Search Results

Search found 5205 results on 209 pages for 'extra'.

Page 204/209 | < Previous Page | 200 201 202 203 204 205 206 207 208 209  | Next Page >

  • CodePlex Daily Summary for Wednesday, November 06, 2013

    CodePlex Daily Summary for Wednesday, November 06, 2013Popular ReleasesWin_8 (??? Devel Studio 2 ??? 3): Win8 0.8 + Sample (.dvs): ???????------------------------------------------ 1. ????????? ??????????? ????????? ??????. 2. ?????????? ???? , ????????? ? ?????????? ???? ????. 3. ?????????? ?????? ??????. 4. ?????????? ????????? ???????????. 5. ????????????? ??? . English----------------------------------------------------------------------- 1. Added ability to load icons. 2. Fixed bugs related to obtaining names of shapes. 3. Fixed a memory leak. 4. Fixed some defects. 5. Optimized code. ---------------------------...NWTCompiler: NWTCompiler v2.4.0: This version fixes a bug with Pinyin and adds support for the 2013 English NWT.ConEmu - Windows console with tabs: ConEmu 131105 [Alpha]: ConEmu - developer build x86 and x64 versions. Written in C++, no additional packages required. Run "ConEmu.exe" or "ConEmu64.exe". Some useful information you may found: http://superuser.com/questions/tagged/conemu http://code.google.com/p/conemu-maximus5/wiki/ConEmuFAQ http://code.google.com/p/conemu-maximus5/wiki/TableOfContents If you want to use ConEmu in portable mode, just create empty "ConEmu.xml" file near to "ConEmu.exe"CS-Script for Notepad++ (C# intellisense and code execution): Release v1.0.9.0: Implemented Recent Scripts list Added checking for plugin updates from AboutBox Multiple formatting improvements/fixes Implemented selection of the CLR version when preparing distribution package Added project panel button for showing plugin shortcuts list Added 'What's New?' panel Fixed auto-formatting scrolling artifact Implemented navigation to "logical" file (vs. auto-generated) file from output panel To avoid the DLLs getting locked by OS use MSI file for the installation.Home Access Plus+: v9.7: Updated: JSON.net Fixed: Issue with the Windows 8 App Added: Windows 8.1 App Added: Win: Self Signed HAP+ Install Support Added: Win: Delete File Support Added: Timeout for the Logon Tracker Removed: Error Dialogs on the User Card Fixed: Green line showing over the booking form Note: a web.config file update is requiredWPF Extended DataGrid: WPF Extended DataGrid 2.0.0.10 binaries: Now row summaries are updated whenever autofilter value sis modified.Community Forums NNTP bridge: Community Forums NNTP Bridge V55 (LiveConnect): This is a which can be used with the new LiveConnect authentication and the MSDN forums. It fixed a bug where the authentication does not work after 1 hour. A logfile will be stored in "%AppData%\Community\CommunityForumsNNTPServer". If you have any problems please feel free to sent me the file "LogFile.txt" or attached it to a issue.xUnit.net - Unit testing framework for C# and .NET (a successor to NUnit): xUnit.net Visual Studio Runner: A placeholder for downloading Visual Studio runner VSIX files, in case the Gallery is down (or you want to downgrade to older versions).Social Network Importer for NodeXL: SocialNetImporter(v.1.9.1): This new version includes: - Include me option is back - Fixed the login bug reported latelyVeraCrypt: VeraCrypt version 1.0c: Changes between 1.0b and 1.0c (11 November 2013) : Set correctly the minimum required version in volumes header (this value must always follow the program version after any major changes). This also solves also the hidden volume issueCaptcha MVC: Captcha MVC 2.5: v 2.5: Added support for MVC 5. The DefaultCaptchaManager is no longer throws an error if the captcha values was entered incorrectly. Minor changes. v 2.4.1: Fixed issues with deleting incorrect values of the captcha token in the SessionStorageProvider. This could lead to a situation when the captcha was not working with the SessionStorageProvider. Minor changes. v 2.4: Changed the IIntelligencePolicy interface, added ICaptchaManager as parameter for all methods. Improved font size ...Role Based Views in Microsoft Dynamics CRM 2011: Role Based Views in CRM 2011 - 1.0.0.0: Set the default view for a user for a particular entity based on security role Hide/ Show views for a user for a particular entity based on his security role Choose the preferred role for a user for view configuration when the user have more than one security role in the system. Ability to exclude/ include a user from view configuration as per business requirementsDuplica: duplica 0.2.498: this is first stable releaseDNN Blog: 06.00.01: 06.00.01 ReleaseThis is the first bugfix release of the new v6 blog module. These are the changes: Added some robustness in v5-v6 scripts to cater for some rare upgrade scenarios Changed the name of the module definition to avoid clash with Evoq Social Addition of sitemap providerStock Track: Version 1.2 Stable: Overhaul and re-think of the user interface in normal mode. Added stock history view in normal mode. Allows user to enter orders in normal mode. Allow advanced user to run database queries within the program. Improved sales statistics feature, able to calculate against a single category. Updated database script file. Now compatible with lower version of SQL Server.VG-Ripper & PG-Ripper: VG-Ripper 2.9.50: changes NEW: Added Support for "ImageHostHQ.com" links NEW: Added Support for "ImgMoney.net" links NEW: Added Support for "ImgSavy.com" links NEW: Added Support for "PixTreat.com" links Bug fixesVidCoder: 1.5.11 Beta: Added Encode Details window. Exposes elapsed time, ETA, current and average FPS, running file size, current pass and pass progress. Open it by going to Windows -> Encode Details while an encode is running. Subtitle dialog now disables the "Burn In" checkbox when it's either unavailable or it's the only option. It also disables the "Forced Only" when the subtitle type doesn't support the "Forced" flag. Updated HandBrake core to SVN 5872. Fixed crash in the preview window when a source fil...Wsus Package Publisher: Release v1.3.1311.02: Add three new Actions in Custom Updates : Work with Files (Copy, Delete, Rename), Work with Folders (Add, Delete, Rename) and Work with Registry Keys (Add, Delete, Rename). Fix a bug, where after resigning an update, the display is not refresh. Modify the way WPP sort rows in 'Updates Detail Viewer' and 'Computer List Viewer' so that dates are correctly sorted. Add a Tab in the settings form to set Proxy settings when WPP needs to go on Internet. Fix a bug where 'Manage Catalogs Subsc...uComponents: uComponents v6.0.0: This release of uComponents will compile against and support the new API in Umbraco v6.1.0. What's new in uComponents v6.0.0? New DataTypesImage Point XML DropDownList XPath Templatable List New features / Resolved issuesThe following workitems have been implemented and/or resolved: 14781 14805 14808 14818 14854 14827 14868 14859 14790 14853 14790 DataType Grid 14788 14810 14873 14833 14864 14855 / 14860 14816 14823 Drag & Drop support for rows Su...SmartStore.NET - Free ASP.NET MVC Ecommerce Shopping Cart Solution: SmartStore.NET 1.2.1: New FeaturesAdded option Limit to current basket subtotal to HadSpentAmount discount rule Items in product lists can be labelled as NEW for a configurable period of time Product templates can optionally display a discount sign when discounts were applied Added the ability to set multiple favicons depending on stores and/or themes Plugin management: multiple plugins can now be (un)installed in one go Added a field for the HTML body id to store entity (Developer) New property 'Extra...New Projects.Net PG: Just university projectA2D: 1. Cache System 2. Event System 3. IoC 4. Sql Dispatcher System 5. Session System 6. ???Command Bus 7. ????Advantage Browser: A web browser made in Visual Basic 2010 for all to add and learn from or just use.BarCoder: BarCoder is C# Web app for creating EAN-8 and EAN-16 bar codec in vector graphic image format.CLIDE .NET: CLIDE .NET The Command Line IDE for .NET Because Code is just CodeDevcken Java Library: Devcken's Java LibraryDouble Sides Flipping Control - Windows Phone: Double Sides Flipping Control The Control features the following: Two Sides Control which flipping across its center in Both Directions based on horizontal geFigTree FHMS (Funeral Home Management System): FigTree FHMS (Funeral Home Management System) application is outfitted for daily operations of your funeral home.InChatter: InChatter is a Instant messaging communication module for a desktop application programmed by C#. And the server is a WCF program.Mod.Training: Some helpful examples about Orchardy stuffPlupload MVC4 Demo: This project shows how to implement Plupload with an MVC applicationQuality Control Management System: QCMS is a web-based Test Management systemQuan Ly Nha Thuoc: Project Qu?n Lý Ti?m Thu?c Tây Email: phuoc.nh2953@sinhvien.hoasen.edu.vnRandomchaos DX11 Engine: An open source C++ DX 11 EngineService Gateway: The service gateway enables composition and agility for web sites and services.Sortable objects: Sortable objects server and client sideSTSADM ExportCrawlLog - SP Foundation 2010: STSADM extension to see/export SharePoint Fiundation 2010 MSSearch configuration and Crawl LogsTACACS Plus Extended: tacacs+ updates to support subnet specific configurations and reduced configuration with ldap access.TKinect: Framework for Testing Kinect ApplicationsWebApi Data Wrapper: This project - a collection of wrapper for WebAPI.WPF ExpressionEditor: Control representing expression editor. Allows usage of custom expression parsers.

    Read the article

  • Java: immutability, overuse of stack -- better data structure?

    - by HH
    I overused hashSets but it was slow, then changed to Stacks, speed boost-up. Poly's reply uses Collections.emptyList() as immutable list, cutting out excess null-checkers. No Collections.emptyStack(). Combining the words stack and immutability, from the last experiences, gets "immutable stack" (probably not related to functional prog). Java Api 5 for list interface shows that Stack is an implementing class for list and arraylist, here. The java.coccurrent pkg does not have any immutable Stack data structure. The first hinted of misusing stack. The lack of immutabily in the last and poly's book recommendation leads way to list. Something very primitive, fast, no extra layers, with methods like emptyThing(). Overuse of stack and where I use it DataFile.java: public Stack<DataFile> files; FileObject.java: public Stack<String> printViews = new Stack<String>(); FileObject.java:// private static Stack<Object> getFormat(File f){return (new Format(f)).getFormat();} Format.java: private Stack<Object> getLine(File[] fs,String s){return wF;} Format.java: private Stack<Object> getFormat(){return format;} Positions.java: public static Stack<Integer[]> getPrintPoss(String s,File f,Integer maxViewPerF) Positions.java: Stack<File> possPrint = new Stack<File>(); Positions.java: Stack<Integer> positions=new Stack<Integer>(); Record.java: private String getFormatLine(Stack<Object> st) Record.java: Stack<String> lines=new Stack<String>(); SearchToUser.java: public static final Stack<File> allFiles = findf.getFs(); SearchToUser.java: public static final Stack<File> allDirs = findf.getDs(); SearchToUser.java: private Stack<Integer[]> positionsPrint=new Stack<Integer[]>(); SearchToUser.java: public Stack<String> getSearchResults(String s, Integer countPerFile, Integer resCount) SearchToUser.java: Stack<File> filesToS=Fs2Word.getFs2W(s,50); SearchToUser.java: Stack<String> rs=new Stack<String>(); View.java: public Stack<Integer[]> poss = new Stack<Integer[4]>(); View.java: public static Stack<String> getPrintViewsFileWise(String s,Object[] df,Integer maxViewsPerF) View.java: Stack<String> substrings = new Stack<String>(); View.java: private Stack<String> printViews=new Stack<String>(); View.java: MatchView(Stack<Integer> pss,File f,Integer maxViews) View.java: Stack<String> formatFile; View.java: private Stack<Search> files; View.java: private Stack<File> matchingFiles; View.java: private Stack<String> matchViews; View.java: private Stack<String> searchMatches; View.java: private Stack<String> getSearchResults(Integer numbResults) Easier with List: AllDirs and AllFs, now looping with push, but list has more pow. methods such as addAll [OLD] From Stack to some immutable data structure How to get immutable Stack data structure? Can I box it with list? Should I switch my current implementatios from stacks to Lists to get immutable? Which immutable data structure is Very fast with about similar exec time as Stack? No immutability to Stack with Final import java.io.*; import java.util.*; public class TestStack{ public static void main(String[] args) { final Stack<Integer> test = new Stack<Integer>(); Stack<Integer> test2 = new Stack<Integer>(); test.push(37707); test2.push(80437707); //WHY is there not an error to remove an elment // from FINAL stack? System.out.println(test.pop()); System.out.println(test2.pop()); } }

    Read the article

  • Scrum Master Stephen Forte Teaches Agile Development, Silverlight and BI at GIDS 2010

    - by rajesh ahuja
    Great Indian Developer Summit 2010 – Gold Standard for India's Software Developer Ecosystem Bangalore, March 25, 2010: The author of several books on application and database development including Programming SQL Server 2008 and certified Scrum Master Stephen Forte is coming this summer to India's biggest summit for the developer ecosystem - Great Indian Developer Summit. At the summit, Stephen will conduct a workshop guaranteed to give attendees a jump start in taking a certified scrum master exam. Scrum, one of the most popular Agile project management and development methods, which is starting to be adopted at major corporations and on very large projects. After an introduction to the basics of Scrum like project planning and estimation, the Scrum Master, team, product owner and burn down, and of course the daily Scrum, Stephen will show many real world applications of the methodology drawn from his own experience as a Scrum Master. Negotiating with the business, estimation and team dynamics are all discussed as well as how to use Scrum in small organizations, large enterprise environments and consulting environments. Stephen will also discuss using Scrum with virtual teams and an off-shoring environment. He will then take a look at the tools we will use for Agile development, including planning poker, unit testing, and much more. On 20th April at the GIDS.NET Conference, Stephen will also conduct a series of sessions on Microsoft computing technologies. He will teach how to build data driven, n-tier Rich Internet Applications (RIA) with Silverlight 4.0. Line of business applications (LOB) in Silverlight 4.0 are easy by tapping the power of WCF RIA Services, the Silverlight Toolkit, and elevated out of browser support. Stephen's demo centric session will walk you through an example of building a LOB application with Silverlight 4.0. See how Silverlight and WCF RIA Services support domain logic, services, data binding, validation, server based paging, authentication, authorization and much more. Silverlight 4.0 means business. Silverlight runs C# and Visual Basic code, and so it seems natural that a business application might share some code between the Silverlight client and its ASP.NET Web server. You may want to run some code client-side for interactivity, but re-run that code on the server for security or reliability. This is possible, and there are several techniques you can use to accomplish this goal. In Stephen's second talk learn about the various techniques and their pros and cons. Some techniques work better in C#, others in VB. Still others are simpler with a little extra tooling or code-generation. Any serious Silverlight business application will almost certainly face this issue, and this session gets you going fast. In the third talk, Stephen will explain how to properly architect and deploy a BI application using a mix of some exciting new tools and some old familiar ones. He will start with a traditional relational transaction centric database (OLTP) and explore ways to build a data warehouse (OLAP), looking at the star and snowflake schemas. Next he will look at the process of extraction, transformation, and loading (ETL) your OLTP data into your data warehouse. Different techniques for ETL will be described and the various tradeoffs will be discussed. Then he will look at using the warehouse for reporting, drill down, and data analysis in Microsoft Excel's PowerPivot 2010. The session will round off by showing how to properly build a cube and build a data analysis application on top of that cube, and conclude by looking at some tools to help with the data visualization process. Every year, GIDS is a game changer for several thousands of IT professionals, providing them with a competitive edge over their peers, enlightening them with bleeding-edge information most useful in their daily jobs, helping them network with world-class experts and visionaries, and providing them with a much needed thrust in their careers. Attend Great Indian Developer Summit to gain the information, education and solutions you seek. From post-conference workshops, breakout sessions by expert instructors, keynotes by industry heavyweights, enhanced networking opportunities, and more. About Great Indian Developer Summit Great Indian Developer Summit is the gold standard for India's software developer ecosystem for gaining exposure to and evaluating new projects, tools, services, platforms, languages, software and standards. Packed with premium knowledge, action plans and advise from been-there-done-it veterans, creators, and visionaries, the 2010 edition of Great Indian Developer Summit features focused sessions, case studies, workshops and power panels that will transform you into a force to reckon with. Featuring 3 co-located conferences: GIDS.NET, GIDS.Web, GIDS.Java and an exclusive day of in-depth tutorials - GIDS.Workshops, from 20 April to 24 April at the IISc campus in Bangalore. At GIDS you'll participate in hundreds of sessions encompassing the full range of Microsoft computing, Java, Agile, RIA, Rich Web, open source/standards, languages, frameworks and platforms, practical tutorials that deep dive into technical skill and best practices, inspirational keynote presentations, an Expo Hall featuring dozens of the latest projects and products activities, engaging networking events, and the interact with the best and brightest of speakers from around the world. For further information on GIDS 2010, please visit the summit on the web http://www.developersummit.com/ A Saltmarch Media Press Release E: [email protected] Ph: +91 80 4005 1000

    Read the article

  • Getting started with Exchange Web Services 2010

    - by Adam Tuttle
    I've been tasked with writing a SOAP web-service in .Net to be middleware between EWS2010 and an application server that previously used WebDAV to connect to Exchange. (As I understand it, WebDAV is going away with EWS2010, so the application server will no longer be able to connect as it previously did, and it is exponentially harder to connect to EWS without WebDAV. The theory is that doing it in .Net should be easier than anything else... Right?!) My end goal is to be able to get and create/update email, calendar items, contacts, and to-do list items for a specified Exchange account. (Deleting is not currently necessary, but I may build it in for future consideration, if it's easy enough). I was originally given some sample code, which did in fact work, but I quickly realized that it was outdated. The types and classes used appear nowhere in the current documentation. For example, the method used to create a connection to the Exchange server was: ExchangeService svc = new ExchangeService(); svc.Credentials = new WebCredentials(AuthEmailAddress, AuthEmailPassword); svc.AutodiscoverUrl(AutoDiscoverEmailAddress); For what it's worth, this was using an assembly that came with the sample code: Microsoft.Exchange.WebServices.dll ("MEWS"). Before I realized that this wasn't the current standard way to accomplish the connection, and it worked, I tried to build on it and add a method to create calendar items, which I copied from here: static void CreateAppointment(ExchangeServiceBinding esb) { // Create the appointment. CalendarItemType appointment = new CalendarItemType(); ... } Right away, I'm confronted with the difference between ExchangeService and ExchangeServiceBinding ("ESB"); so I started Googling to try and figure out how to get an ESB definition so that the CreateAppointment method will compile. I found this blog post that explains how to generate a proxy class from a WSDL, which I did. Unfortunately, this caused some conflicts where types that were defined in the original Assembly, Microsoft.Exchange.WebServices.dll (that came with the sample code) overlapped with Types in my new EWS.dll assembly (which I compiled from the code generated from the services.wsdl provided by the Exchange server). I excluded the MEWS assembly, which only made things worse. I went from a handful of errors and warnings to 25 errors and 2,510 warnings. All kinds of types and methods were not found. Something is clearly wrong, here. So I went back on the hunt. I found instructions on adding service references and web references (i.e. the extra steps it takes in VS2008), and I think I'm back on the right track. I removed (actually, for now, just excluded) all previous assemblies I had been trying; and I added a service reference for https://my.exchange-server.com/ews/services.wsdl Now I'm down to just 1 error and 1 warning. Warning: The element 'transport' cannot contain child element 'extendedProtectionPolicy' because the parent element's content model is empty. This is in reference to a change that was made to web.config when I added the service reference; and I just found a fix for that here on SO. I've commented that section out as indicated, and it did make the warning go away, so woot for that. The error hasn't been so easy to get around, though: Error: The type or namespace name 'ExchangeService' could not be found (are you missing a using directive or an assembly reference?) This is in reference to the function I was using to create the EWS connection, called by each of the web methods: private ExchangeService getService(String AutoDiscoverEmailAddress, String AuthEmailAddress, String AuthEmailPassword) { ExchangeService svc = new ExchangeService(); svc.Credentials = new WebCredentials(AuthEmailAddress, AuthEmailPassword); svc.AutodiscoverUrl(AutoDiscoverEmailAddress); return svc; } This function worked perfectly with the MEWS assembly from the sample code, but the ExchangeService type is no longer available. (Nor is ExchangeServiceBinding, that was the first thing I checked.) At this point, since I'm not following any directions from the documentation (I couldn't find anywhere in the documentation that said to add a service reference to your Exchange server's services.wsdl -- but that does seem to be the best/farthest I've gotten so far), I feel like I'm flying blind. I know I need to figure out whatever it is that should replace ExchangeService / ExchangeServiceBinding, implement that, and then work through whatever errors crop up as a result of that switch... But I have no idea how to do that, or where to look for how to do it. Googling "ExchangeService" and "ExchangeServiceBinding" only seem to lead back to outdated blog posts and MSDN, neither of which has proven terribly helpful thus far. Help me, Obi-Wan, you're my only hope!

    Read the article

  • how to clear stack after stack overflow signal occur

    - by user353573
    In pthread, After reaching yellow zone in stack, signal handler stop the recursive function by making it return however, we can only continue to use extra area in yellow zone, how to clear the rubbish before the yellow zone in the thread stack ? (Copied from "answers"): #include <pthread.h> #include <stdio.h> #include <stdlib.h> #include <signal.h> #include <setjmp.h> #include <sys/mman.h> #include <unistd.h> #include <assert.h> #include <sys/resource.h> #define ALT_STACK_SIZE (64*1024) #define YELLOW_ZONE_PAGES (1) typedef struct { size_t stack_size; char* stack_pointer; char* red_zone_boundary; char* yellow_zone_boundary; sigjmp_buf return_point; size_t red_zone_size; } ThreadInfo; static pthread_key_t thread_info_key; static struct sigaction newAct, oldAct; bool gofromyellow = false; int call_times = 0; static void main_routine(){ // make it overflow if(gofromyellow == true) { printf("return from yellow zone, called %d times\n", call_times); return; } else { call_times = call_times + 1; main_routine(); gofromyellow = true; } } // red zone management static void stackoverflow_routine(){ fprintf(stderr, "stack overflow error.\n"); fflush(stderr); } // yellow zone management static void yellow_zone_hook(){ fprintf(stderr, "exceed yellow zone.\n"); fflush(stderr); } static int get_stack_info(void** stackaddr, size_t* stacksize){ int ret = -1; pthread_attr_t attr; pthread_attr_init(&attr); if(pthread_getattr_np(pthread_self(), &attr) == 0){ ret = pthread_attr_getstack(&attr, stackaddr, stacksize); } pthread_attr_destroy(&attr); return ret; } static int is_in_stack(const ThreadInfo* tinfo, char* pointer){ return (tinfo->stack_pointer <= pointer) && (pointer < tinfo->stack_pointer + tinfo->stack_size); } static int is_in_red_zone(const ThreadInfo* tinfo, char* pointer){ if(tinfo->red_zone_boundary){ return (tinfo->stack_pointer <= pointer) && (pointer < tinfo->red_zone_boundary); } } static int is_in_yellow_zone(const ThreadInfo* tinfo, char* pointer){ if(tinfo->yellow_zone_boundary){ return (tinfo->red_zone_boundary <= pointer) && (pointer < tinfo->yellow_zone_boundary); } } static void set_yellow_zone(ThreadInfo* tinfo){ int pagesize = sysconf(_SC_PAGE_SIZE); assert(pagesize > 0); tinfo->yellow_zone_boundary = tinfo->red_zone_boundary + pagesize * YELLOW_ZONE_PAGES; mprotect(tinfo->red_zone_boundary, pagesize * YELLOW_ZONE_PAGES, PROT_NONE); } static void reset_yellow_zone(ThreadInfo* tinfo){ size_t pagesize = tinfo->yellow_zone_boundary - tinfo->red_zone_boundary; if(mmap(tinfo->red_zone_boundary, pagesize, PROT_READ | PROT_WRITE, MAP_PRIVATE | MAP_ANONYMOUS, 0, 0) == 0){ perror("mmap failed"), exit(1); } mprotect(tinfo->red_zone_boundary, pagesize, PROT_READ | PROT_WRITE); tinfo->yellow_zone_boundary = 0; } static void signal_handler(int sig, siginfo_t* sig_info, void* sig_data){ if(sig == SIGSEGV){ ThreadInfo* tinfo = (ThreadInfo*) pthread_getspecific(thread_info_key); char* fault_address = (char*) sig_info->si_addr; if(is_in_stack(tinfo, fault_address)){ if(is_in_red_zone(tinfo, fault_address)){ siglongjmp(tinfo->return_point, 1); }else if(is_in_yellow_zone(tinfo, fault_address)){ reset_yellow_zone(tinfo); yellow_zone_hook(); gofromyellow = true; return; } else { //inside stack not related overflow SEGV happen } } } } static void register_application_info(){ pthread_key_create(&thread_info_key, NULL); sigemptyset(&newAct.sa_mask); sigaddset(&newAct.sa_mask, SIGSEGV); newAct.sa_sigaction = signal_handler; newAct.sa_flags = SA_SIGINFO | SA_RESTART | SA_ONSTACK; sigaction(SIGSEGV, &newAct, &oldAct); } static void register_thread_info(ThreadInfo* tinfo){ stack_t ss; pthread_setspecific(thread_info_key, tinfo); get_stack_info((void**)&tinfo->stack_pointer, &tinfo->stack_size); printf("stack size %d mb\n", tinfo->stack_size/1024/1024 ); tinfo->red_zone_boundary = tinfo->stack_pointer + tinfo->red_zone_size; set_yellow_zone(tinfo); ss.ss_sp = (char*)malloc(ALT_STACK_SIZE); ss.ss_size = ALT_STACK_SIZE; ss.ss_flags = 0; sigaltstack(&ss, NULL); } static void* thread_routine(void* p){ ThreadInfo* tinfo = (ThreadInfo*)p; register_thread_info(tinfo); if(sigsetjmp(tinfo->return_point, 1) == 0){ main_routine(); } else { stackoverflow_routine(); } free(tinfo); printf("after tinfo, end thread\n"); return 0; } int main(int argc, char** argv){ register_application_info(); if( argc == 2 ){ int stacksize = atoi(argv[1]); pthread_attr_t attr; pthread_attr_init(&attr); pthread_attr_setstacksize(&attr, 1024 * 1024 * stacksize); { pthread_t pid0; ThreadInfo* tinfo = (ThreadInfo*)calloc(1, sizeof(ThreadInfo)); pthread_attr_getguardsize(&attr, &tinfo->red_zone_size); pthread_create(&pid0, &attr, thread_routine, tinfo); pthread_join(pid0, NULL); } } else { printf("Usage: %s stacksize(mb)\n", argv[0]); } return 0; } C language in linux, ubuntu

    Read the article

  • Launch market place with id of an application that doesn't exist in the android market place

    - by Gaurav
    Hi, I am creating an application that checks the installation of a package and then launches the market-place with its id. When I try to launch market place with id of an application say com.mybrowser.android by throwing an intent android.intent.action.VIEW with url: market://details?id=com.mybrowser.android, the market place application does launches but crashes after launch. Note: the application com.mybrowser.android doesn't exists in the market-place. MyApplication is my application. $ adb logcat I/ActivityManager( 1030): Starting activity: Intent { act=android.intent.action.MAIN cat=[android.intent.category.LAUNCHER] flg=0x10200000 cmp=myapp.testapp/.MyApplication } I/ActivityManager( 1030): Start proc myapp.testapp for activity myapp.testapp/.MyApplication: pid=3858 uid=10047 gids={1015, 3003} I/MyApplication( 3858): [ Activity CREATED ] I/MyApplication( 3858): [ Activity STARTED ] I/MyApplication( 3858): onResume D/dalvikvm( 1109): GC freed 6571 objects / 423480 bytes in 73ms I/MyApplication( 3858): Pressed OK button I/MyApplication( 3858): Broadcasting Intent: android.intent.action.VIEW, data: market://details?id=com.mybrowser.android I/ActivityManager( 1030): Starting activity: Intent { act=android.intent.action.VIEW dat=market://details?id=com.mybrowser.android flg=0x10000000 cmp=com.android.ven ding/.AssetInfoActivity } I/MyApplication( 3858): onPause I/ActivityManager( 1030): Start proc com.android.vending for activity com.android.vending/.AssetInfoActivity: pid=3865 uid=10023 gids={3003} I/ActivityThread( 3865): Publishing provider com.android.vending.SuggestionsProvider: com.android.vending.SuggestionsProvider D/dalvikvm( 1030): GREF has increased to 701 I/vending ( 3865): com.android.vending.api.RadioHttpClient$1.handleMessage(): Handle DATA_STATE_CHANGED event: NetworkInfo: type: WIFI[], state: CONNECTED/CO NNECTED, reason: (unspecified), extra: (none), roaming: false, failover: false, isAvailable: true I/ActivityManager( 1030): Displayed activity com.android.vending/.AssetInfoActivity: 609 ms (total 7678 ms) D/dalvikvm( 1030): GC freed 10458 objects / 676440 bytes in 128ms I/MyApplication( 3858): [ Activity STOPPED ] D/dalvikvm( 3865): GC freed 3538 objects / 254008 bytes in 84ms W/dalvikvm( 3865): threadid=19: thread exiting with uncaught exception (group=0x4001b180) E/AndroidRuntime( 3865): Uncaught handler: thread AsyncTask #1 exiting due to uncaught exception E/AndroidRuntime( 3865): java.lang.RuntimeException: An error occured while executing doInBackground() E/AndroidRuntime( 3865): at android.os.AsyncTask$3.done(AsyncTask.java:200) E/AndroidRuntime( 3865): at java.util.concurrent.FutureTask$Sync.innerSetException(FutureTask.java:273) E/AndroidRuntime( 3865): at java.util.concurrent.FutureTask.setException(FutureTask.java:124) E/AndroidRuntime( 3865): at java.util.concurrent.FutureTask$Sync.innerRun(FutureTask.java:307) E/AndroidRuntime( 3865): at java.util.concurrent.FutureTask.run(FutureTask.java:137) E/AndroidRuntime( 3865): at java.util.concurrent.ThreadPoolExecutor.runWorker(ThreadPoolExecutor.java:1068) E/AndroidRuntime( 3865): at java.util.concurrent.ThreadPoolExecutor$Worker.run(ThreadPoolExecutor.java:561) E/AndroidRuntime( 3865): at java.lang.Thread.run(Thread.java:1096) E/AndroidRuntime( 3865): Caused by: java.lang.NullPointerException E/AndroidRuntime( 3865): at com.android.vending.AssetItemAdapter$ReloadLocalAssetInformationTask.doInBackground(AssetItemAdapter.java:845) E/AndroidRuntime( 3865): at com.android.vending.AssetItemAdapter$ReloadLocalAssetInformationTask.doInBackground(AssetItemAdapter.java:831) E/AndroidRuntime( 3865): at android.os.AsyncTask$2.call(AsyncTask.java:185) E/AndroidRuntime( 3865): at java.util.concurrent.FutureTask$Sync.innerRun(FutureTask.java:305) E/AndroidRuntime( 3865): ... 4 more I/Process ( 1030): Sending signal. PID: 3865 SIG: 3 I/dalvikvm( 3865): threadid=7: reacting to signal 3 I/dalvikvm( 3865): Wrote stack trace to '/data/anr/traces.txt' I/DumpStateReceiver( 1030): Added state dump to 1 crashes D/AndroidRuntime( 3865): Shutting down VM W/dalvikvm( 3865): threadid=3: thread exiting with uncaught exception (group=0x4001b180) E/AndroidRuntime( 3865): Uncaught handler: thread main exiting due to uncaught exception E/AndroidRuntime( 3865): java.lang.NullPointerException E/AndroidRuntime( 3865): at com.android.vending.controller.AssetInfoActivityController.getIdDeferToLocal(AssetInfoActivityController.java:637) E/AndroidRuntime( 3865): at com.android.vending.AssetInfoActivity.displayAssetInfo(AssetInfoActivity.java:556) E/AndroidRuntime( 3865): at com.android.vending.AssetInfoActivity.access$800(AssetInfoActivity.java:74) E/AndroidRuntime( 3865): at com.android.vending.AssetInfoActivity$LoadAssetInfoAction$1.run(AssetInfoActivity.java:917) E/AndroidRuntime( 3865): at android.os.Handler.handleCallback(Handler.java:587) E/AndroidRuntime( 3865): at android.os.Handler.dispatchMessage(Handler.java:92) E/AndroidRuntime( 3865): at android.os.Looper.loop(Looper.java:123) E/AndroidRuntime( 3865): at android.app.ActivityThread.main(ActivityThread.java:4363) E/AndroidRuntime( 3865): at java.lang.reflect.Method.invokeNative(Native Method) E/AndroidRuntime( 3865): at java.lang.reflect.Method.invoke(Method.java:521) E/AndroidRuntime( 3865): at com.android.internal.os.ZygoteInit$MethodAndArgsCaller.run(ZygoteInit.java:860) E/AndroidRuntime( 3865): at com.android.internal.os.ZygoteInit.main(ZygoteInit.java:618) E/AndroidRuntime( 3865): at dalvik.system.NativeStart.main(Native Method) I/Process ( 1030): Sending signal. PID: 3865 SIG: 3 W/ActivityManager( 1030): Process com.android.vending has crashed too many times: killing! D/ActivityManager( 1030): Force finishing activity com.android.vending/.AssetInfoActivity I/dalvikvm( 3865): threadid=7: reacting to signal 3 D/ActivityManager( 1030): Force removing process ProcessRecord{44e48548 3865:com.android.vending/10023} (com.android.vending/10023) However, when I try to launch the market place for a package that exists in the market place say com.opera.mini.android, everything works. Log for this case: D/dalvikvm( 966): GC freed 2781 objects / 195056 bytes in 99ms I/MyApplication( 1165): Pressed OK button I/MyApplication( 1165): Broadcasting Intent: android.intent.action.VIEW, data: market://details?id=com.opera.mini.android I/ActivityManager( 78): Starting activity: Intent { act=android.intent.action.VIEW dat=market://details?id=com.opera.mini.android flg=0x10000000 cmp=com.android.vending/.AssetInfoActivity } I/AndroidRuntime( 1165): AndroidRuntime onExit calling exit(0) I/WindowManager( 78): WIN DEATH: Window{44c72308 myapp.testapp/myapp.testapp.MyApplication paused=true} I/ActivityManager( 78): Process myapp.testapp (pid 1165) has died. I/WindowManager( 78): WIN DEATH: Window{44c72958 myapp.testapp/myapp.testapp.MyApplication paused=false} D/dalvikvm( 78): GC freed 31778 objects / 1796368 bytes in 142ms I/ActivityManager( 78): Displayed activity com.android.vending/.AssetInfoActivity: 214 ms (total 22866 ms) W/KeyCharacterMap( 978): No keyboard for id 65540 W/KeyCharacterMap( 978): Using default keymap: /system/usr/keychars/qwerty.kcm.bin V/RenderScript_jni( 966): surfaceCreated V/RenderScript_jni( 966): surfaceChanged V/RenderScript( 966): setSurface 480 762 0x573430 D/ViewFlipper( 966): updateRunning() mVisible=true, mStarted=true, mUserPresent=true, mRunning=true D/dalvikvm( 978): GC freed 10065 objects / 624440 bytes in 95ms Any ideas? Thanks in advance!

    Read the article

  • Giving an Error Object Expected Line 48 Char 1

    - by Leslie Peer
    Giving an Error Object Expected Line 48 Char 1------What did I do wrong??? *Note Line # are for reference only not on Original Web page****** <HTML><HEAD><TITLE></TITLE> <META http-equiv=Content-Type content="text/html; charset=utf-8"> <META content="Leslie Peer" name=author> <META content="Created with Trellian WebPage" name=description> <META content="MSHTML 6.00.6000.16809" name=GENERATOR> <META content=Index name=keywords> <STYLE type=text/css>BODY { COLOR: #000000; BACKGROUND-REPEAT: repeat; FONT-FAMILY: Accent SF, Arial, Arial Black, Arial Narrow, Century Gothic, Comic Sans MS, Courier, Courier New, Georgia, Microsoft Sans Serif, Monotype Corsiva, Symbol, Tahoma, Times New Roman; BACKGROUND-COLOR: #666666 } A { FONT-SIZE: 14px; FONT-FAMILY: Arial Black, Bookman Old Style, DnD4Attack, Lucida Console, MS Serif, MS Outlook, MS Sans Serif, Rockwell Extra Bold, Roman, Star Time JL, Tahoma, Terminal, Times New Roman, Verdana, Wingdings 2, Wingdings 3, Wingdings } A:link { COLOR: #9966cc; TEXT-DECORATION: underline } A:visited { COLOR: #66ff66; TEXT-DECORATION: underline } A:hover { COLOR: #ffff00; TEXT-DECORATION: underline } A:active { COLOR: #ff0033; TEXT-DECORATION: underline } H1 { FONT-SIZE: 25px; COLOR: #9966cc; FONT-FAMILY: Century Gothic } H2 { FONT-SIZE: 20px; COLOR: #ff33cc; FONT-FAMILY: Century Gothic } H3 { FONT-SIZE: 18px; COLOR: #6666cc; FONT-FAMILY: Century Gothic } H4 { FONT-SIZE: 15px; COLOR: #00cc33; FONT-FAMILY: Century Gothic } H5 { FONT-SIZE: 10px; COLOR: #ffff33; FONT-FAMILY: Century Gothic } H6 { FONT-SIZE: 5px; COLOR: #996666; FONT-FAMILY: Century Gothic } </STYLE> line 46-<SCRIPT> line 47- CharNum=6; line 48-var Character=newArray();Character[0]="Larry Lightfoot";Character[1]="Sam Wrightfield";Character[2]="Gavin Hartfild";Character[3]="Gail Quickfoot";Character[4]="Robert Gragorian";Character[5]="Peter Shain"; line 49-var ExChar=newArray();ExChar[0]="Tabor Bloomfield"; line 50-var Class=newArray();Class[0]="MagicUser";Class[1]="Fighter";Class[2]="Fighter";Class[3]="Thief";Class[4]="Cleric";Class[5]="Fighter"; line 51-line 47var ExClass=newArray();ExClass[0]="MagicUser"; line 52-var Level=newArray();Level[0]="2";Level[1]="1";Level[2]="1";Level[3]="2";Level[4]="2";Level[5]="1"; line 53-var ExLevel=newArray();ExLevel[0]="23"; line 54-var Hpts=newArray();Hpts[0]="6";Hpts[1]="14";Hpts[2]="13";Hpts[3]="8";Hpts[4]="12";Hpts[5]="15"; line 55-var ExHpts=newArray();ExHpts[0]="145"; line 56-var Armor=newArray();Armor[0]="Cloak";Armor[1]="Splinted Armor";Armor[2]="Chain Armor";Armor[3]="Leather Armor";Armor[4]="Chain Armor";Armor[5]="Splinted Armor"; line 57-var ExArmor=newArray();ExArmor[0]="Robe of Protection +5"; line 58-var Ac1=newArray();Ac1[0]="0";Ac1[1]="3";Ac1[2]="3";Ac1[3]="4";Ac1[4]="2";Ac1[5]="3"; line 59-var ExAc=newArray();ExAc[0]="5"; line 60-var Armor1b=newArray();Armor1b[0]="Ring of Protection +1";Armor1b[1]="Small Shield";Armor1b[2]="Small Shield";Armor1b[3]="Wooden Shield";Armor1b[4]="Large Shield";Armor1b[5]="Small Shield"; line 61-var ExArmor1b=newArray();ExArmor1b[0]="Ring of Protection +5"; line 62-var Ac2=newArray();Ac2[0]="1";Ac2[1]="1";Ac2[2]="1";Ac2[3]="1";Ac2[4]="1";Ac2[5]="1"; line 63-var ExAc1b=newArray();ExAc1b[0]="5" line 64-var Str=newArray();Str[0]="15";Str[1]="16";Str[2]="14";Str[3]="13";Str[4]="14";Str[5]="13"; line 65-var ExStr=newArray();ExStr[0]=21; line 66-var Int=newArray();Int[0]="17";Int[1]="11";Int[2]="12";Int[3]="13";Int[4]="14";Int[5]="13"; line 67-var ExInt=newArray();ExInt[0]="19"; line 68-var Wis=newArray();Wis[0]="17";Wis[1]="12";Wis[2]="14";Wis[3]="13";Wis[4]="14";Wis[5]="12"; line 69-var ExWis=newArray();ExWis[0]="18"; line 70-var Dex=newArray();Dex[0]="15";Dex[1]="14";Dex[2]="13";Dex[3]="15";Dex[4]="14";Dex[5]="12"; line 71-var ExDex=newArray();ExDex[0]="19"; line 72-var Con=newArray();Con[0]="16";Con[1]="15";Con[2]="16";Con[3]="13";Con[4]="12";Con[5]="10"; line 73-var ExCon=newArray();ExCon[0]="19"; line 74-var Chr=newArray();Chr[0]="16";Chr[1]="14";Chr[2]="13";Chr[3]="12";Chr[4]="14";Chr[5]="13"; line 75-var ExChr=newArray();ExChr[0]="21"; line 76-var Expt=newArray();Expt[0]="45";Expt[1]="21";Expt[2]="16";Expt[3]="18";Expt[4]="22";Expt[5]="34"; line 77-var ExExpt=newArray();ExExpt[0]="245678"; line 78-var ExBp=newArray();ExBp[0]="Unknown";ExBp[1]="Extrademensional Plane World of Amborsia";ExBp[2]="Evil Wizard Banished for Mass Geniocodes"; line 79-</SCRIPT> line 80-</HEAD> line 81-<BODY> Giving an Error Object Expected Line 48 Char 1------What did I do wrong??? *Note Line # are for reference only not on Original Web page******

    Read the article

  • Few Google Checkout Questions

    - by Richard Knop
    I am planning to integrate a Google Checkout payment system on a social networking website. The idea is that members can buy "tokens" for real money (which are sort of the website currency) and then they can buy access to some extra content on the website etc. What I want to do is create a Google Checkout button that takes a member to the checkout page where he pays with his credit or debit card. What I want is the Google Checkout to notify notify my server whether the purchase of tokens was successful (if the credit/debit card was charged) so I can update the local database. The website is coded in PHP/MySQL. I have downloaded the sample PHP code from here: code.google.com/p/google-checkout-php-sample-code/wiki/Documentation I know how to create a Google checkout button and I have also placed the responsehandlerdemo.php file on my server. This is the file the Google Checkout is supposed to send response to (of course I set the path to the file in Google merchant account). Now in the response handler file there is a switch block with several case statements. Which one means that the payment was successful and I can add tokens to the member account in the local database? switch ($root) { case "request-received": { break; } case "error": { break; } case "diagnosis": { break; } case "checkout-redirect": { break; } case "merchant-calculation-callback": { // Create the results and send it $merchant_calc = new GoogleMerchantCalculations($currency); // Loop through the list of address ids from the callback $addresses = get_arr_result($data[$root]['calculate']['addresses']['anonymous-address']); foreach($addresses as $curr_address) { $curr_id = $curr_address['id']; $country = $curr_address['country-code']['VALUE']; $city = $curr_address['city']['VALUE']; $region = $curr_address['region']['VALUE']; $postal_code = $curr_address['postal-code']['VALUE']; // Loop through each shipping method if merchant-calculated shipping // support is to be provided if(isset($data[$root]['calculate']['shipping'])) { $shipping = get_arr_result($data[$root]['calculate']['shipping']['method']); foreach($shipping as $curr_ship) { $name = $curr_ship['name']; //Compute the price for this shipping method and address id $price = 12; // Modify this to get the actual price $shippable = "true"; // Modify this as required $merchant_result = new GoogleResult($curr_id); $merchant_result->SetShippingDetails($name, $price, $shippable); if($data[$root]['calculate']['tax']['VALUE'] == "true") { //Compute tax for this address id and shipping type $amount = 15; // Modify this to the actual tax value $merchant_result->SetTaxDetails($amount); } if(isset($data[$root]['calculate']['merchant-code-strings'] ['merchant-code-string'])) { $codes = get_arr_result($data[$root]['calculate']['merchant-code-strings'] ['merchant-code-string']); foreach($codes as $curr_code) { //Update this data as required to set whether the coupon is valid, the code and the amount $coupons = new GoogleCoupons("true", $curr_code['code'], 5, "test2"); $merchant_result->AddCoupons($coupons); } } $merchant_calc->AddResult($merchant_result); } } else { $merchant_result = new GoogleResult($curr_id); if($data[$root]['calculate']['tax']['VALUE'] == "true") { //Compute tax for this address id and shipping type $amount = 15; // Modify this to the actual tax value $merchant_result->SetTaxDetails($amount); } $codes = get_arr_result($data[$root]['calculate']['merchant-code-strings'] ['merchant-code-string']); foreach($codes as $curr_code) { //Update this data as required to set whether the coupon is valid, the code and the amount $coupons = new GoogleCoupons("true", $curr_code['code'], 5, "test2"); $merchant_result->AddCoupons($coupons); } $merchant_calc->AddResult($merchant_result); } } $Gresponse->ProcessMerchantCalculations($merchant_calc); break; } case "new-order-notification": { $Gresponse->SendAck(); break; } case "order-state-change-notification": { $Gresponse->SendAck(); $new_financial_state = $data[$root]['new-financial-order-state']['VALUE']; $new_fulfillment_order = $data[$root]['new-fulfillment-order-state']['VALUE']; switch($new_financial_state) { case 'REVIEWING': { break; } case 'CHARGEABLE': { //$Grequest->SendProcessOrder($data[$root]['google-order-number']['VALUE']); //$Grequest->SendChargeOrder($data[$root]['google-order-number']['VALUE'],''); break; } case 'CHARGING': { break; } case 'CHARGED': { break; } case 'PAYMENT_DECLINED': { break; } case 'CANCELLED': { break; } case 'CANCELLED_BY_GOOGLE': { //$Grequest->SendBuyerMessage($data[$root]['google-order-number']['VALUE'], // "Sorry, your order is cancelled by Google", true); break; } default: break; } switch($new_fulfillment_order) { case 'NEW': { break; } case 'PROCESSING': { break; } case 'DELIVERED': { break; } case 'WILL_NOT_DELIVER': { break; } default: break; } break; } case "charge-amount-notification": { //$Grequest->SendDeliverOrder($data[$root]['google-order-number']['VALUE'], // <carrier>, <tracking-number>, <send-email>); //$Grequest->SendArchiveOrder($data[$root]['google-order-number']['VALUE'] ); $Gresponse->SendAck(); break; } case "chargeback-amount-notification": { $Gresponse->SendAck(); break; } case "refund-amount-notification": { $Gresponse->SendAck(); break; } case "risk-information-notification": { $Gresponse->SendAck(); break; } default: $Gresponse->SendBadRequestStatus("Invalid or not supported Message"); break; } I guess that case 'CHARGED' is the one, am I right? Second question, do I need an SSL certificate to receive response from Google Checkout? According to this I do: groups.google.com/group/google-checkout-api-php/browse_thread/thread/10ce55177281c2b0 But I don's see it mentioned anywhere in the official documentation. Thank you.

    Read the article

  • mfc tab control switch tabs

    - by MRM
    I created a simple tab control that has 2 tabs (each tab is a different dialog). The thing is that i don't have any idea how to switch between tabs (when the user presses Titlu Tab1 to show the dialog i made for the first tab, and when it presses Titlu Tab2 to show my other dialog). I added a handler for changing items, but i don't know how should i acces some kind of index or child for tabs. Tab1.h and Tab2.h are headers for dialogs that show only static texts with the name of the each tab. There may be an obvious answer to my question, but i am a real newbie in c++ and MFC. This is my header: // CTabControlDlg.h : header file // #pragma once #include "afxcmn.h" #include "Tab1.h" #include "Tab2.h" // CCTabControlDlg dialog class CCTabControlDlg : public CDialog { // Construction public: CCTabControlDlg(CWnd* pParent = NULL); // standard constructor // Dialog Data enum { IDD = IDD_CTABCONTROL_DIALOG }; protected: virtual void DoDataExchange(CDataExchange* pDX); // DDX/DDV support // Implementation protected: HICON m_hIcon; // Generated message map functions virtual BOOL OnInitDialog(); afx_msg void OnSysCommand(UINT nID, LPARAM lParam); afx_msg void OnPaint(); afx_msg HCURSOR OnQueryDragIcon(); DECLARE_MESSAGE_MAP() public: CTabCtrl m_tabcontrol1; CTab1 m_tab1; CTab2 m_tab2; afx_msg void OnTcnSelchangeTabcontrol(NMHDR *pNMHDR, LRESULT *pResult); }; And this is the .cpp: // CTabControlDlg.cpp : implementation file // #include "stdafx.h" #include "CTabControl.h" #include "CTabControlDlg.h" #ifdef _DEBUG #define new DEBUG_NEW #endif // CAboutDlg dialog used for App About class CAboutDlg : public CDialog { public: CAboutDlg(); // Dialog Data enum { IDD = IDD_ABOUTBOX }; protected: virtual void DoDataExchange(CDataExchange* pDX); // DDX/DDV support // Implementation protected: DECLARE_MESSAGE_MAP() }; CAboutDlg::CAboutDlg() : CDialog(CAboutDlg::IDD) { } void CAboutDlg::DoDataExchange(CDataExchange* pDX) { CDialog::DoDataExchange(pDX); } BEGIN_MESSAGE_MAP(CAboutDlg, CDialog) END_MESSAGE_MAP() // CCTabControlDlg dialog CCTabControlDlg::CCTabControlDlg(CWnd* pParent /*=NULL*/) : CDialog(CCTabControlDlg::IDD, pParent) { m_hIcon = AfxGetApp()->LoadIcon(IDR_MAINFRAME); } void CCTabControlDlg::DoDataExchange(CDataExchange* pDX) { CDialog::DoDataExchange(pDX); DDX_Control(pDX, IDC_TABCONTROL, m_tabcontrol1); } BEGIN_MESSAGE_MAP(CCTabControlDlg, CDialog) ON_WM_SYSCOMMAND() ON_WM_PAINT() ON_WM_QUERYDRAGICON() //}}AFX_MSG_MAP ON_NOTIFY(TCN_SELCHANGE, IDC_TABCONTROL, &CCTabControlDlg::OnTcnSelchangeTabcontrol) END_MESSAGE_MAP() // CCTabControlDlg message handlers BOOL CCTabControlDlg::OnInitDialog() { CDialog::OnInitDialog(); // Add "About..." menu item to system menu. // IDM_ABOUTBOX must be in the system command range. ASSERT((IDM_ABOUTBOX & 0xFFF0) == IDM_ABOUTBOX); ASSERT(IDM_ABOUTBOX < 0xF000); CMenu* pSysMenu = GetSystemMenu(FALSE); if (pSysMenu != NULL) { CString strAboutMenu; strAboutMenu.LoadString(IDS_ABOUTBOX); if (!strAboutMenu.IsEmpty()) { pSysMenu->AppendMenu(MF_SEPARATOR); pSysMenu->AppendMenu(MF_STRING, IDM_ABOUTBOX, strAboutMenu); } } // Set the icon for this dialog. The framework does this automatically // when the application's main window is not a dialog SetIcon(m_hIcon, TRUE); // Set big icon SetIcon(m_hIcon, FALSE); // Set small icon // TODO: Add extra initialization here CTabCtrl* pTabCtrl = (CTabCtrl*)GetDlgItem(IDC_TABCONTROL); m_tab1.Create(IDD_TAB1, pTabCtrl); TCITEM item1; item1.mask = TCIF_TEXT | TCIF_PARAM; item1.lParam = (LPARAM)& m_tab1; item1.pszText = _T("Titlu Tab1"); pTabCtrl->InsertItem(0, &item1); //Pozitionarea dialogului CRect rcItem; pTabCtrl->GetItemRect(0, &rcItem); m_tab1.SetWindowPos(NULL, rcItem.left, rcItem.bottom + 1, 0, 0, SWP_NOSIZE | SWP_NOZORDER ); m_tab1.ShowWindow(SW_SHOW); // al doilea tab m_tab2.Create(IDD_TAB2, pTabCtrl); TCITEM item2; item2.mask = TCIF_TEXT | TCIF_PARAM; item2.lParam = (LPARAM)& m_tab1; item2.pszText = _T("Titlu Tab2"); pTabCtrl->InsertItem(0, &item2); //Pozitionarea dialogului //CRect rcItem; pTabCtrl->GetItemRect(0, &rcItem); m_tab2.SetWindowPos(NULL, rcItem.left, rcItem.bottom + 1, 0, 0, SWP_NOSIZE | SWP_NOZORDER ); m_tab2.ShowWindow(SW_SHOW); return TRUE; // return TRUE unless you set the focus to a control } void CCTabControlDlg::OnSysCommand(UINT nID, LPARAM lParam) { if ((nID & 0xFFF0) == IDM_ABOUTBOX) { CAboutDlg dlgAbout; dlgAbout.DoModal(); } else { CDialog::OnSysCommand(nID, lParam); } } // If you add a minimize button to your dialog, you will need the code below // to draw the icon. For MFC applications using the document/view model, // this is automatically done for you by the framework. void CCTabControlDlg::OnPaint() { if (IsIconic()) { CPaintDC dc(this); // device context for painting SendMessage(WM_ICONERASEBKGND, reinterpret_cast<WPARAM>(dc.GetSafeHdc()), 0); // Center icon in client rectangle int cxIcon = GetSystemMetrics(SM_CXICON); int cyIcon = GetSystemMetrics(SM_CYICON); CRect rect; GetClientRect(&rect); int x = (rect.Width() - cxIcon + 1) / 2; int y = (rect.Height() - cyIcon + 1) / 2; // Draw the icon dc.DrawIcon(x, y, m_hIcon); } else { CDialog::OnPaint(); } } // The system calls this function to obtain the cursor to display while the user drags // the minimized window. HCURSOR CCTabControlDlg::OnQueryDragIcon() { return static_cast<HCURSOR>(m_hIcon); } void CCTabControlDlg::OnTcnSelchangeTabcontrol(NMHDR *pNMHDR, LRESULT *pResult) { // TODO: Add your control notification handler code here *pResult = 0; }

    Read the article

  • Alpha Beta Search

    - by Becky
    I'm making a version of Martian Chess in java with AI and so far I THINK my move searching is semi-working, it seems to work alright for some depths but if I use a depth of 3 it returns a move for the opposite side...now the game is a bit weird because when a piece crosses half of the board, it becomes property of the other player so I think this is part of the problem. I'd be really greatful if someone could look over my code and point out any errors you think are there! (pls note that my evaluation function isn't nearly complete lol) MoveSearch.java public class MoveSearch { private Evaluation evaluate = new Evaluation(); private int blackPlayerScore, whitePlayerScore; public MoveContent bestMove; public MoveSearch(int blackScore, int whiteScore) { blackPlayerScore = blackScore; whitePlayerScore = whiteScore; } private Vector<Position> EvaluateMoves(Board board) { Vector<Position> positions = new Vector<Position>(); for (int i = 0; i < 32; i++) { Piece piece = null; if (!board.chessBoard[i].square.isEmpty()) { // store the piece piece = board.chessBoard[i].square.firstElement(); } // skip empty squares if (piece == null) { continue; } // skip the other players pieces if (piece.pieceColour != board.whosMove) { continue; } // generate valid moves for the piece PieceValidMoves validMoves = new PieceValidMoves(board.chessBoard, i, board.whosMove); validMoves.generateMoves(); // for each valid move for (int j = 0; j < piece.validMoves.size(); j++) { // store it as a position Position move = new Position(); move.startPosition = i; move.endPosition = piece.validMoves.elementAt(j); Piece pieceAttacked = null; if (!board.chessBoard[move.endPosition].square.isEmpty()) { // if the end position is not empty, store the attacked piece pieceAttacked = board.chessBoard[move.endPosition].square.firstElement(); } // if a piece is attacked if (pieceAttacked != null) { // append its value to the move score move.score += pieceAttacked.pieceValue; // if the moving pieces value is less than the value of the attacked piece if (piece.pieceValue < pieceAttacked.pieceValue) { // score extra points move.score += pieceAttacked.pieceValue - piece.pieceValue; } } // add the move to the set of positions positions.add(move); } } return positions; } // EvaluateMoves() private int SideToMoveScore(int score, PieceColour colour) { if (colour == PieceColour.Black){ return -score; } else { return score; } } public int AlphaBeta(Board board, int depth, int alpha, int beta) { //int best = -9999; // if the depth is 0, return the score of the current board if (depth <= 0) { board.printBoard(); System.out.println("Score: " + evaluate.EvaluateBoardScore(board)); System.out.println(""); int boardScore = evaluate.EvaluateBoardScore(board); return SideToMoveScore(boardScore, board.whosMove); } // fill the positions with valid moves Vector<Position> positions = EvaluateMoves(board); // if there are no available positions if (positions.size() == 0) { // and its blacks move if (board.whosMove == PieceColour.Black) { if (blackPlayerScore > whitePlayerScore) { // and they are winning, return a high number return 9999; } else if (whitePlayerScore == blackPlayerScore) { // if its a draw, lower number return 500; } else { // if they are losing, return a very low number return -9999; } } if (board.whosMove == PieceColour.White) { if (whitePlayerScore > blackPlayerScore) { return 9999; } else if (blackPlayerScore == whitePlayerScore) { return 500; } else { return -9999; } } } // for each position for (int i = 0; i < positions.size(); i++) { // store the position Position move = positions.elementAt(i); // temporarily copy the board Board temp = board.copyBoard(board); // make the move temp.makeMove(move.startPosition, move.endPosition); for (int x = 0; x < 32; x++) { if (!temp.chessBoard[x].square.isEmpty()) { PieceValidMoves validMoves = new PieceValidMoves(temp.chessBoard, x, temp.whosMove); validMoves.generateMoves(); } } // repeat the process recursively, decrementing the depth int val = -AlphaBeta(temp, depth - 1, -beta, -alpha); // if the value returned is better than the current best score, replace it if (val >= beta) { // beta cut-off return beta; } if (val > alpha) { alpha = val; bestMove = new MoveContent(alpha, move.startPosition, move.endPosition); } } // return the best score return alpha; } // AlphaBeta() } This is the makeMove method public void makeMove(int startPosition, int endPosition) { // quick reference to selected piece and attacked piece Piece selectedPiece = null; if (!(chessBoard[startPosition].square.isEmpty())) { selectedPiece = chessBoard[startPosition].square.firstElement(); } Piece attackedPiece = null; if (!(chessBoard[endPosition].square.isEmpty())) { attackedPiece = chessBoard[endPosition].square.firstElement(); } // if a piece is taken, amend score if (!(chessBoard[endPosition].square.isEmpty()) && attackedPiece != null) { if (attackedPiece.pieceColour == PieceColour.White) { blackScore = blackScore + attackedPiece.pieceValue; } if (attackedPiece.pieceColour == PieceColour.Black) { whiteScore = whiteScore + attackedPiece.pieceValue; } } // actually move the piece chessBoard[endPosition].square.removeAllElements(); chessBoard[endPosition].addPieceToSquare(selectedPiece); chessBoard[startPosition].square.removeAllElements(); // changing piece colour based on position if (endPosition > 15) { selectedPiece.pieceColour = PieceColour.White; } if (endPosition <= 15) { selectedPiece.pieceColour = PieceColour.Black; } //change to other player if (whosMove == PieceColour.Black) whosMove = PieceColour.White; else if (whosMove == PieceColour.White) whosMove = PieceColour.Black; } // makeMove()

    Read the article

  • Why can't I fetch an AOL captcha image in my Delphi program?

    - by Bill
    New demo code: I am trying to get the captcha image from a AOL, and i keep getting an error 418. unit imageunit; /// /// h t t p s://new.aol.com/productsweb/ /// interface uses Windows, Messages, SysUtils, Variants, Classes, Graphics, Controls, Forms, Dialogs, StdCtrls, IdIOHandler, IdIOHandlerSocket, IdIOHandlerStack, IdSSL, IdSSLOpenSSL, IdIntercept, IdZLibCompressorBase, IdCompressorZLib, IdCookieManager, IdBaseComponent, IdComponent, IdTCPConnection, IdTCPClient, IdHTTP,jpeg,GIFImg, ExtCtrls, PerlRegEx; type TForm2 = class(TForm) IdHTTP1: TIdHTTP; IdCookieManager1: TIdCookieManager; IdCompressorZLib1: TIdCompressorZLib; IdConnectionIntercept1: TIdConnectionIntercept; IdSSLIOHandlerSocketOpenSSL1: TIdSSLIOHandlerSocketOpenSSL; Panel1: TPanel; Image1: TImage; Panel2: TPanel; Button1: TButton; PerlRegEx1: TPerlRegEx; Memo1: TMemo; procedure Button1Click(Sender: TObject); private { Private declarations } public { Public declarations } end; var Form2: TForm2; implementation {$R *.dfm} function getaimcaptchaimage(data:string):string; var Regex: TPerlRegEx; ResultString: string; begin Regex := TPerlRegEx.Create(nil); Regex.RegEx := '= 1 then begin ResultString := Regex.SubExpressions[1]; end; result:=Resultstring; end; end; procedure TForm2.Button1Click(Sender: TObject); var JPI : TJPEGImage; streamdata:TMemoryStream; SStream: Tstringstream; website:string; begin streamdata := TMemoryStream.Create; SStream := tstringstream.Create ( '' ); try idhttp1.Get('h t t p s://new.aol.com/productsweb/',SStream); memo1.Text:=UTF8ToWideString ( SStream.DataString ); website:='h t t p s://new.aol.com/productsweb/WordVerImage'+getaimcaptchaimage( UTF8ToWideString ( SStream.DataString )); form2.Caption:=website; idhttp1.Get(website, Streamdata); Except { Handle exceptions } On E : Exception Do Begin MessageDlg('Exception: '+E.Message,mtError, [mbOK], 0); End; End; //h t t p s://new.aol.com/productsweb/WordVerImage?20890843 //h t t p s://new.aol.com/productsweb/WordVerImage?91868359 /// /// gives error 418 unused /// streamdata.Position := 0; JPI := TJPEGImage.Create; Try JPI.LoadFromStream ( streamdata ); Finally Image1.Picture.Assign ( JPI ); JPI.Free; streamdata.Free; End; end; end. Form: object Form2: TForm2 Left = 0 Top = 0 Caption = 'Form2' ClientHeight = 247 ClientWidth = 480 Color = clBtnFace Font.Charset = DEFAULT_CHARSET Font.Color = clWindowText Font.Height = -11 Font.Name = 'Tahoma' Font.Style = [] OldCreateOrder = False PixelsPerInch = 96 TextHeight = 13 object Panel1: TPanel Left = 0 Top = 41 Width = 480 Height = 206 Align = alClient TabOrder = 0 object Image1: TImage Left = 1 Top = 1 Width = 478 Height = 115 Align = alClient ExplicitLeft = 5 ExplicitTop = 17 ExplicitWidth = 200 ExplicitHeight = 70 end object Memo1: TMemo Left = 1 Top = 116 Width = 478 Height = 89 Align = alBottom TabOrder = 0 ExplicitLeft = 80 ExplicitTop = 152 ExplicitWidth = 185 end end object Panel2: TPanel Left = 0 Top = 0 Width = 480 Height = 41 Align = alTop TabOrder = 1 object Button1: TButton Left = 239 Top = 6 Width = 75 Height = 25 Caption = 'Button1' TabOrder = 0 OnClick = Button1Click end end object IdHTTP1: TIdHTTP Intercept = IdConnectionIntercept1 IOHandler = IdSSLIOHandlerSocketOpenSSL1 MaxAuthRetries = 100 AllowCookies = True HandleRedirects = True RedirectMaximum = 100 ProxyParams.BasicAuthentication = False ProxyParams.ProxyPort = 0 Request.ContentLength = -1 Request.Accept = 'image/gif, image/jpeg, image/pjpeg, image/pjpeg, application/x-s' + 'hockwave-flash, application/cade, application/xaml+xml, applicat' + 'ion/vnd.ms-xpsdocument, application/x-ms-xbap, application/x-ms-' + 'application, */*' Request.BasicAuthentication = False Request.Referer = 'http://www.yahoo.com' Request.UserAgent = 'Mozilla/5.0 (X11; U; Linux i686; en-US; rv:1.9.2.1) Gecko/201001' + '22 firefox/3.6.1' HTTPOptions = [hoForceEncodeParams] CookieManager = IdCookieManager1 Compressor = IdCompressorZLib1 Left = 40 Top = 160 end object IdCookieManager1: TIdCookieManager Left = 360 Top = 136 end object IdCompressorZLib1: TIdCompressorZLib Left = 408 Top = 56 end object IdConnectionIntercept1: TIdConnectionIntercept Left = 304 Top = 72 end object IdSSLIOHandlerSocketOpenSSL1: TIdSSLIOHandlerSocketOpenSSL Intercept = IdConnectionIntercept1 MaxLineAction = maException Port = 0 DefaultPort = 0 SSLOptions.Mode = sslmUnassigned SSLOptions.VerifyMode = [] SSLOptions.VerifyDepth = 0 Left = 192 Top = 136 end object PerlRegEx1: TPerlRegEx Options = [] Left = 120 Top = 56 end end If you go to h t t p s://new.aol.com/productsweb/ you will notice the captcha image has a url like h t t p s://new.aol.com/productsweb/WordVerImage?91868359 I put that url in the edit box and get an error. What is wrong with this code? *take the extra spaces out of the URLs

    Read the article

  • Trouble on setting SSL certificates for Virtual Hosts using Apache\Phusion Passenger in localhost

    - by user502052
    I am using Ruby on Rails 3 and I would like to make to work HTTPS connections on localhost. I am using: Apache v2 + Phusion Passenger Mac OS + Snow Leopard v10.6.6 My Ruby on Rails installation use the Typhoeus gem (it is possible to use the Ruby net\http library but the result doesn't change) to make HTTP requests over HTTPS. I created self-signed ca.key, pjtname.crt and pjtname.key as detailed on the Apple website. Notice: Following instruction from the Apple website, on running the openssl req -new -key server.key -out server.csr command (see the link) at this point Common Name (eg, YOUR name) []: (this is the important one) I entered *pjtname.com so that is valid for all sub_domain of that site. In my Apache httpd.conf I have two virtual hosts configured in this way: # Secure (SSL/TLS) connections #Include /private/etc/apache2/extra/httpd-ssl.conf # # Note: The following must must be present to support # starting without SSL on platforms with no /dev/random equivalent # but a statically compiled-in mod_ssl. # <IfModule ssl_module> SSLRandomSeed startup builtin SSLRandomSeed connect builtin </IfModule> Include /private/etc/apache2/other/*.conf # Passenger configuration LoadModule passenger_module /Users/<my_user_name>/.rvm/gems/ruby-1.9.2-p136/gems/passenger-3.0.2/ext/apache2/mod_passenger.so PassengerRoot /Users/<my_user_name>/.rvm/gems/ruby-1.9.2-p136/gems/passenger-3.0.2 PassengerRuby /Users/<my_user_name>/.rvm/wrappers/ruby-1.9.2-p136/ruby # Go ahead and accept connections for these vhosts # from non-SNI clients SSLStrictSNIVHostCheck off # Ensure that Apache listens on port 443 Listen 443 # Listen for virtual host requests on all IP addresses NameVirtualHost *:80 NameVirtualHost *:443 # # PJTNAME.COM and subdomains SETTING # <VirtualHost *:443> # Because this virtual host is defined first, it will # be used as the default if the hostname is not received # in the SSL handshake, e.g. if the browser doesn't support # SNI. ServerName pjtname.com:443 DocumentRoot "/Users/<my_user_name>/Sites/pjtname.com/pjtname.com/public" ServerAdmin [email protected] ErrorLog "/private/var/log/apache2/error_log" TransferLog "/private/var/log/apache2/access_log" RackEnv development <Directory "/Users/<my_user_name>/Sites/pjtname.com/pjtname.com/public"> Order allow,deny Allow from all </Directory> # SSL Configuration SSLEngine on # Self Signed certificates # Server Certificate SSLCertificateFile /private/etc/apache2/ssl/wildcard.certificate/pjtname.crt # Server Private Key SSLCertificateKeyFile /private/etc/apache2/ssl/wildcard.certificate/pjtname.key # Server Intermediate Bundle SSLCertificateChainFile /private/etc/apache2/ssl/wildcard.certificate/ca.crt </VirtualHost> # HTTP Setting <VirtualHost *:80> ServerName pjtname.com DocumentRoot "/Users/<my_user_name>/Sites/pjtname.com/pjtname.com/public" RackEnv development <Directory "/Users/<my_user_name>/Sites/pjtname.com/pjtname.com/public"> Order allow,deny Allow from all </Directory> </VirtualHost> <VirtualHost *:443> ServerName users.pjtname.com:443 DocumentRoot "/Users/<my_user_name>/Sites/pjtname.com/users.pjtname.com/public" ServerAdmin [email protected] ErrorLog "/private/var/log/apache2/error_log" TransferLog "/private/var/log/apache2/access_log" RackEnv development <Directory "/Users/<my_user_name>/Sites/pjtname.com/users.pjtname.com/public"> Order allow,deny Allow from all </Directory> # SSL Configuration SSLEngine on # Self Signed certificates # Server Certificate SSLCertificateFile /private/etc/apache2/ssl/wildcard.certificate/pjtname.crt # Server Private Key SSLCertificateKeyFile /private/etc/apache2/ssl/wildcard.certificate/pjtname.key # Server Intermediate Bundle SSLCertificateChainFile /private/etc/apache2/ssl/wildcard.certificate/ca.crt </VirtualHost> # HTTP Setting <VirtualHost *:80> ServerName users.pjtname.com DocumentRoot "/Users/<my_user_name>/Sites/pjtname.com/users.pjtname.com/public" RackEnv development <Directory "/Users/<my_user_name>/Sites/pjtname.com/users.pjtname.com/public"> Order allow,deny Allow from all </Directory> </VirtualHost> In the host file I have: ## # Host Database # # localhost is used to configure the loopback interface # when the system is booting. Do not change this entry. ## 127.0.0.1 localhost 255.255.255.255 broadcasthost ::1 localhost fe80::1%lo0 localhost # PJTNAME.COM SETTING 127.0.0.1 pjtname.com 127.0.0.1 users.pjtname.com All seems to work properly because I have already set everything (I think correctly): I generated a wildcard certificate for my domains and sub-domains (in this example: *.pjtname.com) I have set base-named virtualhosts in the http.conf file listening on port :433 and :80 My browser accept certificates also if it alerts me that those aren't safe (notice: I must accept certificates for each domain\sub-domain; that is, [only] at the first time I access a domain or sub-domain over HTTPS I must do the same procedure for acceptance) and I can have access to pages using HTTPS After all this work, when I make a request using Typhoeus (I can use also the Ruby Net::Http library and the result doesn't change) from the pjtname.com RoR application: # Typhoeus request Typhoeus::Request.get("https://users.pjtname.com/") I get something like a warning about the certificate: --- &id001 !ruby/object:Typhoeus::Response app_connect_time: 0.0 body: "" code: 0 connect_time: 0.000625 # Here is the warning curl_error_message: Peer certificate cannot be authenticated with known CA certificates curl_return_code: 60 effective_url: https://users.pjtname.com/ headers: "" http_version: mock: false name_lookup_time: 0.000513 pretransfer_time: 0.0 request: !ruby/object:Typhoeus::Request after_complete: auth_method: body: ... All this means that something is wrong. So, what I have to do to avoid the "Peer certificate cannot be authenticated with known CA certificates" warning and make the HTTPS request to work? Where is\are the error\errors (I think in the Apache configuration, but where?!)? P.S.: if you need some more info, let me know.

    Read the article

  • Python hashable dicts

    - by TokenMacGuy
    As an exercise, and mostly for my own amusement, I'm implementing a backtracking packrat parser. The inspiration for this is i'd like to have a better idea about how hygenic macros would work in an algol-like language (as apposed to the syntax free lisp dialects you normally find them in). Because of this, different passes through the input might see different grammars, so cached parse results are invalid, unless I also store the current version of the grammar along with the cached parse results. (EDIT: a consequence of this use of key-value collections is that they should be immutable, but I don't intend to expose the interface to allow them to be changed, so either mutable or immutable collections are fine) The problem is that python dicts cannot appear as keys to other dicts. Even using a tuple (as I'd be doing anyways) doesn't help. >>> cache = {} >>> rule = {"foo":"bar"} >>> cache[(rule, "baz")] = "quux" Traceback (most recent call last): File "<stdin>", line 1, in <module> TypeError: unhashable type: 'dict' >>> I guess it has to be tuples all the way down. Now the python standard library provides approximately what i'd need, collections.namedtuple has a very different syntax, but can be used as a key. continuing from above session: >>> from collections import namedtuple >>> Rule = namedtuple("Rule",rule.keys()) >>> cache[(Rule(**rule), "baz")] = "quux" >>> cache {(Rule(foo='bar'), 'baz'): 'quux'} Ok. But I have to make a class for each possible combination of keys in the rule I would want to use, which isn't so bad, because each parse rule knows exactly what parameters it uses, so that class can be defined at the same time as the function that parses the rule. But combining the rules together is much more dynamic. In particular, I'd like a simple way to have rules override other rules, but collections.namedtuple has no analogue to dict.update(). Edit: An additional problem with namedtuples is that they are strictly positional. Two tuples that look like they should be different can in fact be the same: >>> you = namedtuple("foo",["bar","baz"]) >>> me = namedtuple("foo",["bar","quux"]) >>> you(bar=1,baz=2) == me(bar=1,quux=2) True >>> bob = namedtuple("foo",["baz","bar"]) >>> you(bar=1,baz=2) == bob(bar=1,baz=2) False tl'dr: How do I get dicts that can be used as keys to other dicts? Having hacked a bit on the answers, here's the more complete solution I'm using. Note that this does a bit extra work to make the resulting dicts vaguely immutable for practical purposes. Of course it's still quite easy to hack around it by calling dict.__setitem__(instance, key, value) but we're all adults here. class hashdict(dict): """ hashable dict implementation, suitable for use as a key into other dicts. >>> h1 = hashdict({"apples": 1, "bananas":2}) >>> h2 = hashdict({"bananas": 3, "mangoes": 5}) >>> h1+h2 hashdict(apples=1, bananas=3, mangoes=5) >>> d1 = {} >>> d1[h1] = "salad" >>> d1[h1] 'salad' >>> d1[h2] Traceback (most recent call last): ... KeyError: hashdict(bananas=3, mangoes=5) based on answers from http://stackoverflow.com/questions/1151658/python-hashable-dicts """ def __key(self): return tuple(sorted(self.items())) def __repr__(self): return "{0}({1})".format(self.__class__.__name__, ", ".join("{0}={1}".format( str(i[0]),repr(i[1])) for i in self.__key())) def __hash__(self): return hash(self.__key()) def __setitem__(self, key, value): raise TypeError("{0} does not support item assignment" .format(self.__class__.__name__)) def __delitem__(self, key): raise TypeError("{0} does not support item assignment" .format(self.__class__.__name__)) def clear(self): raise TypeError("{0} does not support item assignment" .format(self.__class__.__name__)) def pop(self, *args, **kwargs): raise TypeError("{0} does not support item assignment" .format(self.__class__.__name__)) def popitem(self, *args, **kwargs): raise TypeError("{0} does not support item assignment" .format(self.__class__.__name__)) def setdefault(self, *args, **kwargs): raise TypeError("{0} does not support item assignment" .format(self.__class__.__name__)) def update(self, *args, **kwargs): raise TypeError("{0} does not support item assignment" .format(self.__class__.__name__)) def __add__(self, right): result = hashdict(self) dict.update(result, right) return result if __name__ == "__main__": import doctest doctest.testmod()

    Read the article

  • Prefer extension methods for encapsulation and reusability?

    - by tzaman
    edit4: wikified, since this seems to have morphed more into a discussion than a specific question. In C++ programming, it's generally considered good practice to "prefer non-member non-friend functions" instead of instance methods. This has been recommended by Scott Meyers in this classic Dr. Dobbs article, and repeated by Herb Sutter and Andrei Alexandrescu in C++ Coding Standards (item 44); the general argument being that if a function can do its job solely by relying on the public interface exposed by the class, it actually increases encapsulation to have it be external. While this confuses the "packaging" of the class to some extent, the benefits are generally considered worth it. Now, ever since I've started programming in C#, I've had a feeling that here is the ultimate expression of the concept that they're trying to achieve with "non-member, non-friend functions that are part of a class interface". C# adds two crucial components to the mix - the first being interfaces, and the second extension methods: Interfaces allow a class to formally specify their public contract, the methods and properties that they're exposing to the world. Any other class can choose to implement the same interface and fulfill that same contract. Extension methods can be defined on an interface, providing any functionality that can be implemented via the interface to all implementers automatically. And best of all, because of the "instance syntax" sugar and IDE support, they can be called the same way as any other instance method, eliminating the cognitive overhead! So you get the encapsulation benefits of "non-member, non-friend" functions with the convenience of members. Seems like the best of both worlds to me; the .NET library itself providing a shining example in LINQ. However, everywhere I look I see people warning against extension method overuse; even the MSDN page itself states: In general, we recommend that you implement extension methods sparingly and only when you have to. (edit: Even in the current .NET library, I can see places where it would've been useful to have extensions instead of instance methods - for example, all of the utility functions of List<T> (Sort, BinarySearch, FindIndex, etc.) would be incredibly useful if they were lifted up to IList<T> - getting free bonus functionality like that adds a lot more benefit to implementing the interface.) So what's the verdict? Are extension methods the acme of encapsulation and code reuse, or am I just deluding myself? (edit2: In response to Tomas - while C# did start out with Java's (overly, imo) OO mentality, it seems to be embracing more multi-paradigm programming with every new release; the main thrust of this question is whether using extension methods to drive a style change (towards more generic / functional C#) is useful or worthwhile..) edit3: overridable extension methods The only real problem identified so far with this approach, is that you can't specialize extension methods if you need to. I've been thinking about the issue, and I think I've come up with a solution. Suppose I have an interface MyInterface, which I want to extend - I define my extension methods in a MyExtension static class, and pair it with another interface, call it MyExtensionOverrider. MyExtension methods are defined according to this pattern: public static int MyMethod(this MyInterface obj, int arg, bool attemptCast=true) { if (attemptCast && obj is MyExtensionOverrider) { return ((MyExtensionOverrider)obj).MyMethod(arg); } // regular implementation here } The override interface mirrors all of the methods defined in MyExtension, except without the this or attemptCast parameters: public interface MyExtensionOverrider { int MyMethod(int arg); string MyOtherMethod(); } Now, any class can implement the interface and get the default extension functionality: public class MyClass : MyInterface { ... } Anyone that wants to override it with specific implementations can additionally implement the override interface: public class MySpecializedClass : MyInterface, MyExtensionOverrider { public int MyMethod(int arg) { //specialized implementation for one method } public string MyOtherMethod() { // fallback to default for others MyExtension.MyOtherMethod(this, attemptCast: false); } } And there we go: extension methods provided on an interface, with the option of complete extensibility if needed. Fully general too, the interface itself doesn't need to know about the extension / override, and multiple extension / override pairs can be implemented without interfering with each other. I can see three problems with this approach - It's a little bit fragile - the extension methods and override interface have to be kept synchronized manually. It's a little bit ugly - implementing the override interface involves boilerplate for every function you don't want to specialize. It's a little bit slow - there's an extra bool comparison and cast attempt added to the mainline of every method. Still, all those notwithstanding, I think this is the best we can get until there's language support for interface functions. Thoughts?

    Read the article

  • How to refresh DataGrid and DropDown on main page after hiding modal popup

    - by James
    Hi, I am adding records to a database from a modal popup. After hiding the modal popup, the page has not been refreshed even though I have Rebound the controls. I have reviewed a few postings on the web about this but the solution still evades me. I have attached my code after removing some of the extra detail... It seems I need to cause a postback but I don't know what needs to be changed. Some posts have talked about the extender being misplaced. Anyway, thank you James <asp:Content ID="Content1" ContentPlaceHolderID="Head" Runat="Server"> <div class="divBorder"> <asp:DataGrid id="dgrSessionFolders" runat="server" BorderWidth="2px" BorderStyle="Solid" BorderColor="#C0C0FF" Font-Names="Arial" Font-Bold="True" Font-Size="8pt" GridLines="Horizontal" AutoGenerateColumns="False" PageSize="9999" AllowPaging="False" OnItemCommand="dgrSessionFolders_Command" OnItemDataBound="CheckSessionFolderStatus" HorizontalAlign="Left" ForeColor="Blue" ShowFooter="True" CellPadding="2" OnSortCommand="dgrSessionFolders_Sort" AllowSorting="True"> </asp:DataGrid> </div> &nbsp;&nbsp;&nbsp; <asp:Label ID="Errormsg" runat="server" ForeColor="#CC0000"></asp:Label> <asp:UpdatePanel ID="UpdatePanel1" runat="server" RenderMode="Inline" ChildrenAsTriggers="false" UpdateMode="Conditional"> <Triggers> <asp:AsyncPostBackTrigger ControlID="btnEditTopic" /> <asp:AsyncPostBackTrigger ControlID="btnAdd" /> <asp:AsyncPostBackTrigger ControlID="btnUpdate" /> <asp:AsyncPostBackTrigger ControlID="btnDelete" /> <asp:AsyncPostBackTrigger ControlID="btnClear" /> <asp:AsyncPostBackTrigger ControlID="btnAddTopic" /> <asp:AsyncPostBackTrigger ControlID="btnUpdateTopic" /> <asp:AsyncPostBackTrigger ControlID="btnDeleteTopic" /> </Triggers> <ContentTemplate> <asp:panel id="pnl" runat="server" HorizontalAlign="Center" Height="48px" Width="100%" > &nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp; <asp:ImageButton ID="btnEditTopic" runat="server" AlternateText="Edit Topic" ImageUrl="~/App_Themes/Common/images/BtnEditTopic.jpg" Height="28px"> </asp:ImageButton> <cc1:ModalPopupExtender ID="btnEditTopic_ModalPopupExtender" runat="server" BackgroundCssClass="modalBackground" DropShadow="true" Enabled="true" PopupControlID="pnlEditTopic" TargetControlID="btnEditTopicHidden" CancelControlID="btnEditTopicClose"> </cc1:ModalPopupExtender> <asp:ImageButton ID="btnAdd" runat="server" AlternateText="Add Folder" ImageUrl="~/App_Themes/Common/images/BtnAddFolder.jpg" Height="28px"> </asp:ImageButton> <asp:ImageButton ID="btnUpdate" runat="server" AlternateText="Update Folder" ImageUrl="~/App_Themes/Common/images/BtnUpdateFolder.jpg" Height="28px"> </asp:ImageButton> <asp:ImageButton ID="btnDelete" runat="server" AlternateText="Delete Folder" ImageUrl="~/App_Themes/Common/images/BtnDeleteFolder.jpg" Height="28px"> </asp:ImageButton> <asp:ImageButton ID="BtnClear" runat="server" AlternateText="Clear Screen Input Fields" ImageUrl="~/App_Themes/Common/images/BtnAddMode.jpg" Height="28px"> </asp:ImageButton> <asp:Button ID="btnEditTopicHidden" runat="server" Enabled="false" Text="" Style="visibility: hidden" /> </asp:panel> <asp:Panel ID="pnlEditTopic" runat="server" CssClass="modalPopupEditTopic" Style="display: none;" > <table cellspacing="0" class="borderTable0" width="100%" style=""> <tr> <td colspan="10" class="Subhdr" align="center" style="width:100%"> <asp:label id="lblTopicScreenHdr" Cssclass="ScreenHdr" runat="server">Topic Maintenance</asp:label> </td> </tr> <tr> <td colspan="6"> <asp:Label ID="TopicPopErrorMsg" runat="server" ForeColor="#CC0000">&nbsp;</asp:Label> </td> </tr> <tr style="height:4px"> <td colspan="6" align="center"> <asp:ImageButton ID="btnAddTopic" runat="server" AlternateText="Add Topic" ImageUrl="~/App_Themes/Common/images/BtnApply.jpg" Height="28px"> </asp:ImageButton> <asp:ImageButton ID="btnUpdateTopic" runat="server" AlternateText="Update Topic" ImageUrl="~/App_Themes/Common/images/BtnApply.jpg" Height="28px"> </asp:ImageButton> <asp:ImageButton ID="btnDeleteTopic" runat="server" AlternateText="Delete Topic" ImageUrl="~/App_Themes/Common/images/BtnDelete.jpg" Height="28px"> </asp:ImageButton> <asp:ImageButton ID="btnEditTopicClose" runat="server" AlternateText="Close Edit Topic Popup" ImageUrl="~/App_Themes/Common/images/BtnCancel.jpg" Height="28px"> </asp:ImageButton> </td> </tr> </table> </asp:Panel> </ContentTemplate> </asp:UpdatePanel> Private Sub btnAddTopic_Click(ByVal sender As System.Object, ByVal e As System.EventArgs) Handles btnAddTopic.Click 'Add the Topic table entry AddTopic() 'Display an informational message Errormsg.Text = "The Topic has been successfully added, thank you! " Errormsg.ForeColor = Drawing.Color.Blue 'Rebind the Topic Drop Down and set to added Topic ddlSessionTopic.DataBind() ddlSessionTopic.SelectedValue = drTopic("TOPC_ID") 'Rebind the Session Folders grid RebindGrid() 'Hide the Topic Popup btnEditTopic_ModalPopupExtender.Hide() End Sub Private Sub RebindGrid() cnnSQL = New SqlConnection(strConnection) cmdSQL = New SqlCommand("GetSessionFoldersForGrid", cnnSQL) cmdSQL.CommandType = CommandType.StoredProcedure cmdSQL.Parameters.Clear() cnnSQL.Open() dadSQL = New SqlDataAdapter(cmdSQL) dadSQL.SelectCommand = cmdSQL dadSQL.Fill(dtSessionFolderGrid) cnnSQL.Close() dvSessionFolderGrid = dtSessionFolderGrid.DefaultView dvSessionFolderGrid.Sort = String.Format("{0} {1}{2}", so.Sortfield, so.SortDirection, so.SortSuffix) dgrSessionFolders.DataSource = dvSessionFolderGrid dgrSessionFolders.DataBind() End Sub

    Read the article

  • python list mysteriously getting set to something within my django/piston handler

    - by Anverc
    To start, I'm very new to python, let alone Django and Piston. Anyway, I've created a new BaseHandler class "class BaseApiHandler(BaseHandler)" so that I can extend some of the stff that BaseHandler does. This has been working fine until I added a new filter that could limit results to the first or last result. Now I can refresh the api page over and over and sometimes it will limit the result even if I don't include /limit/whatever in my URL... I've added some debug info into my return value to see what is happening, and that's when it gets more weird. this return value will make more sense after you see the code, but here they are for reference: When the results are correct: "statusmsg": "2 hours_detail found with query: {'empid':'22','datestamp':'2009-03-02',}", when the results are incorrect (once you read the code you'll notice two things wrong. First, it doesn't have 'limit':'None', secondly it shouldn't even get this far to begin with. "statusmsg": "1 hours_detail found with query: {'empid':'22','datestamp':'2009-03-02',with limit[0,1](limit,None),}", It may be important to note that I'm the only person with access to the server running this right now, so even if it was a cache issue, it doesn't make sense that I can just refresh and get different results by hitting F5 while viewing: http://localhost/api/hours_detail/datestamp/2009-03-02/empid/22 Here's the code broken into urls.py and handlers.py so that you can see what i'm doing: URLS.PY urlpatterns = patterns('', #hours_detail/id/{id}/empid/{empid}/projid/{projid}/datestamp/{datestamp}/daterange/{fromdate}to{todate}/limit/{first|last}/exact #empid is required # id, empid, projid, datestamp, daterange can be in any order url(r'^api/hours_detail/(?:' + \ r'(?:[/]?id/(?P<id>\d+))?' + \ r'(?:[/]?empid/(?P<empid>\d+))?' + \ r'(?:[/]?projid/(?P<projid>\d+))?' + \ r'(?:[/]?datestamp/(?P<datestamp>\d{4,}[-/\.]\d{2,}[-/\.]\d{2,}))?' + \ r'(?:[/]?daterange/(?P<daterange>(?:\d{4,}[-/\.]\d{2,}[-/\.]\d{2,})(?:to|/-)(?:\d{4,}[-/\.]\d{2,}[-/\.]\d{2,})))?' + \ r')+' + \ r'(?:/limit/(?P<limit>(?:first|last)))?' + \ r'(?:/(?P<exact>exact))?$', hours_detail_resource), HANDLERS.PY # inherit from BaseHandler to add the extra functionality i need to process the possibly null URL params class BaseApiHandler(BaseHandler): # keep track of the handler so the data is represented back to me correctly post_name = 'base' # THIS IS THE LIST IN QUESTION - SOMETIMES IT IS GETTING SET TO [0,1] MYSTERIOUSLY # this gets set to a list when the results are to be limited limit = None def has_limit(self): return (isinstance(self.limit, list) and len(self.limit) == 2) def process_kwarg_read(self, key, value, d_post, b_exact): """ this should be overridden in the derived classes to process kwargs """ pass # override 'read' so we can better handle our api's searching capabilities def read(self, request, *args, **kwargs): d_post = {'status':0,'statusmsg':'Nothing Happened'} try: # setup the named response object # select all employees then filter - querysets are lazy in django # the actual query is only done once data is needed, so this may # seem like some memory hog slow beast, but it's actually not. d_post[self.post_name] = self.queryset(request) # this is a string that holds debug information... it's the string I mentioned before pasting this code s_query = '' b_exact = False if 'exact' in kwargs and kwargs['exact'] <> None: b_exact = True s_query = '\'exact\':True,' for key,value in kwargs.iteritems(): # the regex url possibilities will push None into the kwargs dictionary # if not specified, so just continue looping through if that's the case if value == None or key == 'exact': continue # write to the s_query string so we have a nice error message s_query = '%s\'%s\':\'%s\',' % (s_query, key, value) # now process this key/value kwarg self.process_kwarg_read(key=key, value=value, d_post=d_post, b_exact=b_exact) # end of the kwargs for loop else: if self.has_limit(): # THIS SEEMS TO GET HIT SOMETIMES IF YOU CONSTANTLY REFRESH THE API PAGE, EVEN THOUGH # THE LINE IN THE FOR LOOP WHICH UPDATES s_query DOESN'T GET HIS AND THUS self.process_kwarg_read ALSO # DOESN'T GET HIT SO NEITHER DOES limit = [0,1] s_query = '%swith limit[%s,%s](limit,%s),' % (s_query, self.limit[0], self.limit[1], kwargs['limit']) d_post[self.post_name] = d_post[self.post_name][self.limit[0]:self.limit[1]] if d_post[self.post_name].count() == 0: d_post['status'] = 0 d_post['statusmsg'] = '%s not found with query: {%s}' % (self.post_name, s_query) else: d_post['status'] = 1 d_post['statusmsg'] = '%s %s found with query: {%s}' % (d_post[self.post_name].count(), self.post_name, s_query) except: e = sys.exc_info()[1] d_post['status'] = 0 d_post['statusmsg'] = 'error: %s' % e d_post[self.post_name] = [] return d_post class HoursDetailHandler(BaseApiHandler): #allowed_methods = ('GET',) model = HoursDetail exclude = () post_name = 'hours_detail' def process_kwarg_read(self, key, value, d_post, b_exact): if ... # I have several if/elif statements here that check for other things... # 'self.limit =' only shows up in the following elif: elif key == 'limit': order_by = 'clock_time' if value == 'last': order_by = '-clock_time' d_post[self.post_name] = d_post[self.post_name].order_by(order_by) # TO GET HERE, THE ONLY PLACE IN CODE WHERE self.limit IS SET, YOU MUST HAVE GONE THROUGH # THE value == None CHECK???? self.limit = [0, 1] else: raise NameError def read(self, request, *args, **kwargs): # empid is required, so make sure it exists before running BaseApiHandler's read method if not('empid' in kwargs and kwargs['empid'] <> None and kwargs['empid'] >= 0): return {'status':0,'statusmsg':'empid cannot be empty'} else: return BaseApiHandler.read(self, request, *args, **kwargs) Does anyone have a clue how else self.limit might be getting set to [0, 1] ? Am I misunderstanding kwargs or loops or anything in Python?

    Read the article

  • Son of Suckerfish ie6 problem - right-most dropdown menu also appearing on left side of screen

    - by Kevin Burke
    I'm interning for an NGO in India and trying to fix their website, including updating their menu so it's not the last item on the page to load, and it's centered on the screen. Everything works well enough but when I try out my new menu in IE6, I get this weird error where the content below the menu is padded an extra 30px or so and the material in the right-most drop down appears on the far left of the screen, always visible. When I drop down the rightmost link ("Publications") the content appears both in the correct location and in the same spot on the far left of the screen, and changes color when I hover as well. It's tough to describe, so it would probably be best if you took a look: visit http://sevamandir.org/a30/index.htm in your Internet Explorer 6 browser to see for yourself. I really appreciate your help. Also I'm using a 1000px wide monitor, if there's more hijinks going on outside that space I'd like to know about that too. Here's the relevant code: in the html head: <script> sfHover = function() { var sfEls = document.getElementById("nav").getElementsByTagName("LI"); for (var i=0; i<sfEls.length; i++) { sfEls[i].onmouseover=function() { this.className+=" sfhover"; } sfEls[i].onmouseout=function() { this.className=this.className.replace(new RegExp(" sfhover\\b"), ""); } } } if (window.attachEvent) window.attachEvent("onload", sfHover); </script> text surrounding the menu - the menu is simply <ul id="nav"><li></li></ul> etc. <!--begin catchphrase--> <div style="float:left; height:27px; width:520px; margin:0px; font:16px Arial, Helvetica, sans-serif; font-weight:bold; color:#769841;"> Transforming lives through democratic &amp; participatory development </div> <?php include("menu.php"); ?> </div><!-- end header --> <!--begin main text div--> <div id="maincontent"> Relevant menu CSS: #nav, #nav ul { font:bold 11px Verdana, sans-serif; float: left; width: 980px; list-style: none; line-height: 1; background: white; font-weight: bold; padding: 0; border: solid #769841; border-width: 0; margin: 0 0 1em 0; } #nav a { display: block; width: 140px; /*this is the total width of the upper menu*/ w\idth: 120px; /*this is the width less horizontal padding */ padding: 5px 10px 5px 10px; /*horiz padding is the 2nd & 4th items here - goes Top Right Bottom Left */ color: #ffffff; background:#b6791e; text-decoration: none; } #nav a.daddy { background: url(rightarrow2.gif) center right no-repeat; } #nav li { float: left; padding: 0; width: 140px; /*this needs to be updated to match top #nav a */ background:#b6791e; } #nav li:hover, #nav li a:hover, #nav li:hover a { background:#769841; } #nav li:hover li a { background:#ffffff; color:#769841; } #nav li ul { position: absolute; left: -999em; height: auto; width: 14.4em; w\idth: 13.9em; font-weight: bold; border-width: 0.25em; /*green border around dropdown menu*/ margin: 0; } #nav li ul a { background:#ffffff; color:#769841; } #nav li li { padding-right: 1em; width: 13em; background:#ffffff; } #nav li ul a { width: 13em; w\idth: 9em; } #nav li ul ul { margin: -1.75em 0 0 14em; } #nav li:hover ul ul, #nav li:hover ul ul ul, #nav li.sfhover ul ul, #nav li.sfhover ul ul ul { left: -999em; } #nav li:hover ul, #nav li li:hover ul, #nav li li li:hover ul, #nav li.sfhover ul, #nav li li.sfhover ul, #nav li li li.sfhover ul { left: auto; } #nav li:hover, #nav li.sfhover, { background: #769841; color:#ffe400; } #nav li a:hover, #nav li li a:hover, #nav li:hover li:hover, #nav li.sfhover a:hover { background: #769841; color:#ffe400; }

    Read the article

  • Cascading updates with business key equality: Hibernate best practices?

    - by Traphicone
    I'm new to Hibernate, and while there are literally tons of examples to look at, there seems to be so much flexibility here that it's sometimes very hard to narrow all the options down the best way of doing things. I've been working on a project for a little while now, and despite reading through a lot of books, articles, and forums, I'm still left with a bit of a head scratcher. Any veteran advice would be very appreciated. So, I have a model involving two classes with a one-to-many relationship from parent to child. Each class has a surrogate primary key and a uniquely constrained composite business key. <class name="Container"> <id name="id" type="java.lang.Long"> <generator class="identity"/> </id> <properties name="containerBusinessKey" unique="true" update="false"> <property name="name" not-null="true"/> <property name="owner" not-null="true"/> </properties> <set name="items" inverse="true" cascade="all-delete-orphan"> <key column="container" not-null="true"/> <one-to-many class="Item"/> </set> </class> <class name="Item"> <id name="id" type="java.lang.Long"> <generator class="identity"/> </id> <properties name="itemBusinessKey" unique="true" update="false"> <property name="type" not-null="true"/> <property name="color" not-null="true"/> </properties> <many-to-one name="container" not-null="true" update="false" class="Container"/> </class> The beans behind these mappings are as boring as you can possibly imagine--nothing fancy going on. With that in mind, consider the following code: Container c = new Container("Things", "Me"); c.addItem(new Item("String", "Blue")); c.addItem(new Item("Wax", "Red")); Transaction t = session.beginTransaction(); session.saveOrUpdate(c); t.commit(); Everything works fine the first time, and both the Container and its Items are persisted. If the above code block is executed again, however, Hibernate throws a ConstraintViolationException--duplicate values for the "name" and "owner" columns. Because the new Container instance has a null identifier, Hibernate assumes it is an unsaved transient instance. This is expected but not desired. Since the persistent and transient Container objects have the same business key values, what we really want is to issue an update. It is easy enough to convince Hibernate that our new Container instance is the same as our old one. With a quick query we can get the identifier of the Container we'd like to update, and set our transient object's identifier to match. Container c = new Container("Things", "Me"); c.addItem(new Item("String", "Blue")); c.addItem(new Item("Wax", "Red")); Query query = session.createSQLQuery("SELECT id FROM Container" + "WHERE name = ? AND owner = ?"); query.setString(0, c.getName()); query.setString(1, c.getOwner()); BigInteger id = (BigInteger)query.uniqueResult(); if (id != null) { c.setId(id.longValue()); } Transaction t = session.beginTransaction(); session.saveOrUpdate(c); t.commit(); This almost satisfies Hibernate, but because the one-to-many relationship from Container to Item cascades, the same ConstraintViolationException is also thrown for the child Item objects. My question is: what is the best practice in this situation? It is highly recommended to use surrogate primary keys, and it is also recommended to use business key equality. When you put these two recommendations in to practice together, however, two of the greatest conveniences of Hibernate--saveOrUpdate and cascading operations--seem to be rendered almost completely useless. As I see it, I have only two options: Manually fetch and set the identifier for each object in the mapping. This clearly works, but for even a moderately sized schema this is a lot of extra work which it seems Hibernate could easily be doing. Write a custom interceptor to fetch and set object identifiers on each operation. This looks cleaner than the first option but is rather heavy-handed, and it seems wrong to me that you should be expected to write a plug-in which overrides Hibernate's default behavior for a mapping which follows the recommended design. Is there a better way? Am I making completely the wrong assumptions? I'm hoping that I'm just missing something. Thanks.

    Read the article

  • linux thread synchronization

    - by johnnycrash
    I am new to linux and linux threads. I have spent some time googling to try to understand the differences between all the functions available for thread synchronization. I still have some questions. I have found all of these different types of synchronizations, each with a number of functions for locking, unlocking, testing the lock, etc. gcc atomic operations futexes mutexes spinlocks seqlocks rculocks conditions semaphores My current (but probably flawed) understanding is this: semaphores are process wide, involve the filesystem (virtually I assume), and are probably the slowest. Futexes might be the base locking mechanism used by mutexes, spinlocks, seqlocks, and rculocks. Futexes might be faster than the locking mechanisms that are based on them. Spinlocks dont block and thus avoid context swtiches. However they avoid the context switch at the expense of consuming all the cycles on a CPU until the lock is released (spinning). They should only should be used on multi processor systems for obvious reasons. Never sleep in a spinlock. The seq lock just tells you when you finished your work if a writer changed the data the work was based on. You have to go back and repeat the work in this case. Atomic operations are the fastest synch call, and probably are used in all the above locking mechanisms. You do not want to use atomic operations on all the fields in your shared data. You want to use a lock (mutex, futex, spin, seq, rcu) or a single atomic opertation on a lock flag when you are accessing multiple data fields. My questions go like this: Am I right so far with my assumptions? Does anyone know the cpu cycle cost of the various options? I am adding parallelism to the app so we can get better wall time response at the expense of running fewer app instances per box. Performances is the utmost consideration. I don't want to consume cpu with context switching, spinning, or lots of extra cpu cycles to read and write shared memory. I am absolutely concerned with number of cpu cycles consumed. Which (if any) of the locks prevent interruption of a thread by the scheduler or interrupt...or am I just an idiot and all synchonization mechanisms do this. What kinds of interruption are prevented? Can I block all threads or threads just on the locking thread's CPU? This question stems from my fear of interrupting a thread holding a lock for a very commonly used function. I expect that the scheduler might schedule any number of other workers who will likely run into this function and then block because it was locked. A lot of context switching would be wasted until the thread with the lock gets rescheduled and finishes. I can re-write this function to minimize lock time, but still it is so commonly called I would like to use a lock that prevents interruption...across all processors. I am writing user code...so I get software interrupts, not hardware ones...right? I should stay away from any functions (spin/seq locks) that have the word "irq" in them. Which locks are for writing kernel or driver code and which are meant for user mode? Does anyone think using an atomic operation to have multiple threads move through a linked list is nuts? I am thinking to atomicly change the current item pointer to the next item in the list. If the attempt works, then the thread can safely use the data the current item pointed to before it was moved. Other threads would now be moved along the list. futexes? Any reason to use them instead of mutexes? Is there a better way than using a condition to sleep a thread when there is no work? When using gcc atomic ops, specifically the test_and_set, can I get a performance increase by doing a non atomic test first and then using test_and_set to confirm? *I know this will be case specific, so here is the case. There is a large collection of work items, say thousands. Each work item has a flag that is initialized to 0. When a thread has exclusive access to the work item, the flag will be one. There will be lots of worker threads. Any time a thread is looking for work, they can non atomicly test for 1. If they read a 1, we know for certain that the work is unavailable. If they read a zero, they need to perform the atomic test_and_set to confirm. So if the atomic test_and_set is 500 cpu cycles because it is disabling pipelining, causes cpu's to communicate and L2 caches to flush/fill .... and a simple test is 1 cycle .... then as long as I had a better ratio of 500 to 1 when it came to stumbling upon already completed work items....this would be a win.* I hope to use mutexes or spinlocks to sparilngly protect sections of code that I want only one thread on the SYSTEM (not jsut the CPU) to access at a time. I hope to sparingly use gcc atomic ops to select work and minimize use of mutexes and spinlocks. For instance: a flag in a work item can be checked to see if a thread has worked it (0=no, 1=yes or in progress). A simple test_and_set tells the thread if it has work or needs to move on. I hope to use conditions to wake up threads when there is work. Thanks!

    Read the article

  • C# Reading and Writing a Char[] to and from a Byte[] - Updated with Solution

    - by Simon G
    Hi, I have a byte array of around 10,000 bytes which is basically a blob from delphi that contains char, string, double and arrays of various types. This need to be read in and updated via C#. I've created a very basic reader that gets the byte array from the db and converts the bytes to the relevant object type when accessing the property which works fine. My problem is when I try to write to a specific char[] item, it doesn't seem to update the byte array. I've created the following extensions for reading and writing: public static class CharExtension { public static byte ToByte( this char c ) { return Convert.ToByte( c ); } public static byte ToByte( this char c, int position, byte[] blob ) { byte b = c.ToByte(); blob[position] = b; return b; } } public static class CharArrayExtension { public static byte[] ToByteArray( this char[] c ) { byte[] b = new byte[c.Length]; for ( int i = 1; i < c.Length; i++ ) { b[i] = c[i].ToByte(); } return b; } public static byte[] ToByteArray( this char[] c, int positon, int length, byte[] blob ) { byte[] b = c.ToByteArray(); Array.Copy( b, 0, blob, positon, length ); return b; } } public static class ByteExtension { public static char ToChar( this byte[] b, int position ) { return Convert.ToChar( b[position] ); } } public static class ByteArrayExtension { public static char[] ToCharArray( this byte[] b, int position, int length ) { char[] c = new char[length]; for ( int i = 0; i < length; i++ ) { c[i] = b.ToChar( position ); position += 1; } return c; } } to read and write chars and char arrays my code looks like: Byte[] _Blob; // set from a db field public char ubin { get { return _tariffBlob.ToChar( 14 ); } set { value.ToByte( 14, _Blob ); } } public char[] usercaplas { get { return _tariffBlob.ToCharArray( 2035, 10 ); } set { value.ToByteArray( 2035, 10, _Blob ); } } So to write to the objects I can do: ubin = 'C'; // this will update the byte[] usercaplas = new char[10] { 'A', 'B', etc. }; // this will update the byte[] usercaplas[3] = 'C'; // this does not update the byte[] I know the reason is that the setter property is not being called but I want to know is there a way around this using code similar to what I already have? I know a possible solution is to use a private variable called _usercaplas that I set and update as needed however as the byte array is nearly 10,000 bytes in length the class is already long and I would like a simpler approach as to reduce the overall code length and complexity. Thank Solution Here's my solution should anyone want it. If you have a better way of doing then let me know please. First I created a new class for the array: public class CharArrayList : ArrayList { char[] arr; private byte[] blob; private int length = 0; private int position = 0; public CharArrayList( byte[] blob, int position, int length ) { this.blob = blob; this.length = length; this.position = position; PopulateInternalArray(); SetArray(); } private void PopulateInternalArray() { arr = blob.ToCharArray( position, length ); } private void SetArray() { foreach ( char c in arr ) { this.Add( c ); } } private void UpdateInternalArray() { this.Clear(); SetArray(); } public char this[int i] { get { return arr[i]; } set { arr[i] = value; UpdateInternalArray(); } } } Then I created a couple of extension methods to help with converting to a byte[] public static byte[] ToByteArray( this CharArrayList c ) { byte[] b = new byte[c.Count]; for ( int i = 0; i < c.Count; i++ ) { b[i] = Convert.ToChar( c[i] ).ToByte(); } return b; } public static byte[] ToByteArray( this CharArrayList c, byte[] blob, int position, int length ) { byte[] b = c.ToByteArray(); Array.Copy( b, 0, blob, position, length ); return b; } So to read and write to the object: private CharArrayList _usercaplass; public CharArrayList usercaplas { get { if ( _usercaplass == null ) _usercaplass = new CharArrayList( _tariffBlob, 2035, 100 ); return _usercaplass; } set { _usercaplass = value; _usercaplass.ToByteArray( _tariffBlob, 2035, 100 ); } } As mentioned before its not an ideal solutions as I have to have private variables and extra code in the setter but I couldnt see a way around it.

    Read the article

  • Python - Converting CSV to Objects - Code Design

    - by victorhooi
    Hi, I have a small script we're using to read in a CSV file containing employees, and perform some basic manipulations on that data. We read in the data (import_gd_dump), and create an Employees object, containing a list of Employee objects (maybe I should think of a better naming convention...lol). We then call clean_all_phone_numbers() on Employees, which calls clean_phone_number() on each Employee, as well as lookup_all_supervisors(), on Employees. import csv import re import sys #class CSVLoader: # """Virtual class to assist with loading in CSV files.""" # def import_gd_dump(self, input_file='Gp Directory 20100331 original.csv'): # gd_extract = csv.DictReader(open(input_file), dialect='excel') # employees = [] # for row in gd_extract: # curr_employee = Employee(row) # employees.append(curr_employee) # return employees # #self.employees = {row['dbdirid']:row for row in gd_extract} # Previously, this was inside a (virtual) class called "CSVLoader". # However, according to here (http://tomayko.com/writings/the-static-method-thing) - the idiomatic way of doing this in Python is not with a class-fucntion but with a module-level function def import_gd_dump(input_file='Gp Directory 20100331 original.csv'): """Return a list ('employee') of dict objects, taken from a Group Directory CSV file.""" gd_extract = csv.DictReader(open(input_file), dialect='excel') employees = [] for row in gd_extract: employees.append(row) return employees def write_gd_formatted(employees_dict, output_file="gd_formatted.csv"): """Read in an Employees() object, and write out each Employee() inside this to a CSV file""" gd_output_fieldnames = ('hrid', 'mail', 'givenName', 'sn', 'dbcostcenter', 'dbdirid', 'hrreportsto', 'PHFull', 'PHFull_message', 'SupervisorEmail', 'SupervisorFirstName', 'SupervisorSurname') try: gd_formatted = csv.DictWriter(open(output_file, 'w', newline=''), fieldnames=gd_output_fieldnames, extrasaction='ignore', dialect='excel') except IOError: print('Unable to open file, IO error (Is it locked?)') sys.exit(1) headers = {n:n for n in gd_output_fieldnames} gd_formatted.writerow(headers) for employee in employees_dict.employee_list: # We're using the employee object's inbuilt __dict__ attribute - hmm, is this good practice? gd_formatted.writerow(employee.__dict__) class Employee: """An Employee in the system, with employee attributes (name, email, cost-centre etc.)""" def __init__(self, employee_attributes): """We use the Employee constructor to convert a dictionary into instance attributes.""" for k, v in employee_attributes.items(): setattr(self, k, v) def clean_phone_number(self): """Perform some rudimentary checks and corrections, to make sure numbers are in the right format. Numbers should be in the form 0XYYYYYYYY, where X is the area code, and Y is the local number.""" if self.telephoneNumber is None or self.telephoneNumber == '': return '', 'Missing phone number.' else: standard_format = re.compile(r'^\+(?P<intl_prefix>\d{2})\((?P<area_code>\d)\)(?P<local_first_half>\d{4})-(?P<local_second_half>\d{4})') extra_zero = re.compile(r'^\+(?P<intl_prefix>\d{2})\(0(?P<area_code>\d)\)(?P<local_first_half>\d{4})-(?P<local_second_half>\d{4})') missing_hyphen = re.compile(r'^\+(?P<intl_prefix>\d{2})\(0(?P<area_code>\d)\)(?P<local_first_half>\d{4})(?P<local_second_half>\d{4})') if standard_format.search(self.telephoneNumber): result = standard_format.search(self.telephoneNumber) return '0' + result.group('area_code') + result.group('local_first_half') + result.group('local_second_half'), '' elif extra_zero.search(self.telephoneNumber): result = extra_zero.search(self.telephoneNumber) return '0' + result.group('area_code') + result.group('local_first_half') + result.group('local_second_half'), 'Extra zero in area code - ask user to remediate. ' elif missing_hyphen.search(self.telephoneNumber): result = missing_hyphen.search(self.telephoneNumber) return '0' + result.group('area_code') + result.group('local_first_half') + result.group('local_second_half'), 'Missing hyphen in local component - ask user to remediate. ' else: return '', "Number didn't match recognised format. Original text is: " + self.telephoneNumber class Employees: def __init__(self, import_list): self.employee_list = [] for employee in import_list: self.employee_list.append(Employee(employee)) def clean_all_phone_numbers(self): for employee in self.employee_list: #Should we just set this directly in Employee.clean_phone_number() instead? employee.PHFull, employee.PHFull_message = employee.clean_phone_number() # Hmm, the search is O(n^2) - there's probably a better way of doing this search? def lookup_all_supervisors(self): for employee in self.employee_list: if employee.hrreportsto is not None and employee.hrreportsto != '': for supervisor in self.employee_list: if supervisor.hrid == employee.hrreportsto: (employee.SupervisorEmail, employee.SupervisorFirstName, employee.SupervisorSurname) = supervisor.mail, supervisor.givenName, supervisor.sn break else: (employee.SupervisorEmail, employee.SupervisorFirstName, employee.SupervisorSurname) = ('Supervisor not found.', 'Supervisor not found.', 'Supervisor not found.') else: (employee.SupervisorEmail, employee.SupervisorFirstName, employee.SupervisorSurname) = ('Supervisor not set.', 'Supervisor not set.', 'Supervisor not set.') #Is thre a more pythonic way of doing this? def print_employees(self): for employee in self.employee_list: print(employee.__dict__) if __name__ == '__main__': db_employees = Employees(import_gd_dump()) db_employees.clean_all_phone_numbers() db_employees.lookup_all_supervisors() #db_employees.print_employees() write_gd_formatted(db_employees) Firstly, my preamble question is, can you see anything inherently wrong with the above, from either a class design or Python point-of-view? Is the logic/design sound? Anyhow, to the specifics: The Employees object has a method, clean_all_phone_numbers(), which calls clean_phone_number() on each Employee object inside it. Is this bad design? If so, why? Also, is the way I'm calling lookup_all_supervisors() bad? Originally, I wrapped the clean_phone_number() and lookup_supervisor() method in a single function, with a single for-loop inside it. clean_phone_number is O(n), I believe, lookup_supervisor is O(n^2) - is it ok splitting it into two loops like this? In clean_all_phone_numbers(), I'm looping on the Employee objects, and settings their values using return/assignment - should I be setting this inside clean_phone_number() itself? There's also a few things that I'm sorted of hacked out, not sure if they're bad practice - e.g. print_employee() and gd_formatted() both use __dict__, and the constructor for Employee uses setattr() to convert a dictionary into instance attributes. I'd value any thoughts at all. If you think the questions are too broad, let me know and I can repost as several split up (I just didn't want to pollute the boards with multiple similar questions, and the three questions are more or less fairly tightly related). Cheers, Victor

    Read the article

  • Trouble with copying dictionaries and using deepcopy on an SQLAlchemy ORM object

    - by Az
    Hi there, I'm doing a Simulated Annealing algorithm to optimise a given allocation of students and projects. This is language-agnostic pseudocode from Wikipedia: s ? s0; e ? E(s) // Initial state, energy. sbest ? s; ebest ? e // Initial "best" solution k ? 0 // Energy evaluation count. while k < kmax and e > emax // While time left & not good enough: snew ? neighbour(s) // Pick some neighbour. enew ? E(snew) // Compute its energy. if enew < ebest then // Is this a new best? sbest ? snew; ebest ? enew // Save 'new neighbour' to 'best found'. if P(e, enew, temp(k/kmax)) > random() then // Should we move to it? s ? snew; e ? enew // Yes, change state. k ? k + 1 // One more evaluation done return sbest // Return the best solution found. The following is an adaptation of the technique. My supervisor said the idea is fine in theory. First I pick up some allocation (i.e. an entire dictionary of students and their allocated projects, including the ranks for the projects) from entire set of randomised allocations, copy it and pass it to my function. Let's call this allocation aOld (it is a dictionary). aOld has a weight related to it called wOld. The weighting is described below. The function does the following: Let this allocation, aOld be the best_node From all the students, pick a random number of students and stick in a list Strip (DEALLOCATE) them of their projects ++ reflect the changes for projects (allocated parameter is now False) and lecturers (free up slots if one or more of their projects are no longer allocated) Randomise that list Try assigning (REALLOCATE) everyone in that list projects again Calculate the weight (add up ranks, rank 1 = 1, rank 2 = 2... and no project rank = 101) For this new allocation aNew, if the weight wNew is smaller than the allocation weight wOld I picked up at the beginning, then this is the best_node (as defined by the Simulated Annealing algorithm above). Apply the algorithm to aNew and continue. If wOld < wNew, then apply the algorithm to aOld again and continue. The allocations/data-points are expressed as "nodes" such that a node = (weight, allocation_dict, projects_dict, lecturers_dict) Right now, I can only perform this algorithm once, but I'll need to try for a number N (denoted by kmax in the Wikipedia snippet) and make sure I always have with me, the previous node and the best_node. So that I don't modify my original dictionaries (which I might want to reset to), I've done a shallow copy of the dictionaries. From what I've read in the docs, it seems that it only copies the references and since my dictionaries contain objects, changing the copied dictionary ends up changing the objects anyway. So I tried to use copy.deepcopy().These dictionaries refer to objects that have been mapped with SQLA. Questions: I've been given some solutions to the problems faced but due to my über green-ness with using Python, they all sound rather cryptic to me. Deepcopy isn't playing nicely with SQLA. I've been told thatdeepcopy on ORM objects probably has issues that prevent it from working as you'd expect. Apparently I'd be better off "building copy constructors, i.e. def copy(self): return FooBar(....)." Can someone please explain what that means? I checked and found out that deepcopy has issues because SQLAlchemy places extra information on your objects, i.e. an _sa_instance_state attribute, that I wouldn't want in the copy but is necessary for the object to have. I've been told: "There are ways to manually blow away the old _sa_instance_state and put a new one on the object, but the most straightforward is to make a new object with __init__() and set up the attributes that are significant, instead of doing a full deep copy." What exactly does that mean? Do I create a new, unmapped class similar to the old, mapped one? An alternate solution is that I'd have to "implement __deepcopy__() on your objects and ensure that a new _sa_instance_state is set up, there are functions in sqlalchemy.orm.attributes which can help with that." Once again this is beyond me so could someone kindly explain what it means? A more general question: given the above information are there any suggestions on how I can maintain the information/state for the best_node (which must always persist through my while loop) and the previous_node, if my actual objects (referenced by the dictionaries, therefore the nodes) are changing due to the deallocation/reallocation taking place? That is, without using copy?

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • App crashes when adding array data to table cells

    - by bassmandan
    I am trying to create a table view that loads a number of tweets into the table (one per cell etc). I am using NSXMLParser to get the information and have got as far as creating an array with the selection of tweets that I want. However, when I try to add them to the table cells, the app crashes on the line: cell.textLabel.text = cellValue; An NSLog before this shows in the console that the app is getting the correct data, so I am a bit stumped as to why this isn't working. This is the block of code that appears to be having the problem: - (UITableViewCell *)tableView:(UITableView *)tableView cellForRowAtIndexPath:(NSIndexPath *)indexPath { static NSString *CellIdentifier = @"Cell"; UITableViewCell *cell = [tableView dequeueReusableCellWithIdentifier:CellIdentifier]; if (cell == nil) { cell = [[UITableViewCell alloc] initWithStyle:UITableViewCellStyleDefault reuseIdentifier:CellIdentifier]; } // Set up the cell... NSString *cellValue = [statuses objectAtIndex:indexPath.row]; NSLog(@"%@", cellValue); cell.textLabel.text = cellValue; return cell;} If it makes a difference, I am using ARC and the latest version of XCode. I'm still quite new to all this, so if I need to give some extra information, let me know. Thanks in advance. Edit: Backtrace gives the following: * thread #1: tid = 0x2003, 0x918a19c6 libsystem_kernel.dylib`__pthread_kill + 10, stop reason = signal SIGABRT frame #0: 0x918a19c6 libsystem_kernel.dylib`__pthread_kill + 10 frame #1: 0x9968ff78 libsystem_c.dylib`pthread_kill + 106 frame #2: 0x99680bdd libsystem_c.dylib`abort + 167 frame #3: 0x03c93e78 libc++abi.dylib`_Unwind_DeleteException frame #4: 0x03c9189e libc++abi.dylib`_ZL17default_terminatev + 34 frame #5: 0x0154df4b libobjc.A.dylib`_objc_terminate + 94 frame #6: 0x03c918de libc++abi.dylib`_ZL19safe_handler_callerPFvvE + 13 frame #7: 0x03c91946 libc++abi.dylib`std::terminate() + 23 frame #8: 0x03c92ab2 libc++abi.dylib`__cxa_throw + 110 frame #9: 0x0154de15 libobjc.A.dylib`objc_exception_throw + 311 frame #10: 0x013bdced CoreFoundation`-[NSObject doesNotRecognizeSelector:] + 253 frame #11: 0x01322f00 CoreFoundation`___forwarding___ + 432 frame #12: 0x01322ce2 CoreFoundation`_CF_forwarding_prep_0 + 50 frame #13: 0x0015168f UIKit`-[UILabel setText:] + 56 frame #14: 0x00003088 Twitter`-[TwitterViewController tableView:cellForRowAtIndexPath:] + 376 at TwitterViewController.m:131 frame #15: 0x000ace0f UIKit`-[UITableView(UITableViewInternal) _createPreparedCellForGlobalRow:withIndexPath:] + 494 frame #16: 0x000ad589 UIKit`-[UITableView(UITableViewInternal) _createPreparedCellForGlobalRow:] + 69 frame #17: 0x00098dfd UIKit`-[UITableView(_UITableViewPrivate) _updateVisibleCellsNow:] + 1350 frame #18: 0x000a7851 UIKit`-[UITableView layoutSubviews] + 242 frame #19: 0x00052301 UIKit`-[UIView(CALayerDelegate) layoutSublayersOfLayer:] + 145 frame #20: 0x013bde72 CoreFoundation`-[NSObject performSelector:withObject:] + 66 frame #21: 0x01d6692d QuartzCore`-[CALayer layoutSublayers] + 266 frame #22: 0x01d70827 QuartzCore`CA::Layer::layout_if_needed(CA::Transaction*) + 231 frame #23: 0x01cf6fa7 QuartzCore`CA::Context::commit_transaction(CA::Transaction*) + 377 frame #24: 0x01cf8ea6 QuartzCore`CA::Transaction::commit() + 374 frame #25: 0x01d8430c QuartzCore`+[CATransaction flush] + 52 frame #26: 0x000124c6 UIKit`-[UIApplication _reportAppLaunchFinished] + 39 frame #27: 0x00012bd6 UIKit`-[UIApplication _runWithURL:payload:launchOrientation:statusBarStyle:statusBarHidden:] + 1324 frame #28: 0x00021743 UIKit`-[UIApplication handleEvent:withNewEvent:] + 1027 frame #29: 0x000221f8 UIKit`-[UIApplication sendEvent:] + 68 frame #30: 0x00015aa9 UIKit`_UIApplicationHandleEvent + 8196 frame #31: 0x012a6fa9 GraphicsServices`PurpleEventCallback + 1274 frame #32: 0x013901c5 CoreFoundation`__CFRUNLOOP_IS_CALLING_OUT_TO_A_SOURCE1_PERFORM_FUNCTION__ + 53 frame #33: 0x012f5022 CoreFoundation`__CFRunLoopDoSource1 + 146 frame #34: 0x012f390a CoreFoundation`__CFRunLoopRun + 2218 frame #35: 0x012f2db4 CoreFoundation`CFRunLoopRunSpecific + 212 frame #36: 0x012f2ccb CoreFoundation`CFRunLoopRunInMode + 123 frame #37: 0x000122a7 UIKit`-[UIApplication _run] + 576 frame #38: 0x00013a9b UIKit`UIApplicationMain + 1175 frame #39: 0x0000239d Twitter`main + 141 at main.m:16 frame #40: 0x00002305 Twitter`start + 53 Debugging console shows this: 2012-04-08 10:10:05.084 Twitter[25309:f803] ( { text = "Have you shared the Shakedown yet? http://t.co/WHrIC9w7"; }, { text = "For all you closet rocknrollas pencil in Sat 12th May The Rebirth of Rock n Roll Party. Haywire Saint @ The Good... http://t.co/OXHKlLIV"; }, { text = "4 weeks today: Vocal tracks will be getting recorded at The Premises Studios"; }, { text = "Rehearsal tonight in preparation to some big recording next month!"; }, { text = "haywire saint 'great taste.' Tune. \n\nhttp://t.co/GKmu5Lna http://t.co/0fii55Hw"; }, { text = "Meeting up with an old roadie for The Cure today. oh the stories...... http://t.co/UeUYccme"; }, { text = "Satisfying day of programming today.. Haywire Saint app coming along nicely with the custom music player ready to rock 'n' roll!"; }, { text = "Happy Friday Everyone!"; }, { text = "We had a great time at The Premises Studios yesterday. We'll be back there before long :D x"; }, { text = "I posted a new photo to Facebook http://t.co/73qAnCvk"; } ) 2012-04-08 10:10:05.093 Twitter[25309:f803] { text = "Have you shared the Shakedown yet? http://t.co/WHrIC9w7"; } 2012-04-08 10:10:05.094 Twitter[25309:f803] -[__NSCFDictionary isEqualToString:]: unrecognized selector sent to instance 0x6877a50 2012-04-08 10:10:05.096 Twitter[25309:f803] *** Terminating app due to uncaught exception 'NSInvalidArgumentException', reason: '-[__NSCFDictionary isEqualToString:]: unrecognized selector sent to instance 0x6877a50' *** First throw call stack: (0x13bc052 0x154dd0a 0x13bdced 0x1322f00 0x1322ce2 0x15168f 0x3088 0xace0f 0xad589 0x98dfd 0xa7851 0x52301 0x13bde72 0x1d6692d 0x1d70827 0x1cf6fa7 0x1cf8ea6 0x1d8430c 0x124c6 0x12bd6 0x21743 0x221f8 0x15aa9 0x12a6fa9 0x13901c5 0x12f5022 0x12f390a 0x12f2db4 0x12f2ccb 0x122a7 0x13a9b 0x239d 0x2305) terminate called throwing an exception2012-04-08 10:10:05.924 Twitter[25309:f803] -[__NSCFConstantString count]: unrecognized selector sent to instance 0x5b30

    Read the article

  • Undefined reference to ...

    - by Patrick LaChance
    I keep getting this error message every time I try to compile, and I cannot find out what the problem is. any help would be greatly appreciated: C:\DOCUME~1\Patrick\LOCALS~1\Temp/ccL92mj9.o:main.cpp:(.txt+0x184): undefined reference to 'List::List()' C:\DOCUME~1\Patrick\LOCALS~1\Temp/ccL92mj9.o:main.cpp:(.txt+0x184): undefined reference to 'List::add(int)' collect2: ld returned 1 exit status code: //List.h #ifndef LIST_H #define LIST_H #include <exception> //brief Definition of linked list class class List { public: /** \brief Exception for operating on empty list */ class Empty : public std::exception { public: virtual const char* what() const throw(); }; /** \brief Exception for invalid operations other than operating on an empty list */ class InvalidOperation : public std::exception { public: virtual const char* what() const throw(); }; /** \brief Node within List */ class Node { public: /** data element stored in this node */ int element; /** next node in list */ Node* next; /** previous node in list */ Node* previous; Node (int element); ~Node(); void print() const; void printDebug() const; }; List(); ~List(); void add(int element); void remove(int element); int first()const; int last()const; int removeFirst(); int removeLast(); bool isEmpty()const; int size()const; void printForward() const; void printReverse() const; void printDebug() const; /** enables extra output for debugging purposes */ static bool traceOn; private: /** head of list */ Node* head; /** tail of list */ Node* tail; /** count of number of nodes */ int count; }; #endif //List.cpp I only included the parts of List.cpp that might be the issue #include "List.h" #include <iostream> #include <iomanip> using namespace std; List::List() { //List::size = NULL; head = NULL; tail = NULL; } List::~List() { Node* current; while(head != NULL) { current = head-> next; delete current->previous; if (current->next!=NULL) { head = current; } else { delete current; } } } void List::add(int element) { Node* newNode; Node* current; newNode->element = element; if(newNode->element > head->element) { current = head->next; } else { head->previous = newNode; newNode->next = head; newNode->previous = NULL; return; } while(newNode->element > current->element) { current = current->next; } if(newNode->element <= current->element) { newNode->previous = current->previous; newNode->next = current; } } //main.cpp #include "List.h" #include <iostream> #include <string> using namespace std; //void add(int element); int main (char** argv, int argc) { List* MyList = new List(); bool quit = false; string value; int element; while(quit==false) { cin>>value; if(value == "add") { cin>>element; MyList->add(element); } if(value=="quit") { quit = true; } } return 0; } I'm doing everything I think I'm suppose to be doing. main.cpp isn't complete yet, just trying to get the add function to work first. Any help will be greatly appreciated.

    Read the article

< Previous Page | 200 201 202 203 204 205 206 207 208 209  | Next Page >