info( "Resource {} still exists, it should not... - I will continue to wait patiently...", getIdentifier()); try { LOGGER.info("Now I will sleep " + sleepTime / 1000 + " seconds while trying to delete {} - attempt: {}", getIdentifier(), retryCount + 1); Thread.sleep(sleepTime); cumulativeSleepTime += sleepTime; sleepTime *= 2; } catch (InterruptedException e) { e.printStackTrace(); LOGGER .error( "Interrupted while sleeping trying to delete {} with message {}...", getIdentifier(), e.getMessage()); throw new RuntimeException(e); } if (retryCount == 0) { getFileSystem(conf).delete(getPath(), true); } retryCount++; if (cumulativeSleepTime > MAXIMUM_TIME_TO_WAIT_TO_DELETE_MS) { break; } } if (getFileSystem(conf).exists(path)) { LOGGER .error( "We didn't succeed to delete the resource {}. Throwing now a runtime exception.", getIdentifier()); throw new RuntimeException( "Although we waited to delete the resource for " + getIdentifier() + ' ' + retryCount + " iterations, it still exists - This must be an issue in the underlying storage system."); } return isDeleted; } [3] INFO [pool-2-thread-15] (BaseFlow.java:1287) - [...] at least one sink is marked for delete INFO [pool-2-thread-15] (BaseFlow.java:1287) - [...] sink oldest modified date: Wed Dec 31 23:59:59 UTC 1969 INFO [pool-2-thread-15] (HiveSinkTap.java:148) - Now I will sleep 1 seconds while trying to delete s3n://... - attempt: 1 INFO [pool-2-thread-15] (HiveSinkTap.java:130) - Deleting resource s3n://... INFO [pool-2-thread-15] (HiveSinkTap.java:133) - Hfs Sink Tap isDeleted is true for s3n://... ERROR [pool-2-thread-15] (HiveSinkTap.java:175) - We didn't succeed to delete the resource s3n://... Throwing now a runtime exception. WARN [pool-2-thread-15] (Cascade.java:706) - [...] flow failed: ... java.lang.RuntimeException: Although we waited to delete the resource for s3n://... 0 iterations, it still exists - This must be an issue in the underlying storage system. at com.qubit.hive.tap.HiveSinkTap.deleteResource(HiveSinkTap.java:179) at com.qubit.hive.tap.HiveSinkTap.deleteResource(HiveSinkTap.java:40) at cascading.flow.BaseFlow.deleteSinksIfNotUpdate(BaseFlow.java:971) at cascading.flow.BaseFlow.prepare(BaseFlow.java:733) at cascading.cascade.Cascade$CascadeJob.call(Cascade.java:761) at cascading.cascade.Cascade$CascadeJob.call(Cascade.java:710) at java.util.concurrent.FutureTask$Sync.innerRun(FutureTask.java:303) at java.util.concurrent.FutureTask.run(FutureTask.java:138) at java.util.concurrent.ThreadPoolExecutor$Worker.runTask(ThreadPoolExecutor.java:886) at java.util.concurrent.ThreadPoolExecutor$Worker.run(ThreadPoolExecutor.java:908) at java.lang.Thread.run(Thread.java:619)

    Read the article

  • "The usage of semaphores is subtly wrong"

    - by Hoonose
    This past semester I was taking an OS practicum in C, in which the first project involved making a threads package, then writing a multiple producer-consumer program to demonstrate the functionality. However, after getting grading feedback, I lost points for "The usage of semaphores is subtly wrong" and "The program assumes preemption (e.g. uses yield to change control)" (We started with a non-preemptive threads package then added preemption later. Note that the comment and example contradict each other. I believe it doesn't assume either, and would work in both environments). This has been bugging me for a long time - the course staff was kind of overwhelmed, so I couldn't ask them what's wrong with this over the semester. I've spent a long time thinking about this and I can't see the issues. If anyone could take a look and point out the error, or reassure me that there actually isn't a problem, I'd really appreciate it. I believe the syntax should be pretty standard in terms of the thread package functions (minithreads and semaphores), but let me know if anything is confusing. #include <stdio.h> #include <stdlib.h> #include "minithread.h" #include "synch.h" #define BUFFER_SIZE 16 #define MAXCOUNT 100 int buffer[BUFFER_SIZE]; int size, head, tail; int count = 1; int out = 0; int toadd = 0; int toremove = 0; semaphore_t empty; semaphore_t full; semaphore_t count_lock; // Semaphore to keep a lock on the // global variables for maintaining the counts /* Method to handle the working of a student * The ID of a student is the corresponding minithread_id */ int student(int total_burgers) { int n, i; semaphore_P(count_lock); while ((out+toremove) < arg) { n = genintrand(BUFFER_SIZE); n = (n <= total_burgers - (out + toremove)) ? n : total_burgers - (out + toremove); printf("Student %d wants to get %d burgers ...\n", minithread_id(), n); toremove += n; semaphore_V(count_lock); for (i=0; i<n; i++) { semaphore_P(empty); out = buffer[tail]; printf("Student %d is taking burger %d.\n", minithread_id(), out); tail = (tail + 1) % BUFFER_SIZE; size--; toremove--; semaphore_V(full); } semaphore_P(count_lock); } semaphore_V(count_lock); printf("Student %d is done.\n", minithread_id()); return 0; } /* Method to handle the working of a cook * The ID of a cook is the corresponding minithread_id */ int cook(int total_burgers) { int n, i; printf("Creating Cook %d\n",minithread_id()); semaphore_P(count_lock); while ((count+toadd) <= arg) { n = genintrand(BUFFER_SIZE); n = (n <= total_burgers - (count + toadd) + 1) ? n : total_burgers - (count + toadd) + 1; printf("Cook %d wants to put %d burgers into the burger stack ...\n", minithread_id(),n); toadd += n; semaphore_V(count_lock); for (i=0; i<n; i++) { semaphore_P(full); printf("Cook %d is putting burger %d into the burger stack.\n", minithread_id(), count); buffer[head] = count++; head = (head + 1) % BUFFER_SIZE; size++; toadd--; semaphore_V(empty); } semaphore_P(count_lock); } semaphore_V(count_lock); printf("Cook %d is done.\n", minithread_id()); return 0; } /* Method to create our multiple producers and consumers * and start their respective threads by fork */ void starter(int* c){ int i; for (i=0;i<c[2];i++){ minithread_fork(cook, c[0]); } for (i=0;i<c[1];i++){ minithread_fork(student, c[0]); } } /* The arguments are passed as command line parameters * argv[1] is the no of students * argv[2] is the no of cooks */ void main(int argc, char *argv[]) { int pass_args[3]; pass_args[0] = MAXCOUNT; pass_args[1] = atoi(argv[1]); pass_args[2] = atoi(argv[2]); size = head = tail = 0; empty = semaphore_create(); semaphore_initialize(empty, 0); full = semaphore_create(); semaphore_initialize(full, BUFFER_SIZE); count_lock = semaphore_create(); semaphore_initialize(count_lock, 1); minithread_system_initialize(starter, pass_args); }

    Read the article

  • Performance of delegate and method group

    - by BlueFox
    Hi I was investigating the performance hit of creating Cachedependency objects, so I wrote a very simple test program as follows: using System; using System.Collections.Generic; using System.Diagnostics; using System.Web.Caching; namespace Test { internal class Program { private static readonly string[] keys = new[] {"Abc"}; private static readonly int MaxIteration = 10000000; private static void Main(string[] args) { Debug.Print("first set"); test7(); test6(); test5(); test4(); test3(); test2(); Debug.Print("second set"); test2(); test3(); test4(); test5(); test6(); test7(); } private static void test2() { DateTime start = DateTime.Now; var list = new List<CacheDependency>(); for (int i = 0; i < MaxIteration; i++) { list.Add(new CacheDependency(null, keys)); } Debug.Print("test2 Time: " + (DateTime.Now - start)); } private static void test3() { DateTime start = DateTime.Now; var list = new List<Func<CacheDependency>>(); for (int i = 0; i < MaxIteration; i++) { list.Add(() => new CacheDependency(null, keys)); } Debug.Print("test3 Time: " + (DateTime.Now - start)); } private static void test4() { var p = new Program(); DateTime start = DateTime.Now; var list = new List<Func<CacheDependency>>(); for (int i = 0; i < MaxIteration; i++) { list.Add(p.GetDep); } Debug.Print("test4 Time: " + (DateTime.Now - start)); } private static void test5() { var p = new Program(); DateTime start = DateTime.Now; var list = new List<Func<CacheDependency>>(); for (int i = 0; i < MaxIteration; i++) { list.Add(() => { return p.GetDep(); }); } Debug.Print("test5 Time: " + (DateTime.Now - start)); } private static void test6() { DateTime start = DateTime.Now; var list = new List<Func<CacheDependency>>(); for (int i = 0; i < MaxIteration; i++) { list.Add(GetDepSatic); } Debug.Print("test6 Time: " + (DateTime.Now - start)); } private static void test7() { DateTime start = DateTime.Now; var list = new List<Func<CacheDependency>>(); for (int i = 0; i < MaxIteration; i++) { list.Add(() => { return GetDepSatic(); }); } Debug.Print("test7 Time: " + (DateTime.Now - start)); } private CacheDependency GetDep() { return new CacheDependency(null, keys); } private static CacheDependency GetDepSatic() { return new CacheDependency(null, keys); } } } But I can't understand why these result looks like this: first set test7 Time: 00:00:00.4840277 test6 Time: 00:00:02.2041261 test5 Time: 00:00:00.1910109 test4 Time: 00:00:03.1401796 test3 Time: 00:00:00.1820105 test2 Time: 00:00:08.5394884 second set test2 Time: 00:00:07.7324423 test3 Time: 00:00:00.1830105 test4 Time: 00:00:02.3561347 test5 Time: 00:00:00.1750100 test6 Time: 00:00:03.2941884 test7 Time: 00:00:00.1850106 In particular: 1. Why is test4 and test6 much slower than their delegate version? I also noticed that Resharper specifically has a comment on the delegate version suggesting change test5 and test7 to "Covert to method group". Which is the same as test4 and test6 but they're actually slower? 2. I don't seem a consistent performance difference when calling test4 and test6, shouldn't static calls to be always faster?

    Read the article

  • Windows Impersonation failed

    - by skprocks
    I am using following code to implement impersonation for the particular windows account,which is failing.Please help. using System.Security.Principal; using System.Runtime.InteropServices; public partial class Source_AddNewProduct : System.Web.UI.Page { [DllImport("advapi32.dll", SetLastError = true)] static extern bool LogonUser( string principal, string authority, string password, LogonSessionType logonType, LogonProvider logonProvider, out IntPtr token); [DllImport("kernel32.dll", SetLastError = true)] static extern bool CloseHandle(IntPtr handle); enum LogonSessionType : uint { Interactive = 2, Network, Batch, Service, NetworkCleartext = 8, NewCredentials } enum LogonProvider : uint { Default = 0, // default for platform (use this!) WinNT35, // sends smoke signals to authority WinNT40, // uses NTLM WinNT50 // negotiates Kerb or NTLM } //impersonation is used when user tries to upload an image to a network drive protected void btnPrimaryPicUpload_Click1(object sender, EventArgs e) { try { string mDocumentExt = string.Empty; string mDocumentName = string.Empty; HttpPostedFile mUserPostedFile = null; HttpFileCollection mUploadedFiles = null; string xmlPath = string.Empty; FileStream fs = null; StreamReader file; string modify; mUploadedFiles = HttpContext.Current.Request.Files; mUserPostedFile = mUploadedFiles[0]; if (mUserPostedFile.ContentLength >= 0 && Path.GetFileName(mUserPostedFile.FileName) != "") { mDocumentName = Path.GetFileName(mUserPostedFile.FileName); mDocumentExt = Path.GetExtension(mDocumentName); mDocumentExt = mDocumentExt.ToLower(); if (mDocumentExt != ".jpg" && mDocumentExt != ".JPG" && mDocumentExt != ".gif" && mDocumentExt != ".GIF" && mDocumentExt != ".jpeg" && mDocumentExt != ".JPEG" && mDocumentExt != ".tiff" && mDocumentExt != ".TIFF" && mDocumentExt != ".png" && mDocumentExt != ".PNG" && mDocumentExt != ".raw" && mDocumentExt != ".RAW" && mDocumentExt != ".bmp" && mDocumentExt != ".BMP" && mDocumentExt != ".TIF" && mDocumentExt != ".tif") { Page.RegisterStartupScript("select", "<script language=" + Convert.ToChar(34) + "VBScript" + Convert.ToChar(34) + "> MsgBox " + Convert.ToChar(34) + "Please upload valid picture file format" + Convert.ToChar(34) + " , " + Convert.ToChar(34) + "64" + Convert.ToChar(34) + " , " + Convert.ToChar(34) + "WFISware" + Convert.ToChar(34) + "</script>"); } else { int intDocLen = mUserPostedFile.ContentLength; byte[] imageBytes = new byte[intDocLen]; mUserPostedFile.InputStream.Read(imageBytes, 0, mUserPostedFile.ContentLength); //xmlPath = @ConfigurationManager.AppSettings["ImagePath"].ToString(); xmlPath = Server.MapPath("./../ProductImages/"); mDocumentName = Guid.NewGuid().ToString().Replace("-", "") + System.IO.Path.GetExtension(mUserPostedFile.FileName); //if (System.IO.Path.GetExtension(mUserPostedFile.FileName) == ".jpg") //{ //} //if (System.IO.Path.GetExtension(mUserPostedFile.FileName) == ".gif") //{ //} mUserPostedFile.SaveAs(xmlPath + mDocumentName); //Remove commenting till upto stmt xmlPath = "./../ProductImages/"; to implement impersonation byte[] bytContent; IntPtr token = IntPtr.Zero; WindowsImpersonationContext impersonatedUser = null; try { // Note: Credentials should be encrypted in configuration file bool result = LogonUser(ConfigurationManager.AppSettings["ServiceAccount"].ToString(), "ad-ent", ConfigurationManager.AppSettings["ServiceAccountPassword"].ToString(), LogonSessionType.Network, LogonProvider.Default, out token); if (result) { WindowsIdentity id = new WindowsIdentity(token); // Begin impersonation impersonatedUser = id.Impersonate(); mUserPostedFile.SaveAs(xmlPath + mDocumentName); } else { throw new Exception("Identity impersonation has failed."); } } catch { throw; } finally { // Stop impersonation and revert to the process identity if (impersonatedUser != null) impersonatedUser.Undo(); // Free the token if (token != IntPtr.Zero) CloseHandle(token); } xmlPath = "./../ProductImages/"; xmlPath = xmlPath + mDocumentName; string o_image = xmlPath; //For impersoantion uncomment this line and comment next line //string o_image = "../ProductImages/" + mDocumentName; ViewState["masterImage"] = o_image; //fs = new FileStream(xmlPath, FileMode.Open, FileAccess.Read); //file = new StreamReader(fs, Encoding.UTF8); //modify = file.ReadToEnd(); //file.Close(); //commented by saurabh kumar 28may'09 imgImage.Visible = true; imgImage.ImageUrl = ViewState["masterImage"].ToString(); img_Label1.Visible = false; } //e.Values["TemplateContent"] = modify; //e.Values["TemplateName"] = mDocumentName.Replace(".xml", ""); } } catch (Exception ex) { ExceptionUtil.UI(ex); Response.Redirect("errorpage.aspx"); } } } The code on execution throws system.invalidoperation exception.I have provided full control to destination folder to the windows service account that i am impersonating.

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • How to determine whether a class has a particular templated member function?

    - by Aozine
    I was wondering if it's possible to extend the SFINAE approach to detecting whether a class has a certain member function (as discussed here: "Is there a Technique in C++ to know if a class has a member function of a given signature?" http://stackoverflow.com/questions/87372/is-there-a-technique-in-c-to-know-if-a-class-has-a-member-function-of-a-given-s ) to support templated member functions? E.g. to be able to detect the function foo in the following class: struct some_class { template < int _n > void foo() { } }; I thought it might be possible to do this for a particular instantiation of foo, (e.g. check to see if void foo< 5 >() is a member) as follows: template < typename _class, int _n > class foo_int_checker { template < typename _t, void (_t::*)() > struct sfinae { }; template < typename _t > static big test( sfinae< _t, &_t::foo< _n > > * ); template < typename _t > static small test( ... ); public: enum { value = sizeof( test< _class >( 0 ) ) == sizeof( big ) }; }; Then do foo_int_checker< some_class, 5 >::value to check whether some_class has the member void foo< 5 >(). However on MSVC++ 2008 this always returns false while g++ gives the following syntax errors at the line test( sfinae< _t, &_t::foo< _n > > ); test.cpp:24: error: missing `>' to terminate the template argument list test.cpp:24: error: template argument 2 is invalid test.cpp:24: error: expected unqualified-id before '<' token test.cpp:24: error: expected `,' or `...' before '<' token test.cpp:24: error: ISO C++ forbids declaration of `parameter' with no type Both seem to fail because I'm trying to get the address of a template function instantiation from a type that is itself a template parameter. Does anyone know whether this is possible or if it's disallowed by the standard for some reason? EDIT: It seems that I missed out the ::template syntax to get g++ to compile the above code correctly. If I change the bit where I get the address of the function to &_t::template foo< _n > then the program compiles, but I get the same behaviour as MSVC++ (value is always set to false). If I comment out the ... overload of test to force the compiler to pick the other one, I get the following compiler error in g++: test.cpp: In instantiation of `foo_int_checker<A, 5>': test.cpp:40: instantiated from here test.cpp:32: error: invalid use of undefined type `class foo_int_checker<A, 5>' test.cpp:17: error: declaration of `class foo_int_checker<A, 5>' test.cpp:32: error: enumerator value for `value' not integer constant where line 32 is the enum { value = sizeof( test< _class >( 0 ) ) == sizeof( big ) }; line. Unfortunately this doesn't seem to help me diagnose the problem :(. MSVC++ gives a similar nondescript error: error C2770: invalid explicit template argument(s) for 'clarity::meta::big checker<_checked_type>::test(checker<_checked_type>::sfinae<_t,&_t::template foo<5>> *)' on the same line. What's strange is that if I get the address from a specific class and not a template parameter (i.e. rather than &_t::template foo< _n > I do &some_class::template foo< _n >) then I get the correct result, but then my checker class is limited to checking a single class (some_class) for the function. Also, if I do the following: template < typename _t, void (_t::*_f)() > void f0() { } template < typename _t > void f1() { f0< _t, &_t::template foo< 5 > >(); } and call f1< some_class >() then I DON'T get a compile error on &_t::template foo< 5 >. This suggests that the problem only arises when getting the address of a templated member function from a type that is itself a template parameter while in a SFINAE context. Argh!

    Read the article

  • Test of procedure is fine but when called from a menu gives uninitialized errors. C

    - by Delfic
    The language is portuguese, but I think you get the picture. My main calls only the menu function (the function in comment is the test which works). In the menu i introduce the option 1 which calls the same function. But there's something wrong. If i test it solely on the input: (1/1)x^2 //it reads the polinomyal (2/1) //reads the rational and returns 4 (you can guess what it does, calculates the value of an instace of x over a rational) My polinomyals are linear linked lists with a coeficient (rational) and a degree (int) int main () { menu_interactivo (); // instanciacao (); return 0; } void menu_interactivo(void) { int i; do{ printf("1. Instanciacao de um polinomio com um escalar\n"); printf("2. Multiplicacao de um polinomio por um escalar\n"); printf("3. Soma de dois polinomios\n"); printf("4. Multiplicacao de dois polinomios\n"); printf("5. Divisao de dois polinomios\n"); printf("0. Sair\n"); scanf ("%d", &i); switch (i) { case 0: exit(0); break; case 1: instanciacao (); break; case 2: multiplicacao_esc (); break; case 3: somar_pol (); break; case 4: multiplicacao_pol (); break; case 5: divisao_pol (); break; default:printf("O numero introduzido nao e valido!\n"); } } while (i != 0); } When i call it with the menu, with the same input, it does not stop reading the polinomyal (I know this because it does not ask me for the rational as on the other example) I've run it with valgrind --track-origins=yes returning the following: ==17482== Memcheck, a memory error detector ==17482== Copyright (C) 2002-2009, and GNU GPL'd, by Julian Seward et al. ==17482== Using Valgrind-3.5.0 and LibVEX; rerun with -h for copyright info ==17482== Command: ./teste ==17482== 1. Instanciacao de um polinomio com um escalar 2. Multiplicacao de um polinomio por um escalar 3. Soma de dois polinomios 4. Multiplicacao de dois polinomios 5. Divisao de dois polinomios 0. Sair 1 Introduza um polinomio na forma (n0/d0)x^e0 + (n1/d1)x^e1 + ... + (nk/dk)^ek, com ei > e(i+1): (1/1)x^2 ==17482== Conditional jump or move depends on uninitialised value(s) ==17482== at 0x401126: simplifica_f (fraccoes.c:53) ==17482== by 0x4010CB: le_f (fraccoes.c:30) ==17482== by 0x400CDA: le_pol (polinomios.c:156) ==17482== by 0x400817: instanciacao (t4.c:14) ==17482== by 0x40098C: menu_interactivo (t4.c:68) ==17482== by 0x4009BF: main (t4.c:86) ==17482== Uninitialised value was created by a stack allocation ==17482== at 0x401048: le_f (fraccoes.c:19) ==17482== ==17482== Conditional jump or move depends on uninitialised value(s) ==17482== at 0x400D03: le_pol (polinomios.c:163) ==17482== by 0x400817: instanciacao (t4.c:14) ==17482== by 0x40098C: menu_interactivo (t4.c:68) ==17482== by 0x4009BF: main (t4.c:86) ==17482== Uninitialised value was created by a stack allocation ==17482== at 0x401048: le_f (fraccoes.c:19) ==17482== I will now give you the functions which are called void le_pol (pol *p) { fraccao f; int e; char c; printf ("Introduza um polinomio na forma (n0/d0)x^e0 + (n1/d1)x^e1 + ... + (nk/dk)^ek,\n"); printf("com ei > e(i+1):\n"); *p = NULL; do { le_f (&f); getchar(); getchar(); scanf ("%d", &e); if (f.n != 0) *p = add (*p, f, e); c = getchar (); if (c != '\n') { getchar(); getchar(); } } while (c != '\n'); } void instanciacao (void) { pol p1; fraccao f; le_pol (&p1); printf ("Insira uma fraccao na forma (n/d):\n"); le_f (&f); escreve_f(inst_esc_pol(p1, f)); } void le_f (fraccao *f) { int n, d; getchar (); scanf ("%d", &n); getchar (); scanf ("%d", &d); getchar (); assert (d != 0); *f = simplifica_f(cria_f(n, d)); } simplifica_f simplifies a rational and cria_f creates a rationa given the numerator and the denominator Can someone help me please? Thanks in advance. If you want me to provide some tests, just post it. See ya.

    Read the article

  • Is there a better way to avoid an infinite loop using winforms?

    - by Hamish Grubijan
    I am using .Net 3.5 for now. Right now I am using a using trick to disable and enable events around certain sections of code. The user can change either days, hours, minutes or total minutes, and that should not cause an infinite cascade of events (e.g. minutes changing total, total changing minutes, etc.) While the code does what I want, there might be a better / more straight-forward way. Do you know of any? For brawny points: This control will be used by multiple teams - I do not want to make it embarrassing. I suspect that I do not need to reinvent the wheel when defining hours in a day, days in week, etc. Some other standard .Net library out there must have it. Any other remarks regarding code? This using (EventHacker.DisableEvents(this)) business - that must be a common pattern in .Net ... changing the setting temporarily. What is the name of it? I'd like to be able to refer to it in a comment and also read up more on current implementations. In the general case not only a handle to the thing being changed needs to be remembered, but also the previous state (in this case previous state does not matter - events are turned on and off unconditionally). Then there is also a possibility of multi-threaded hacking. One could also utilize generics to make the code arguably cleaner. Figuring all this out can lead to a multi-page blog post. I'd be happy to hear some of the answers. P.S. Does it seem like I suffer from obsessive compulsive disorder? Some people like to get things finished and move on; I like to keep them open ... there is always a better way. // Corresponding Designer class is omitted. using System; using System.Windows.Forms; namespace XYZ // Real name masked { interface IEventHackable { void EnableEvents(); void DisableEvents(); } public partial class PollingIntervalGroupBox : GroupBox, IEventHackable { private const int DAYS_IN_WEEK = 7; private const int MINUTES_IN_HOUR = 60; private const int HOURS_IN_DAY = 24; private const int MINUTES_IN_DAY = MINUTES_IN_HOUR * HOURS_IN_DAY; private const int MAX_TOTAL_DAYS = 100; private static readonly decimal MIN_TOTAL_NUM_MINUTES = 1; // Anything faster than once per minute can bog down our servers. private static readonly decimal MAX_TOTAL_NUM_MINUTES = (MAX_TOTAL_DAYS * MINUTES_IN_DAY) - 1; // 99 days should be plenty. // The value above was chosen so to not cause an overflow exception. // Watch out for it - numericUpDownControls each have a MaximumValue setting. public PollingIntervalGroupBox() { InitializeComponent(); InitializeComponentCustom(); } private void InitializeComponentCustom() { this.m_upDownDays.Maximum = MAX_TOTAL_DAYS - 1; this.m_upDownHours.Maximum = HOURS_IN_DAY - 1; this.m_upDownMinutes.Maximum = MINUTES_IN_HOUR - 1; this.m_upDownTotalMinutes.Maximum = MAX_TOTAL_NUM_MINUTES; this.m_upDownTotalMinutes.Minimum = MIN_TOTAL_NUM_MINUTES; } private void m_upDownTotalMinutes_ValueChanged(object sender, EventArgs e) { setTotalMinutes(this.m_upDownTotalMinutes.Value); } private void m_upDownDays_ValueChanged(object sender, EventArgs e) { updateTotalMinutes(); } private void m_upDownHours_ValueChanged(object sender, EventArgs e) { updateTotalMinutes(); } private void m_upDownMinutes_ValueChanged(object sender, EventArgs e) { updateTotalMinutes(); } private void updateTotalMinutes() { this.setTotalMinutes( MINUTES_IN_DAY * m_upDownDays.Value + MINUTES_IN_HOUR * m_upDownHours.Value + m_upDownMinutes.Value); } public decimal TotalMinutes { get { return m_upDownTotalMinutes.Value; } set { m_upDownTotalMinutes.Value = value; } } public decimal TotalHours { set { setTotalMinutes(value * MINUTES_IN_HOUR); } } public decimal TotalDays { set { setTotalMinutes(value * MINUTES_IN_DAY); } } public decimal TotalWeeks { set { setTotalMinutes(value * DAYS_IN_WEEK * MINUTES_IN_DAY); } } private void setTotalMinutes(decimal nTotalMinutes) { if (nTotalMinutes < MIN_TOTAL_NUM_MINUTES) { setTotalMinutes(MIN_TOTAL_NUM_MINUTES); return; // Must be carefull with recursion. } if (nTotalMinutes > MAX_TOTAL_NUM_MINUTES) { setTotalMinutes(MAX_TOTAL_NUM_MINUTES); return; // Must be carefull with recursion. } using (EventHacker.DisableEvents(this)) { // First set the total minutes this.m_upDownTotalMinutes.Value = nTotalMinutes; // Then set the rest this.m_upDownDays.Value = (int)(nTotalMinutes / MINUTES_IN_DAY); nTotalMinutes = nTotalMinutes % MINUTES_IN_DAY; // variable reuse. this.m_upDownHours.Value = (int)(nTotalMinutes / MINUTES_IN_HOUR); nTotalMinutes = nTotalMinutes % MINUTES_IN_HOUR; this.m_upDownMinutes.Value = nTotalMinutes; } } // Event magic public void EnableEvents() { this.m_upDownTotalMinutes.ValueChanged += this.m_upDownTotalMinutes_ValueChanged; this.m_upDownDays.ValueChanged += this.m_upDownDays_ValueChanged; this.m_upDownHours.ValueChanged += this.m_upDownHours_ValueChanged; this.m_upDownMinutes.ValueChanged += this.m_upDownMinutes_ValueChanged; } public void DisableEvents() { this.m_upDownTotalMinutes.ValueChanged -= this.m_upDownTotalMinutes_ValueChanged; this.m_upDownDays.ValueChanged -= this.m_upDownDays_ValueChanged; this.m_upDownHours.ValueChanged -= this.m_upDownHours_ValueChanged; this.m_upDownMinutes.ValueChanged -= this.m_upDownMinutes_ValueChanged; } // We give as little info as possible to the 'hacker'. private sealed class EventHacker : IDisposable { IEventHackable _hackableHandle; public static IDisposable DisableEvents(IEventHackable hackableHandle) { return new EventHacker(hackableHandle); } public EventHacker(IEventHackable hackableHandle) { this._hackableHandle = hackableHandle; this._hackableHandle.DisableEvents(); } public void Dispose() { this._hackableHandle.EnableEvents(); } } } }

    Read the article

  • Android: who can help me with setting up this google maps class please??

    - by Capsud
    Hi, Firstly this has turned out to be quite a long post so please bear with me as its not too difficult but you may need to clarify something with me if i haven't explained it correctly. So with some help the other day from guys on this forum, i managed to partially set up my 'mapClass' class, but i'm having trouble with it and its not running correctly so i would like some help if possible. I will post the code below so you can see. What Ive got is a 'Dundrum' class which sets up the listView for an array of items. Then ive got a 'dundrumSelector' class which I use to set up the setOnClickListener() methods on the listItems and link them to their correct views. DundrumSelector class.. public static final int BUTTON1 = R.id.anandaAddressButton; public static final int BUTTON2 = R.id.bramblesCafeAddressButton; public static final int BUTTON3 = R.id.brannigansAddressButton; public void onCreate(Bundle savedInstanceState){ super.onCreate(savedInstanceState); int position = getIntent().getExtras().getInt("position"); if(position == 0){ setContentView(R.layout.ananda); }; if(position == 1){ setContentView(R.layout.bramblescafe); }; if(position == 2){ setContentView(R.layout.brannigans); Button anandabutton = (Button) findViewById(R.id.anandaAddressButton); anandabutton.setOnClickListener(new View.OnClickListener() { public void onClick(View view) { Intent myIntent = new Intent(view.getContext(),MapClass.class); myIntent.putExtra("button", BUTTON1); startActivityForResult(myIntent,0); } }); Button bramblesbutton = (Button) findViewById(R.id.bramblesCafeAddressButton); bramblesbutton.setOnClickListener(new View.OnClickListener() { public void onClick(View view) { Intent myIntent = new Intent(view.getContext(),MapClass.class); myIntent.putExtra("button", BUTTON2); startActivityForResult(myIntent, 0); } }); etc etc.... Then what i did was set up static ints to represent the buttons which you can see at the top of this class, the reason for this is because in my mapClass activity I just want to have one method, because the only thing that is varying is the coordinates to each location. ie. i dont want to have 100+ map classes essentially doing the same thing other than different coordinates into the method. So my map class is as follows... case DundrumSelector.BUTTON1: handleCoordinates("53.288719","-6.241179"); break; case DundrumSelector.BUTTON2: handleCoordinates("53.288719","-6.241179"); break; case DundrumSelector.BUTTON3: handleCoordinates("53.288719","-6.241179"); break; } } private void handleCoordinates(String l, String b){ mapView = (MapView) findViewById(R.id.mapView); LinearLayout zoomLayout = (LinearLayout)findViewById(R.id.zoom); View zoomView = mapView.getZoomControls(); zoomLayout.addView(zoomView, new LinearLayout.LayoutParams( LayoutParams.WRAP_CONTENT, LayoutParams.WRAP_CONTENT)); mapView.displayZoomControls(true); mc = mapView.getController(); String coordinates[] = {l, b}; double lat = Double.parseDouble(coordinates[0]); double lng = Double.parseDouble(coordinates[1]); p = new GeoPoint( (int) (lat*1E6), (int) (lng*1E6)); mc.animateTo(p); mc.setZoom(17); mapView.invalidate(); } Now this is where my problem is. The onClick() events don't even work from the listView to get into the correct views. I have to comment out the methods in 'DundrumSelector' before I can get into their views. And this is what I dont understand, firstly why wont the onClick() events work, because its not even on that next view where the map is. I know this is a very long post and it might be quite confusing so let me know if you want any clarification.. Just to recap, what i'm trying to do is just have one class that sets up the map coordinates, like what i'm trying to do in my 'mapClass'. Please can someone help or suggest another way of doing this! Thanks alot everyone for reading this.

    Read the article

  • Why is .NET faster than C++ in this case?

    - by acidzombie24
    -edit- I LOVE SLaks comment. "The amount of misinformation in these answers is staggering." :D Calm down guys. Pretty much all of you were wrong. I DID make optimizations. It turns out whatever optimizations I made wasn't good enough. I ran the code in GCC using gettimeofday (I'll paste code below) and used g++ -O2 file.cpp and got slightly faster results then C#. Maybe MS didn't create the optimizations needed in this specific case but after downloading and installing mingw I was tested and found the speed to be near identical. Justicle Seems to be right. I could have sworn I use clock on my PC and used that to count and found it was slower but problem solved. C++ speed isn't almost twice as slower in the MS compiler. When my friend informed me of this I couldn't believe it. So I took his code and put some timers onto it. Instead of Boo I used C#. I constantly got faster results in C#. Why? The .NET version was nearly half the time no matter what number I used. C++ version: #include <iostream> #include <stdio.h> #include <intrin.h> #include <windows.h> using namespace std; int fib(int n) { if (n < 2) return n; return fib(n - 1) + fib(n - 2); } int main() { __int64 time = 0xFFFFFFFF; while (1) { int n; //cin >> n; n = 41; if (n < 0) break; __int64 start = __rdtsc(); int res = fib(n); __int64 end = __rdtsc(); cout << res << endl; cout << (float)(end-start)/1000000<<endl; break; } return 0; } C# version: using System; using System.Collections.Generic; using System.Linq; using System.Text; using System.Runtime.InteropServices; using System.ComponentModel; using System.Threading; using System.IO; using System.Diagnostics; namespace fibCSTest { class Program { static int fib(int n) { if (n < 2)return n; return fib(n - 1) + fib(n - 2); } static void Main(string[] args) { //var sw = new Stopwatch(); //var timer = new PAB.HiPerfTimer(); var timer = new Stopwatch(); while (true) { int n; //cin >> n; n = 41; if (n < 0) break; timer.Start(); int res = fib(n); timer.Stop(); Console.WriteLine(res); Console.WriteLine(timer.ElapsedMilliseconds); break; } } } } GCC version: #include <iostream> #include <stdio.h> #include <sys/time.h> using namespace std; int fib(int n) { if (n < 2) return n; return fib(n - 1) + fib(n - 2); } int main() { timeval start, end; while (1) { int n; //cin >> n; n = 41; if (n < 0) break; gettimeofday(&start, 0); int res = fib(n); gettimeofday(&end, 0); int sec = end.tv_sec - start.tv_sec; int usec = end.tv_usec - start.tv_usec; cout << res << endl; cout << sec << " " << usec <<endl; break; } return 0; }

    Read the article

  • Watching setTimeout loops so that only one is running at a time.

    - by DA
    I'm creating a content rotator in jQuery. 5 items total. Item 1 fades in, pauses 10 seconds, fades out, then item 2 fades in. Repeat. Simple enough. Using setTimeout I can call a set of functions that create a loop and will repeat the process indefinitely. I now want to add the ability to interrupt this rotator at any time by clicking on a navigation element to jump directly to one of the content items. I originally started going down the path of pinging a variable constantly (say every half second) that would check to see if a navigation element was clicked and, if so, abandon the loop, then restart the loop based on the item that was clicked. The challenge I ran into was how to actually ping a variable via a timer. The solution is to dive into JavaScript closures...which are a little over my head but definitely something I need to delve into more. However, in the process of that, I came up with an alternative option that actually seems to be better performance-wise (theoretically, at least). I have a sample running here: http://jsbin.com/uxupi/14 (It's using console.log so have fireBug running) Sample script: $(document).ready(function(){ var loopCount = 0; $('p#hello').click(function(){ loopCount++; doThatThing(loopCount); }) function doThatOtherThing(currentLoopCount) { console.log('doThatOtherThing-'+currentLoopCount); if(currentLoopCount==loopCount){ setTimeout(function(){doThatThing(currentLoopCount)},5000) } } function doThatThing(currentLoopCount) { console.log('doThatThing-'+currentLoopCount); if(currentLoopCount==loopCount){ setTimeout(function(){doThatOtherThing(currentLoopCount)},5000); } } }) The logic being that every click of the trigger element will kick off the loop passing into itself a variable equal to the current value of the global variable. That variable gets passed back and forth between the functions in the loop. Each click of the trigger also increments the global variable so that subsequent calls of the loop have a unique local variable. Then, within the loop, before the next step of each loop is called, it checks to see if the variable it has still matches the global variable. If not, it knows that a new loop has already been activated so it just ends the existing loop. Thoughts on this? Valid solution? Better options? Caveats? Dangers? UPDATE: I'm using John's suggestion below via the clearTimeout option. However, I can't quite get it to work. The logic is as such: var slideNumber = 0; var timeout = null; function startLoop(slideNumber) { ...do stuff here to set up the slide based on slideNumber... slideFadeIn() } function continueCheck(){ if (timeout != null) { // cancel the scheduled task. clearTimeout(timeout); timeout = null; return false; }else{ return true; } }; function slideFadeIn() { if (continueCheck){ // a new loop hasn't been called yet so proceed... // fade in the LI $currentListItem.fadeIn(fade, function() { if(multipleFeatures){ timeout = setTimeout(slideFadeOut,display); } }); }; function slideFadeOut() { if (continueLoop){ // a new loop hasn't been called yet so proceed... slideNumber=slideNumber+1; if(slideNumber==features.length) { slideNumber = 0; }; timeout = setTimeout(function(){startLoop(slideNumber)},100); }; startLoop(slideNumber); The above kicks of the looping. I then have navigation items that, when clicked, I want the above loop to stop, then restart with a new beginning slide: $(myNav).click(function(){ clearTimeout(timeout); timeout = null; startLoop(thisItem); }) If I comment out 'startLoop...' from the click event, it, indeed, stops the initial loop. However, if I leave that last line in, it doesn't actually stop the initial loop. Why? What happens is that both loops seem to run in parallel for a period. So, when I click my navigation, clearTimeout is called, which clears it.

    Read the article

  • How to compare a memory bits in C++?

    - by Trunet
    Hi, I need help with a memory bit comparison function. I bought a LED Matrix here with 4 x HT1632C chips and I'm using it on my arduino mega2560. There're no code available for this chipset(it's not the same as HT1632) and I'm writing on my own. I have a plot function that get x,y coordinates and a color and that pixel turn on. Only this is working perfectly. But I need more performance on my display so I tried to make a shadowRam variable that is a "copy" of my device memory. Before I plot anything on display it checks on shadowRam to see if it's really necessary to change that pixel. When I enabled this(getShadowRam) on plot function my display has some, just SOME(like 3 or 4 on entire display) ghost pixels(pixels that is not supposed to be turned on). If I just comment the prev_color if's on my plot function it works perfectly. Also, I'm cleaning my shadowRam array setting all matrix to zero. variables: #define BLACK 0 #define GREEN 1 #define RED 2 #define ORANGE 3 #define CHIP_MAX 8 byte shadowRam[63][CHIP_MAX-1] = {0}; getShadowRam function: byte HT1632C::getShadowRam(byte x, byte y) { byte addr, bitval, nChip; if (x>=32) { nChip = 3 + x/16 + (y>7?2:0); } else { nChip = 1 + x/16 + (y>7?2:0); } bitval = 8>>(y&3); x = x % 16; y = y % 8; addr = (x<<1) + (y>>2); if ((shadowRam[addr][nChip-1] & bitval) && (shadowRam[addr+32][nChip-1] & bitval)) { return ORANGE; } else if (shadowRam[addr][nChip-1] & bitval) { return GREEN; } else if (shadowRam[addr+32][nChip-1] & bitval) { return RED; } else { return BLACK; } } plot function: void HT1632C::plot (int x, int y, int color) { if (x<0 || x>X_MAX || y<0 || y>Y_MAX) return; if (color != BLACK && color != GREEN && color != RED && color != ORANGE) return; char addr, bitval; byte nChip; byte prev_color = HT1632C::getShadowRam(x,y); bitval = 8>>(y&3); if (x>=32) { nChip = 3 + x/16 + (y>7?2:0); } else { nChip = 1 + x/16 + (y>7?2:0); } x = x % 16; y = y % 8; addr = (x<<1) + (y>>2); switch(color) { case BLACK: if (prev_color != BLACK) { // compare with memory to only set if pixel is other color // clear the bit in both planes; shadowRam[addr][nChip-1] &= ~bitval; HT1632C::sendData(nChip, addr, shadowRam[addr][nChip-1]); shadowRam[addr+32][nChip-1] &= ~bitval; HT1632C::sendData(nChip, addr+32, shadowRam[addr+32][nChip-1]); } break; case GREEN: if (prev_color != GREEN) { // compare with memory to only set if pixel is other color // set the bit in the green plane and clear the bit in the red plane; shadowRam[addr][nChip-1] |= bitval; HT1632C::sendData(nChip, addr, shadowRam[addr][nChip-1]); shadowRam[addr+32][nChip-1] &= ~bitval; HT1632C::sendData(nChip, addr+32, shadowRam[addr+32][nChip-1]); } break; case RED: if (prev_color != RED) { // compare with memory to only set if pixel is other color // clear the bit in green plane and set the bit in the red plane; shadowRam[addr][nChip-1] &= ~bitval; HT1632C::sendData(nChip, addr, shadowRam[addr][nChip-1]); shadowRam[addr+32][nChip-1] |= bitval; HT1632C::sendData(nChip, addr+32, shadowRam[addr+32][nChip-1]); } break; case ORANGE: if (prev_color != ORANGE) { // compare with memory to only set if pixel is other color // set the bit in both the green and red planes; shadowRam[addr][nChip-1] |= bitval; HT1632C::sendData(nChip, addr, shadowRam[addr][nChip-1]); shadowRam[addr+32][nChip-1] |= bitval; HT1632C::sendData(nChip, addr+32, shadowRam[addr+32][nChip-1]); } break; } } If helps: The datasheet of board I'm using. On page 7 has the memory mapping I'm using. Also, I have a video of display working.

    Read the article

  • How should I delete a child object from within a parent's slot? Possibly boost::asio specific.

    - by kaliatech
    I have written a network server class that maintains a std::set of network clients. The network clients emit a signal to the network server on disconnect (via boost::bind). When a network client disconnects, the client instance needs to be removed from the Set and eventually deleted. I would think this is a common pattern, but I am having problems that might, or might not, be specific to ASIO. I've tried to trim down to just the relevant code: /** NetworkServer.hpp **/ class NetworkServices : private boost::noncopyable { public: NetworkServices(void); ~NetworkServices(void); private: void run(); void onNetworkClientEvent(NetworkClientEvent&); private: std::set<boost::shared_ptr<const NetworkClient>> clients; }; /** NetworkClient.cpp **/ void NetworkServices::run() { running = true; boost::asio::io_service::work work(io_service); //keeps service running even if no operations // This creates just one thread for the boost::asio async network services boost::thread iot(boost::bind(&NetworkServices::run_io_service, this)); while (running) { boost::system::error_code err; try { tcp::socket* socket = new tcp::socket(io_service); acceptor->accept(*socket, err); if (!err) { NetworkClient* networkClient = new NetworkClient(io_service, boost::shared_ptr<tcp::socket>(socket)); networkClient->networkClientEventSignal.connect(boost::bind(&NetworkServices::onNetworkClientEvent, this, _1)); clients.insert(boost::shared_ptr<NetworkClient>(networkClient)); networkClient->init(); //kicks off 1st asynch_read call } } // etc... } } void NetworkServices::onNetworkClientEvent(NetworkClientEvent& evt) { switch(evt.getType()) { case NetworkClientEvent::CLIENT_ERROR : { boost::shared_ptr<const NetworkClient> clientPtr = evt.getClient().getSharedPtr(); // ------ THIS IS THE MAGIC LINE ----- // If I keep this, the io_service hangs. If I comment it out, // everything works fine (but I never delete the disconnected NetworkClient). // If actually deleted the client here I might expect problems because it is the caller // of this method via boost::signal and bind. However, The clientPtr is a shared ptr, and a // reference is being kept in the client itself while signaling, so // I would the object is not going to be deleted from the heap here. That seems to be the case. // Never-the-less, this line makes all the difference, most likely because it controls whether or not the NetworkClient ever gets deleted. clients.erase(clientPtr); //I should probably put this socket clean-up in NetworkClient destructor. Regardless by doing this, // I would expect the ASIO socket stuff to be adequately cleaned-up after this. tcp::socket& socket = clientPtr->getSocket(); try { socket.shutdown(boost::asio::socket_base::shutdown_both); socket.close(); } catch(...) { CommServerContext::error("Error while shutting down and closing socket."); } break; } default : { break; } } } /** NetworkClient.hpp **/ class NetworkClient : public boost::enable_shared_from_this<NetworkClient>, Client { NetworkClient(boost::asio::io_service& io_service, boost::shared_ptr<tcp::socket> socket); virtual ~NetworkClient(void); inline boost::shared_ptr<const NetworkClient> getSharedPtr() const { return shared_from_this(); }; boost::signal <void (NetworkClientEvent&)> networkClientEventSignal; void onAsyncReadHeader(const boost::system::error_code& error, size_t bytes_transferred); }; /** NetworkClient.cpp - onAsyncReadHeader method called from io_service.run() thread as result of an async_read operation. Error condition usually result of an unexpected client disconnect.**/ void NetworkClient::onAsyncReadHeader( const boost::system::error_code& error, size_t bytes_transferred) { if (error) { //Make sure this instance doesn't get deleted from parent/slot deferencing //Alternatively, somehow schedule for future delete? boost::shared_ptr<const NetworkClient> clientPtr = getSharedPtr(); //Signal to service that this client is disconnecting NetworkClientEvent evt(*this, NetworkClientEvent::CLIENT_ERROR); networkClientEventSignal(evt); networkClientEventSignal.disconnect_all_slots(); return; } I believe it's not safe to delete the client from within the slot handler because the function return would be ... undefined? (Interestingly, it doesn't seem to blow up on me though.) So I've used boost:shared_ptr along with shared_from_this to make sure the client doesn't get deleted until all slots have been signaled. It doesn't seem to really matter though. I believe this question is not specific to ASIO, but the problem manifests in a peculiar way when using ASIO. I have one thread executing io_service.run(). All ASIO read/write operations are performed asynchronously. Everything works fine with multiple clients connecting/disconnecting UNLESS I delete my client object from the Set per the code above. If I delete my client object, the io_service seemingly deadlocks internally and no further asynchronous operations are performed unless I start another thread. I have try/catches around the io_service.run() call and have not been able to detect any errors. Questions: Are there best practices for deleting child objects, that are also signal emitters, from within parent slots? Any ideas as to why the io_service is hanging when I delete my network client object?

    Read the article

  • Find inner arrays in nested arrays

    - by 50ndr33
    I have a nested array in PHP: array ( '0' => "+5x", '1' => array ( '0' => "+", '1' => "(", '2' => "+3", '3' => array ( '0' => "+", '1' => "(", '2' => array ( // I want to find this one. '0' => "+", '1' => "(", '2' => "+5", '3' => "-3", '4' => ")" ), '3' => "-3", '4' => ")" ), '4' => ")" ) ); I need to process the innermost arrays here, the one with the comment: "I want to find this one." Is there a function for that? I have thought about doing (written as an idea, not as correct PHP): foreach ($array as $id => $value) { if ($value is array) { $name = $id; foreach ($array[$id] as $id_2 => $value_2) { if ($value_2 is array) { $name .= "." . $id_2; foreach ($array[$id][$id_2] as $id_3 => $value_3) { if ($value_3 is array) { $name .= "." . $id_3; foreach ($array[$id][$id_2][$id_3] as $id_4 => $value_4) { if ($value_4 is array) { $name .= "." . $id_4; foreach [and so it goes on]; } else { $listOfInnerArrays[] = $name; break; } } } else { $listOfInnerArrays[] = $name; break; } } } else { $listOfInnerArrays[] = $name; break; } } } } So what it does is it makes $name the current key in the array. If the value is an array, it goes into it with foreach and adds "." and the id of the array. So we would in the example array end up with: array ( '0' => "1.3.2", ) Then I can process those values to access the innner arrays. The problem is that the array that I'm trying to find the inner arrays of is dynamic and made of a user input. (It splits an input string where it finds + or -, and puts it in a separate nested array if it contains brackets. So if the user types a lot of brackets, there will be a lot of nested arrays.) Therefore I need to make this pattern go for 20 times down, and still it will only catch 20 nested arrays no matter what. Is there a function for that, again? Or is there a way to make it do this without my long code? Maybe make a loop make the necessary number of the foreach pattern and run it through eval()? Long answer to J. Bruni: <?php $liste = array ( '0' => "+5x", '1' => array ( '0' => "+", '1' => "(", '2' => "+3", '3' => array ( '0' => "+", '1' => "(", '2' => array ( '0' => "+", '1' => "(", '2' => "+5", '3' => "-3", '4' => ")" ), '3' => "-3", '4' => ")" ), '4' => ")" ) ); function find_deepest( $item, $key ) { echo "0"; if ( !is_array( $item ) ) return false; foreach( $item as $sub_item ) { if ( is_array( $sub_item ) ) return false; } echo "1"; print_r( $item ); return true; } array_walk_recursive( $liste, 'find_deepest' ); echo "<pre>"; print_r($liste); ?> I wrote echo 0 and 1 to see what the script did, and here is the output: 00000000000000 Array ( [0] => +5x [1] => Array ( [0] => + [1] => ( [2] => +3 [3] => Array ( [0] => + [1] => ( [2] => Array ( [0] => + [1] => ( [2] => +5 [3] => -3 [4] => ) ) [3] => -3 [4] => ) ) [4] => ) ) )

    Read the article

< Previous Page | 197 198 199 200 201 202 203 204 205 206  | Next Page >