Search Results

Search found 37048 results on 1482 pages for 'whole line'.

Page 209/1482 | < Previous Page | 205 206 207 208 209 210 211 212 213 214 215 216  | Next Page >

  • sorry for asking again the same user here help me out

    - by jazz
    i copied a game from a book which name is paratrooper i ask this question again i also provide the code of the objects which i create there i want to change the color of these objects but i didn't understand how to do that so can any one plz help me how to do that.Listen guys they are not the standard functions but i use the graphics library for these functions and i can't find the function in the library file of graphics. i hope u understand know.this code will not run properly so plz tell me something about the function which color it i can't put the image other wize i show u the image it will make alot easieer #include "graphics.h" #include "stdio.h" #include "conio.h" #include "process.h" #include "alloc.h" #include "stdlib.h" #include "math.h" #include "dos.h" main() { int gm=CGAHI, gd=CGA, key=0, area; initgraph(&gd, &gm, "C:\tc\bgi"); helidraw(246,50,-1); getch(); return 0; } helidraw ( int x, int y, int d ) { int direction, i, j ; if ( d ) direction = -1 ; else direction = 1 ; i = 3 ; j = 8 ; line ( x - j - 8, y - i - 2, x + j + 8, y - i - 2 ) ; line ( x - j + 5, y - i - 1, x + j - 5, y - i - 1 ) ; line ( x - j, y - i, x + j, y - i ) ; for ( ; i 0 ; i--, j += 2 ) { putpixel ( x - ( direction * j ), y - i, 1 ) ; line ( x + ( direction * j ), y - i, x + ( direction * ( j - 8 ) ), y - i ) ; } i = 0 ; j -= 2 ; line ( x - ( direction * j ), y - i, x - ( direction * ( j + 17 ) ), y - i ) ; line ( x - ( direction * j ), y - i + 1, x - ( direction * ( j + 7 ) ), y - i + 1 ) ; putpixel ( x - ( direction * ( j + 19 ) ), y - i - 1, 1 ) ; for ( ; i < 3 ; i++, j -= 2 ) { putpixel ( x - j, y + i, 1 ) ; putpixel ( x + j, y + i, 1 ) ; } line ( x - j, y + i, x + j, y + i ) ; putpixel ( x - j + 3, y + i + 1, 1 ) ; putpixel ( x + j - 3, y + i + 1, 1 ) ; line ( x - j - 10, y + i + 2, x + j + 10, y + i + 2 ) ; putpixel ( x + ( direction * ( j + 12 ) ), y + i + 1, 1 ) ; }

    Read the article

  • XSD and plain text

    - by Paul Knopf
    I have a rest/xml service that gives me the following... <verse-unit unit-id="38009001"> <marker class="begin-verse" mid="v38009001"/> <begin-chapter num="9"/><heading>Judgment on Israel&apos;s Enemies</heading> <begin-block-indent/> <begin-paragraph class="line-group"/> <begin-line/><verse-num begin-chapter="9">1</verse-num>The burden of the word of the <span class="divine-name">Lord</span> is against the land of Hadrach<end-line class="br"/> <begin-line class="indent"/>and Damascus is its resting place.<end-line class="br"/> <begin-line/>For the <span class="divine-name">Lord</span> has an eye on mankind<end-line class="br"/> <begin-line class="indent"/>and on all the tribes of Israel,<footnote id="f1"> A slight emendation yields <i> For to the <span class="divine-name">Lord</span> belongs the capital of Syria and all the tribes of Israel </i> </footnote><end-line class="br"/> </verse-unit> I used visual studio to generate a schema from this and used XSD.EXE to generate classes that I can use to deserialize this mess into programmable stuff. I got everything to work and it is deserialized perfectly (almost). The problem I have is with the random text mixed throughout the child nodes. The generated verse-unit objects gives me a list of objects (begin-line, begin-block-indent, etc), and also another list of string objects that represent the bits of string throughout the xml. Here is my schema <xs:element maxOccurs="unbounded" name="verse-unit"> <xs:complexType mixed="true"> <xs:sequence> <xs:choice maxOccurs="unbounded"> <xs:element name="marker"> <xs:complexType> <xs:attribute name="class" type="xs:string" use="required" /> <xs:attribute name="mid" type="xs:string" use="required" /> </xs:complexType> </xs:element> <xs:element name="begin-chapter"> <xs:complexType> <xs:attribute name="num" type="xs:unsignedByte" use="required" /> </xs:complexType> </xs:element> <xs:element name="heading"> <xs:complexType mixed="true"> <xs:sequence minOccurs="0"> <xs:element name="span"> <xs:complexType> <xs:simpleContent> <xs:extension base="xs:string"> <xs:attribute name="class" type="xs:string" use="required" /> </xs:extension> </xs:simpleContent> </xs:complexType> </xs:element> </xs:sequence> </xs:complexType> </xs:element> <xs:element name="begin-block-indent" /> <xs:element name="begin-paragraph"> <xs:complexType> <xs:attribute name="class" type="xs:string" use="required" /> </xs:complexType> </xs:element> <xs:element name="begin-line"> <xs:complexType> <xs:attribute name="class" type="xs:string" use="optional" /> </xs:complexType> </xs:element> <xs:element name="verse-num"> <xs:complexType> <xs:simpleContent> <xs:extension base="xs:unsignedByte"> <xs:attribute name="begin-chapter" type="xs:unsignedByte" use="optional" /> </xs:extension> </xs:simpleContent> </xs:complexType> </xs:element> <xs:element name="end-line"> <xs:complexType> <xs:attribute name="class" type="xs:string" use="optional" /> </xs:complexType> </xs:element> <xs:element name="end-paragraph" /> <xs:element name="end-block-indent" /> <xs:element name="end-chapter" /> </xs:choice> </xs:sequence> <xs:attribute name="unit-id" type="xs:unsignedInt" use="required" /> </xs:complexType> </xs:element> WHAT I NEED IS THIS. I need the random text that is NOT surrounded by an xml node to be represented by an object so I know the order that everything is in. I know this is complicated, so let me try to simplify it. <field name="test_field_0"> Some text I'm sure you don't want. <subfield>Some text.</subfield> More text you don't want. </field> I need the xsd to generate a field object with items that can have either a text object, or a subfield object. I need to no where the random text is within the child nodes.

    Read the article

  • any faster alternative??

    - by kaushik
    I have to read a file from a particular line number and i know the line number say "n": i have been thinking of two choice: 1)for i in range(n) fname.readline() k=readline() print k 2)i=0 for line in fname: dictionary[i]=line i=i+1 but i want to know faster alternative as i might have to perform this on different files 20000 times. is there is any other better alternatives?? thanking u

    Read the article

  • color objects in C or C ++ [closed]

    - by jazz
    Possible Duplicate: Colors in C language i copied a game from a book which name is paratrooper i ask this question again i also provide the code of the objects which i create there i want to change the color of these objects but i didn't understand how to do that so can any one plz help me how to do that.Listen guys they are not the standard functions but i use the graphics library for these functions and i can't find the function in the library file of graphics. i hope u understand know.this code will not run properly so plz tell me something about the function which color it i can't put the image other wize i show u the image it will make alot easieer #include "graphics.h" #include "stdio.h" #include "conio.h" #include "process.h" #include "alloc.h" #include "stdlib.h" #include "math.h" #include "dos.h" main() { int gm=CGAHI, gd=CGA, key=0, area; initgraph(&gd, &gm, "C:\\tc\\bgi"); helidraw(246,50,-1); getch(); return 0; } helidraw ( int x, int y, int d ) { int direction, i, j ; if ( d ) direction = -1 ; else direction = 1 ; i = 3 ; j = 8 ; line ( x - j - 8, y - i - 2, x + j + 8, y - i - 2 ) ; line ( x - j + 5, y - i - 1, x + j - 5, y - i - 1 ) ; line ( x - j, y - i, x + j, y - i ) ; for ( ; i > 0 ; i--, j += 2 ) { putpixel ( x - ( direction * j ), y - i, 1 ) ; line ( x + ( direction * j ), y - i, x + ( direction * ( j - 8 ) ), y - i ) ; } i = 0 ; j -= 2 ; line ( x - ( direction * j ), y - i, x - ( direction * ( j + 17 ) ), y - i ) ; line ( x - ( direction * j ), y - i + 1, x - ( direction * ( j + 7 ) ), y - i + 1 ) ; putpixel ( x - ( direction * ( j + 19 ) ), y - i - 1, 1 ) ; for ( ; i < 3 ; i++, j -= 2 ) { putpixel ( x - j, y + i, 1 ) ; putpixel ( x + j, y + i, 1 ) ; } line ( x - j, y + i, x + j, y + i ) ; putpixel ( x - j + 3, y + i + 1, 1 ) ; putpixel ( x + j - 3, y + i + 1, 1 ) ; line ( x - j - 10, y + i + 2, x + j + 10, y + i + 2 ) ; putpixel ( x + ( direction * ( j + 12 ) ), y + i + 1, 1 ) ; }

    Read the article

  • Python Pickle: what can cause stack index out of range error?

    - by Rosarch
    I'm getting this error: File "C:\Python26\lib\pickle.py", line 1374, in loads return Unpickler(file).load() File "C:\Python26\lib\pickle.py", line 858, in load dispatch[key](self) File "C:\Python26\lib\pickle.py", line 1075, in load_obj k = self.marker() File "C:\Python26\lib\pickle.py", line 874, in marker while stack[k] is not mark: k = k-1 IndexError: list index out of range Why could this be happening?

    Read the article

  • strip spaces in python.

    - by Richard
    ok I know that this should be simple... anyways say: line = "$W5M5A,100527,142500,730301c44892fd1c,2,686.5 4,333.96,0,0,28.6,123,75,-0.4,1.4*49" I want to strip out the spaces. I thought you would just do this line = line.strip() but now line is still '$W5M5A,100527,142500,730301c44892fd1c,2,686.5 4,333.96,0,0,28.6,123,75,-0.4,1.4*49' instead of '$W5M5A,100527,142500,730301c44892fd1c,2,686.54,333.96,0,0,28.6,123,75,-0.4,1.4*49' any thoughts?

    Read the article

  • thread management in nbody code of cuda-sdk

    - by xnov
    When I read the nbody code in Cuda-SDK, I went through some lines in the code and I found that it is a little bit different than their paper in GPUGems3 "Fast N-Body Simulation with CUDA". My questions are: First, why the blockIdx.x is still involved in loading memory from global to share memory as written in the following code? for (int tile = blockIdx.y; tile < numTiles + blockIdx.y; tile++) { sharedPos[threadIdx.x+blockDim.x*threadIdx.y] = multithreadBodies ? positions[WRAP(blockIdx.x + q * tile + threadIdx.y, gridDim.x) * p + threadIdx.x] : //this line positions[WRAP(blockIdx.x + tile, gridDim.x) * p + threadIdx.x]; //this line __syncthreads(); // This is the "tile_calculation" function from the GPUG3 article. acc = gravitation(bodyPos, acc); __syncthreads(); } isn't it supposed to be like this according to paper? I wonder why sharedPos[threadIdx.x+blockDim.x*threadIdx.y] = multithreadBodies ? positions[WRAP(q * tile + threadIdx.y, gridDim.x) * p + threadIdx.x] : positions[WRAP(tile, gridDim.x) * p + threadIdx.x]; Second, in the multiple threads per body why the threadIdx.x is still involved? Isn't it supposed to be a fix value or not involving at all because the sum only due to threadIdx.y if (multithreadBodies) { SX_SUM(threadIdx.x, threadIdx.y).x = acc.x; //this line SX_SUM(threadIdx.x, threadIdx.y).y = acc.y; //this line SX_SUM(threadIdx.x, threadIdx.y).z = acc.z; //this line __syncthreads(); // Save the result in global memory for the integration step if (threadIdx.y == 0) { for (int i = 1; i < blockDim.y; i++) { acc.x += SX_SUM(threadIdx.x,i).x; //this line acc.y += SX_SUM(threadIdx.x,i).y; //this line acc.z += SX_SUM(threadIdx.x,i).z; //this line } } } Can anyone explain this to me? Is it some kind of optimization for faster code?

    Read the article

  • Fast response on first Socket I/O request but slow every other time when communicating with remote serial port

    - by GreenGodot
    I'm using sockets to pass Serial commands to a remote device. And the response to that request is sent back and printed out. However, I am having a problem in that the first time it is instant but the rest of the time it can take up to 20 seconds to receive a reply. I think the problem is with my attempt at threading but I am not entirely sure. new Thread() { @Override public void run() { System.out.println("opened"); try { isSocketRetrieving.setText("Opening Socket"); socket = new Socket(getAddress(), getRemotePort())); DataOutput = new DataOutputStream(socket .getOutputStream()); inFromServer = new BufferedReader( new InputStreamReader(socket .getInputStream())); String line = ""; isSocketRetrieving.setText("Reading Stream......"); while ((line = inFromServer.readLine()) != null) { System.out.println(line); if (line.contains(getHandshakeRequest())) { DataOutput.write((getHandshakeResponse()toString() + "\r").getBytes()); DataOutput.flush(); DataOutput .write((getCommand().toString() + "\r").getBytes()); DataOutput.flush(); int pause = (line.length()*8*1000)/getBaud(); sleep(pause); } else if (line.contains(readingObject .getExpected())) { System.out.println(line); textArea.append("value = " + line + "\n"); textAreaScroll.revalidate(); System.out.println("Got Value"); break; } } System.out.println("Ended"); try { inFromServer.close(); DataOutput.close(); socket.close(); isSocketRetrieving.setText("Socket is inactive..."); rs232Table.addMouseListener(listener); interrupt(); join(); } catch (IOException e) { e.printStackTrace(); } catch (InterruptedException e) { System.out.println("Thread exited"); } } catch (NumberFormatException e1) { e1.printStackTrace(); } catch (UnknownHostException e1) { e1.printStackTrace(); } catch (IOException e1) { e1.printStackTrace(); } catch (InterruptedException e) { // TODO Auto-generated catch block e.printStackTrace(); } } }.start();

    Read the article

  • Flex uncontinuous linechart?

    - by Biroka
    Is there a way to break the line in a line-chart, if the gap between 2 values on the x axis is bigger then a given value? For example there are 20 values but the first 13 are close to each other on the x axis and should be connected with a line, but the other 7 are a bit far from these and should be connected with another line. The type of values are the same.

    Read the article

  • in python how to remove this \n from string or list

    - by pritesh modi
    this is my main string "action","employee_id","name" "absent","pritesh",2010/09/15 00:00:00 so after name coolumn its goes to new line but here i append to list a new line character is added and make it like this way data_list*** ['"action","employee_id","name"\n"absent","pritesh",2010/09/15 00:00:00\n'] here its append the new line character with absent but actually its a new line strarting but its appended i want to make it like data_list*** ['"action","employee_id","name","absent","pritesh",2010/09/15 00:00:00']

    Read the article

  • C# drawing and invalidating 2 lines to meet

    - by BlueMonster
    If i have 2 lines on a page as such: e.Graphics.DrawLine(blackPen, w, h, h, w); e.Graphics.DrawLine(blackPen, w2, h2, h2, w2); how would i animate the first line to reach the second line's position? I have the following method which calculates the distance between two points (i'm assuming i would use this?) public int Distance2D(int x1, int y1, int x2, int y2) { // ______________________ //d = &#8730; (x2-x1)^2 + (y2-y1)^2 // //Our end result int result = 0; //Take x2-x1, then square it double part1 = Math.Pow((x2 - x1), 2); //Take y2-y1, then sqaure it double part2 = Math.Pow((y2 - y1), 2); //Add both of the parts together double underRadical = part1 + part2; //Get the square root of the parts result = (int)Math.Sqrt(underRadical); //Return our result return result; } How would i re-draw the line (on a timer) to reach the second line's position? I've looked a lot into XAML (story-boarding) and such - but i want to know how to do this on my own. Any ideas? I know i would need a method which runs in a loop re-drawing the line after moving the position a tid bit. I would have to call Invalidate() in order to make the line appear as though it's moving... but how would i do this? how would i move that line slowly over to the other line? I'm pretty sure i'd have to use double buffering if i'm doing this as well... as such: SetStyle(ControlStyles.DoubleBuffer | ControlStyles.AllPaintingInWmPaint | ControlStyles.UserPaint, true); This doesn't quiet work, i'm not quiet sure how to fix it. Any ideas? protected override void OnPaint(PaintEventArgs e) { Distance2D(w, h, w2, h2); if (w2 != w && h2 != h) { e.Graphics.DrawLine(blackPen, (w * (int)frame), (h * (int)frame), (h * (int)frame), (w * (int)frame)); e.Graphics.DrawLine(blackPen, w2, h2, h2, w2); } else { t.Abort(); } base.OnPaint(e); } public void MoveLine() { for (int i = 0; i < 126; i++) { frame += .02; Invalidate(); Thread.Sleep(30); } } private void button1_Click(object sender, EventArgs e) { t = new Thread(new ThreadStart(MoveLine)); t.Start(); }

    Read the article

  • Read text file in java

    - by user326091
    Hi, I have a text file. I would like to retrieve the content from one line to another line. For example, the file may be 200K lines. I want to read the content from line 78 to line 2735. Since the file may be very large, I do not want to read the whole content into the memory. thanks Frank

    Read the article

  • Netbeans braces placement issue

    - by KeyStroke
    Hi there, I'm trying to get Netbeans PHP to let me write braces in a new line instead of the same line, I mean like this: if($something == TRUE) { // some code here } However, when I write if($something == TRUE) then hit enter, Netbeans places the cursor incorrectly in the new line, like this: if($something == TRUE) { // some code here } I've already changed the braces placement option to be "New Line", but this still doesn't work properly. Any idea how I can fix this? Appreciate your help

    Read the article

  • standard c library for escaping a string.

    - by rampion
    Is there a standard C library function to escape C-strings? For example, if I had the C string: char example[] = "first line\nsecond line: \"inner quotes\""; And I wanted to print "first line\nsecond line: \"inner quotes\"" Is there a library function that will do that transformation for me? Rolling my own just seems a little silly. Bonus points if I can give it a length to escape (so it stops before or beyond the \0).

    Read the article

  • Cannot get variable.replace working properly.

    - by chrissygormley
    Hello, I am trying to replace a string with a new string in a python file and write the new string permanently to it. When I run the below script it removes part of the string and not all of it. The string in the file is: self.id = "027FC8EBC2D1" And the script I have to replace the string is: def edit(): o = open("test.py","r+") #open for line in open("test.py"): line = line.replace("027FC8EBC2D1","NewValue") o.write(line) o.close() edit() Thanks for any help.

    Read the article

  • ssh, "Last Login", `last` and OS X

    - by allentown
    I have hit the googles as much as I can on this, being specific to OS X, I am not finding an answer. Nothing is wrong, but curiosity levels are high. $ssh [email protected] Password: Last login: Wed Apr 7 21:28:03 2010 from my-laptop.local ^lonely tylenol^ Line 1 is my command line 2 is the shell asking for the password line 3 is where my question comes from line 4 comes out of /etc/motd I can find nothing in ~/ of an of the .bash* files that contains the string "Last Login", and would like to alter it. It performs some type of hostname lookup, which I can not determine. If I ssh to another host: $ssh [email protected] Last login: Wed Apr 7 21:14:51 2010 from 123-234-321-123-some.cal.isp.net.example hi there, you are on box 456 line 1 is my command line 2 is again, where my question comes from line 3 is from /etc/motd *The dash'd IP address is not reversed On this remote host, I have ~/.ssh and it's corresponding keys set up, so there was no password request Where is the "Last Login:" coming from, where does the date stamp come from, and most importantly, where does the hostname come from? While on [email protected] (box 456) $echo hostname remote.location.example456.com Or with dig, to make sure I have rDNS/PTR set up, for which I am not authoritative, but my ISP has correctly set... $dig -x 123.234.321.123 PTR remote.location.example456.com or $dig PTR 123.321.234.123.in-addr.arpa. +short remote.location.example456.com. my previous hostname used to be 123-234-321-123-some.cal.isp.net.example, which I set with hostname -s remote.location.example456.com, because it was obnoxious to see such a long name. That solves the value of $echo hostname which now returns remote.location.example456.com. Mac OS X, 10.6 is this case, does seem to honor: touch ~/.hushlogin If leave that file empty, I get nothing on the shell when I login. I want to know what controls the host resolution of the IP, and how it is all working. For example, running last reports a huge list of my logins, which have obtusely long hostnames, when they would be preferable to just be remote.location.example456.com. More confusing to me, reading the man page for wtmp and lastlog, it looks like lastlog is not used on OS X, /var/log/lastlog does not exist. Actually, none of these exist on 10.5 or 10.6: /var/run/utmp The utmp file. /var/log/wtmp The wtmp file. /var/log/lastlog The lastlog file. If I am to assume that the system is doing some kind of reverse lookup, I certainly do not know what it is, as it is not an accurate one.

    Read the article

  • The Incremental Architect&rsquo;s Napkin - #5 - Design functions for extensibility and readability

    - by Ralf Westphal
    Originally posted on: http://geekswithblogs.net/theArchitectsNapkin/archive/2014/08/24/the-incremental-architectrsquos-napkin---5---design-functions-for.aspx The functionality of programs is entered via Entry Points. So what we´re talking about when designing software is a bunch of functions handling the requests represented by and flowing in through those Entry Points. Designing software thus consists of at least three phases: Analyzing the requirements to find the Entry Points and their signatures Designing the functionality to be executed when those Entry Points get triggered Implementing the functionality according to the design aka coding I presume, you´re familiar with phase 1 in some way. And I guess you´re proficient in implementing functionality in some programming language. But in my experience developers in general are not experienced in going through an explicit phase 2. “Designing functionality? What´s that supposed to mean?” you might already have thought. Here´s my definition: To design functionality (or functional design for short) means thinking about… well, functions. You find a solution for what´s supposed to happen when an Entry Point gets triggered in terms of functions. A conceptual solution that is, because those functions only exist in your head (or on paper) during this phase. But you may have guess that, because it´s “design” not “coding”. And here is, what functional design is not: It´s not about logic. Logic is expressions (e.g. +, -, && etc.) and control statements (e.g. if, switch, for, while etc.). Also I consider calling external APIs as logic. It´s equally basic. It´s what code needs to do in order to deliver some functionality or quality. Logic is what´s doing that needs to be done by software. Transformations are either done through expressions or API-calls. And then there is alternative control flow depending on the result of some expression. Basically it´s just jumps in Assembler, sometimes to go forward (if, switch), sometimes to go backward (for, while, do). But calling your own function is not logic. It´s not necessary to produce any outcome. Functionality is not enhanced by adding functions (subroutine calls) to your code. Nor is quality increased by adding functions. No performance gain, no higher scalability etc. through functions. Functions are not relevant to functionality. Strange, isn´t it. What they are important for is security of investment. By introducing functions into our code we can become more productive (re-use) and can increase evolvability (higher unterstandability, easier to keep code consistent). That´s no small feat, however. Evolvable code can hardly be overestimated. That´s why to me functional design is so important. It´s at the core of software development. To sum this up: Functional design is on a level of abstraction above (!) logical design or algorithmic design. Functional design is only done until you get to a point where each function is so simple you are very confident you can easily code it. Functional design an logical design (which mostly is coding, but can also be done using pseudo code or flow charts) are complementary. Software needs both. If you start coding right away you end up in a tangled mess very quickly. Then you need back out through refactoring. Functional design on the other hand is bloodless without actual code. It´s just a theory with no experiments to prove it. But how to do functional design? An example of functional design Let´s assume a program to de-duplicate strings. The user enters a number of strings separated by commas, e.g. a, b, a, c, d, b, e, c, a. And the program is supposed to clear this list of all doubles, e.g. a, b, c, d, e. There is only one Entry Point to this program: the user triggers the de-duplication by starting the program with the string list on the command line C:\>deduplicate "a, b, a, c, d, b, e, c, a" a, b, c, d, e …or by clicking on a GUI button. This leads to the Entry Point function to get called. It´s the program´s main function in case of the batch version or a button click event handler in the GUI version. That´s the physical Entry Point so to speak. It´s inevitable. What then happens is a three step process: Transform the input data from the user into a request. Call the request handler. Transform the output of the request handler into a tangible result for the user. Or to phrase it a bit more generally: Accept input. Transform input into output. Present output. This does not mean any of these steps requires a lot of effort. Maybe it´s just one line of code to accomplish it. Nevertheless it´s a distinct step in doing the processing behind an Entry Point. Call it an aspect or a responsibility - and you will realize it most likely deserves a function of its own to satisfy the Single Responsibility Principle (SRP). Interestingly the above list of steps is already functional design. There is no logic, but nevertheless the solution is described - albeit on a higher level of abstraction than you might have done yourself. But it´s still on a meta-level. The application to the domain at hand is easy, though: Accept string list from command line De-duplicate Present de-duplicated strings on standard output And this concrete list of processing steps can easily be transformed into code:static void Main(string[] args) { var input = Accept_string_list(args); var output = Deduplicate(input); Present_deduplicated_string_list(output); } Instead of a big problem there are three much smaller problems now. If you think each of those is trivial to implement, then go for it. You can stop the functional design at this point. But maybe, just maybe, you´re not so sure how to go about with the de-duplication for example. Then just implement what´s easy right now, e.g.private static string Accept_string_list(string[] args) { return args[0]; } private static void Present_deduplicated_string_list( string[] output) { var line = string.Join(", ", output); Console.WriteLine(line); } Accept_string_list() contains logic in the form of an API-call. Present_deduplicated_string_list() contains logic in the form of an expression and an API-call. And then repeat the functional design for the remaining processing step. What´s left is the domain logic: de-duplicating a list of strings. How should that be done? Without any logic at our disposal during functional design you´re left with just functions. So which functions could make up the de-duplication? Here´s a suggestion: De-duplicate Parse the input string into a true list of strings. Register each string in a dictionary/map/set. That way duplicates get cast away. Transform the data structure into a list of unique strings. Processing step 2 obviously was the core of the solution. That´s where real creativity was needed. That´s the core of the domain. But now after this refinement the implementation of each step is easy again:private static string[] Parse_string_list(string input) { return input.Split(',') .Select(s => s.Trim()) .ToArray(); } private static Dictionary<string,object> Compile_unique_strings(string[] strings) { return strings.Aggregate( new Dictionary<string, object>(), (agg, s) => { agg[s] = null; return agg; }); } private static string[] Serialize_unique_strings( Dictionary<string,object> dict) { return dict.Keys.ToArray(); } With these three additional functions Main() now looks like this:static void Main(string[] args) { var input = Accept_string_list(args); var strings = Parse_string_list(input); var dict = Compile_unique_strings(strings); var output = Serialize_unique_strings(dict); Present_deduplicated_string_list(output); } I think that´s very understandable code: just read it from top to bottom and you know how the solution to the problem works. It´s a mirror image of the initial design: Accept string list from command line Parse the input string into a true list of strings. Register each string in a dictionary/map/set. That way duplicates get cast away. Transform the data structure into a list of unique strings. Present de-duplicated strings on standard output You can even re-generate the design by just looking at the code. Code and functional design thus are always in sync - if you follow some simple rules. But about that later. And as a bonus: all the functions making up the process are small - which means easy to understand, too. So much for an initial concrete example. Now it´s time for some theory. Because there is method to this madness ;-) The above has only scratched the surface. Introducing Flow Design Functional design starts with a given function, the Entry Point. Its goal is to describe the behavior of the program when the Entry Point is triggered using a process, not an algorithm. An algorithm consists of logic, a process on the other hand consists just of steps or stages. Each processing step transforms input into output or a side effect. Also it might access resources, e.g. a printer, a database, or just memory. Processing steps thus can rely on state of some sort. This is different from Functional Programming, where functions are supposed to not be stateful and not cause side effects.[1] In its simplest form a process can be written as a bullet point list of steps, e.g. Get data from user Output result to user Transform data Parse data Map result for output Such a compilation of steps - possibly on different levels of abstraction - often is the first artifact of functional design. It can be generated by a team in an initial design brainstorming. Next comes ordering the steps. What should happen first, what next etc.? Get data from user Parse data Transform data Map result for output Output result to user That´s great for a start into functional design. It´s better than starting to code right away on a given function using TDD. Please get me right: TDD is a valuable practice. But it can be unnecessarily hard if the scope of a functionn is too large. But how do you know beforehand without investing some thinking? And how to do this thinking in a systematic fashion? My recommendation: For any given function you´re supposed to implement first do a functional design. Then, once you´re confident you know the processing steps - which are pretty small - refine and code them using TDD. You´ll see that´s much, much easier - and leads to cleaner code right away. For more information on this approach I call “Informed TDD” read my book of the same title. Thinking before coding is smart. And writing down the solution as a bunch of functions possibly is the simplest thing you can do, I´d say. It´s more according to the KISS (Keep It Simple, Stupid) principle than returning constants or other trivial stuff TDD development often is started with. So far so good. A simple ordered list of processing steps will do to start with functional design. As shown in the above example such steps can easily be translated into functions. Moving from design to coding thus is simple. However, such a list does not scale. Processing is not always that simple to be captured in a list. And then the list is just text. Again. Like code. That means the design is lacking visuality. Textual representations need more parsing by your brain than visual representations. Plus they are limited in their “dimensionality”: text just has one dimension, it´s sequential. Alternatives and parallelism are hard to encode in text. In addition the functional design using numbered lists lacks data. It´s not visible what´s the input, output, and state of the processing steps. That´s why functional design should be done using a lightweight visual notation. No tool is necessary to draw such designs. Use pen and paper; a flipchart, a whiteboard, or even a napkin is sufficient. Visualizing processes The building block of the functional design notation is a functional unit. I mostly draw it like this: Something is done, it´s clear what goes in, it´s clear what comes out, and it´s clear what the processing step requires in terms of state or hardware. Whenever input flows into a functional unit it gets processed and output is produced and/or a side effect occurs. Flowing data is the driver of something happening. That´s why I call this approach to functional design Flow Design. It´s about data flow instead of control flow. Control flow like in algorithms is of no concern to functional design. Thinking about control flow simply is too low level. Once you start with control flow you easily get bogged down by tons of details. That´s what you want to avoid during design. Design is supposed to be quick, broad brush, abstract. It should give overview. But what about all the details? As Robert C. Martin rightly said: “Programming is abot detail”. Detail is a matter of code. Once you start coding the processing steps you designed you can worry about all the detail you want. Functional design does not eliminate all the nitty gritty. It just postpones tackling them. To me that´s also an example of the SRP. Function design has the responsibility to come up with a solution to a problem posed by a single function (Entry Point). And later coding has the responsibility to implement the solution down to the last detail (i.e. statement, API-call). TDD unfortunately mixes both responsibilities. It´s just coding - and thereby trying to find detailed implementations (green phase) plus getting the design right (refactoring). To me that´s one reason why TDD has failed to deliver on its promise for many developers. Using functional units as building blocks of functional design processes can be depicted very easily. Here´s the initial process for the example problem: For each processing step draw a functional unit and label it. Choose a verb or an “action phrase” as a label, not a noun. Functional design is about activities, not state or structure. Then make the output of an upstream step the input of a downstream step. Finally think about the data that should flow between the functional units. Write the data above the arrows connecting the functional units in the direction of the data flow. Enclose the data description in brackets. That way you can clearly see if all flows have already been specified. Empty brackets mean “no data is flowing”, but nevertheless a signal is sent. A name like “list” or “strings” in brackets describes the data content. Use lower case labels for that purpose. A name starting with an upper case letter like “String” or “Customer” on the other hand signifies a data type. If you like, you also can combine descriptions with data types by separating them with a colon, e.g. (list:string) or (strings:string[]). But these are just suggestions from my practice with Flow Design. You can do it differently, if you like. Just be sure to be consistent. Flows wired-up in this manner I call one-dimensional (1D). Each functional unit just has one input and/or one output. A functional unit without an output is possible. It´s like a black hole sucking up input without producing any output. Instead it produces side effects. A functional unit without an input, though, does make much sense. When should it start to work? What´s the trigger? That´s why in the above process even the first processing step has an input. If you like, view such 1D-flows as pipelines. Data is flowing through them from left to right. But as you can see, it´s not always the same data. It get´s transformed along its passage: (args) becomes a (list) which is turned into (strings). The Principle of Mutual Oblivion A very characteristic trait of flows put together from function units is: no functional units knows another one. They are all completely independent of each other. Functional units don´t know where their input is coming from (or even when it´s gonna arrive). They just specify a range of values they can process. And they promise a certain behavior upon input arriving. Also they don´t know where their output is going. They just produce it in their own time independent of other functional units. That means at least conceptually all functional units work in parallel. Functional units don´t know their “deployment context”. They now nothing about the overall flow they are place in. They are just consuming input from some upstream, and producing output for some downstream. That makes functional units very easy to test. At least as long as they don´t depend on state or resources. I call this the Principle of Mutual Oblivion (PoMO). Functional units are oblivious of others as well as an overall context/purpose. They are just parts of a whole focused on a single responsibility. How the whole is built, how a larger goal is achieved, is of no concern to the single functional units. By building software in such a manner, functional design interestingly follows nature. Nature´s building blocks for organisms also follow the PoMO. The cells forming your body do not know each other. Take a nerve cell “controlling” a muscle cell for example:[2] The nerve cell does not know anything about muscle cells, let alone the specific muscel cell it is “attached to”. Likewise the muscle cell does not know anything about nerve cells, let a lone a specific nerve cell “attached to” it. Saying “the nerve cell is controlling the muscle cell” thus only makes sense when viewing both from the outside. “Control” is a concept of the whole, not of its parts. Control is created by wiring-up parts in a certain way. Both cells are mutually oblivious. Both just follow a contract. One produces Acetylcholine (ACh) as output, the other consumes ACh as input. Where the ACh is going, where it´s coming from neither cell cares about. Million years of evolution have led to this kind of division of labor. And million years of evolution have produced organism designs (DNA) which lead to the production of these different cell types (and many others) and also to their co-location. The result: the overall behavior of an organism. How and why this happened in nature is a mystery. For our software, though, it´s clear: functional and quality requirements needs to be fulfilled. So we as developers have to become “intelligent designers” of “software cells” which we put together to form a “software organism” which responds in satisfying ways to triggers from it´s environment. My bet is: If nature gets complex organisms working by following the PoMO, who are we to not apply this recipe for success to our much simpler “machines”? So my rule is: Wherever there is functionality to be delivered, because there is a clear Entry Point into software, design the functionality like nature would do it. Build it from mutually oblivious functional units. That´s what Flow Design is about. In that way it´s even universal, I´d say. Its notation can also be applied to biology: Never mind labeling the functional units with nouns. That´s ok in Flow Design. You´ll do that occassionally for functional units on a higher level of abstraction or when their purpose is close to hardware. Getting a cockroach to roam your bedroom takes 1,000,000 nerve cells (neurons). Getting the de-duplication program to do its job just takes 5 “software cells” (functional units). Both, though, follow the same basic principle. Translating functional units into code Moving from functional design to code is no rocket science. In fact it´s straightforward. There are two simple rules: Translate an input port to a function. Translate an output port either to a return statement in that function or to a function pointer visible to that function. The simplest translation of a functional unit is a function. That´s what you saw in the above example. Functions are mutually oblivious. That why Functional Programming likes them so much. It makes them composable. Which is the reason, nature works according to the PoMO. Let´s be clear about one thing: There is no dependency injection in nature. For all of an organism´s complexity no DI container is used. Behavior is the result of smooth cooperation between mutually oblivious building blocks. Functions will often be the adequate translation for the functional units in your designs. But not always. Take for example the case, where a processing step should not always produce an output. Maybe the purpose is to filter input. Here the functional unit consumes words and produces words. But it does not pass along every word flowing in. Some words are swallowed. Think of a spell checker. It probably should not check acronyms for correctness. There are too many of them. Or words with no more than two letters. Such words are called “stop words”. In the above picture the optionality of the output is signified by the astrisk outside the brackets. It means: Any number of (word) data items can flow from the functional unit for each input data item. It might be none or one or even more. This I call a stream of data. Such behavior cannot be translated into a function where output is generated with return. Because a function always needs to return a value. So the output port is translated into a function pointer or continuation which gets passed to the subroutine when called:[3]void filter_stop_words( string word, Action<string> onNoStopWord) { if (...check if not a stop word...) onNoStopWord(word); } If you want to be nitpicky you might call such a function pointer parameter an injection. And technically you´re right. Conceptually, though, it´s not an injection. Because the subroutine is not functionally dependent on the continuation. Firstly continuations are procedures, i.e. subroutines without a return type. Remember: Flow Design is about unidirectional data flow. Secondly the name of the formal parameter is chosen in a way as to not assume anything about downstream processing steps. onNoStopWord describes a situation (or event) within the functional unit only. Translating output ports into function pointers helps keeping functional units mutually oblivious in cases where output is optional or produced asynchronically. Either pass the function pointer to the function upon call. Or make it global by putting it on the encompassing class. Then it´s called an event. In C# that´s even an explicit feature.class Filter { public void filter_stop_words( string word) { if (...check if not a stop word...) onNoStopWord(word); } public event Action<string> onNoStopWord; } When to use a continuation and when to use an event dependens on how a functional unit is used in flows and how it´s packed together with others into classes. You´ll see examples further down the Flow Design road. Another example of 1D functional design Let´s see Flow Design once more in action using the visual notation. How about the famous word wrap kata? Robert C. Martin has posted a much cited solution including an extensive reasoning behind his TDD approach. So maybe you want to compare it to Flow Design. The function signature given is:string WordWrap(string text, int maxLineLength) {...} That´s not an Entry Point since we don´t see an application with an environment and users. Nevertheless it´s a function which is supposed to provide a certain functionality. The text passed in has to be reformatted. The input is a single line of arbitrary length consisting of words separated by spaces. The output should consist of one or more lines of a maximum length specified. If a word is longer than a the maximum line length it can be split in multiple parts each fitting in a line. Flow Design Let´s start by brainstorming the process to accomplish the feat of reformatting the text. What´s needed? Words need to be assembled into lines Words need to be extracted from the input text The resulting lines need to be assembled into the output text Words too long to fit in a line need to be split Does sound about right? I guess so. And it shows a kind of priority. Long words are a special case. So maybe there is a hint for an incremental design here. First let´s tackle “average words” (words not longer than a line). Here´s the Flow Design for this increment: The the first three bullet points turned into functional units with explicit data added. As the signature requires a text is transformed into another text. See the input of the first functional unit and the output of the last functional unit. In between no text flows, but words and lines. That´s good to see because thereby the domain is clearly represented in the design. The requirements are talking about words and lines and here they are. But note the asterisk! It´s not outside the brackets but inside. That means it´s not a stream of words or lines, but lists or sequences. For each text a sequence of words is output. For each sequence of words a sequence of lines is produced. The asterisk is used to abstract from the concrete implementation. Like with streams. Whether the list of words gets implemented as an array or an IEnumerable is not important during design. It´s an implementation detail. Does any processing step require further refinement? I don´t think so. They all look pretty “atomic” to me. And if not… I can always backtrack and refine a process step using functional design later once I´ve gained more insight into a sub-problem. Implementation The implementation is straightforward as you can imagine. The processing steps can all be translated into functions. Each can be tested easily and separately. Each has a focused responsibility. And the process flow becomes just a sequence of function calls: Easy to understand. It clearly states how word wrapping works - on a high level of abstraction. And it´s easy to evolve as you´ll see. Flow Design - Increment 2 So far only texts consisting of “average words” are wrapped correctly. Words not fitting in a line will result in lines too long. Wrapping long words is a feature of the requested functionality. Whether it´s there or not makes a difference to the user. To quickly get feedback I decided to first implement a solution without this feature. But now it´s time to add it to deliver the full scope. Fortunately Flow Design automatically leads to code following the Open Closed Principle (OCP). It´s easy to extend it - instead of changing well tested code. How´s that possible? Flow Design allows for extension of functionality by inserting functional units into the flow. That way existing functional units need not be changed. The data flow arrow between functional units is a natural extension point. No need to resort to the Strategy Pattern. No need to think ahead where extions might need to be made in the future. I just “phase in” the remaining processing step: Since neither Extract words nor Reformat know of their environment neither needs to be touched due to the “detour”. The new processing step accepts the output of the existing upstream step and produces data compatible with the existing downstream step. Implementation - Increment 2 A trivial implementation checking the assumption if this works does not do anything to split long words. The input is just passed on: Note how clean WordWrap() stays. The solution is easy to understand. A developer looking at this code sometime in the future, when a new feature needs to be build in, quickly sees how long words are dealt with. Compare this to Robert C. Martin´s solution:[4] How does this solution handle long words? Long words are not even part of the domain language present in the code. At least I need considerable time to understand the approach. Admittedly the Flow Design solution with the full implementation of long word splitting is longer than Robert C. Martin´s. At least it seems. Because his solution does not cover all the “word wrap situations” the Flow Design solution handles. Some lines would need to be added to be on par, I guess. But even then… Is a difference in LOC that important as long as it´s in the same ball park? I value understandability and openness for extension higher than saving on the last line of code. Simplicity is not just less code, it´s also clarity in design. But don´t take my word for it. Try Flow Design on larger problems and compare for yourself. What´s the easier, more straightforward way to clean code? And keep in mind: You ain´t seen all yet ;-) There´s more to Flow Design than described in this chapter. In closing I hope I was able to give you a impression of functional design that makes you hungry for more. To me it´s an inevitable step in software development. Jumping from requirements to code does not scale. And it leads to dirty code all to quickly. Some thought should be invested first. Where there is a clear Entry Point visible, it´s functionality should be designed using data flows. Because with data flows abstraction is possible. For more background on why that´s necessary read my blog article here. For now let me point out to you - if you haven´t already noticed - that Flow Design is a general purpose declarative language. It´s “programming by intention” (Shalloway et al.). Just write down how you think the solution should work on a high level of abstraction. This breaks down a large problem in smaller problems. And by following the PoMO the solutions to those smaller problems are independent of each other. So they are easy to test. Or you could even think about getting them implemented in parallel by different team members. Flow Design not only increases evolvability, but also helps becoming more productive. All team members can participate in functional design. This goes beyon collective code ownership. We´re talking collective design/architecture ownership. Because with Flow Design there is a common visual language to talk about functional design - which is the foundation for all other design activities.   PS: If you like what you read, consider getting my ebook “The Incremental Architekt´s Napkin”. It´s where I compile all the articles in this series for easier reading. I like the strictness of Function Programming - but I also find it quite hard to live by. And it certainly is not what millions of programmers are used to. Also to me it seems, the real world is full of state and side effects. So why give them such a bad image? That´s why functional design takes a more pragmatic approach. State and side effects are ok for processing steps - but be sure to follow the SRP. Don´t put too much of it into a single processing step. ? Image taken from www.physioweb.org ? My code samples are written in C#. C# sports typed function pointers called delegates. Action is such a function pointer type matching functions with signature void someName(T t). Other languages provide similar ways to work with functions as first class citizens - even Java now in version 8. I trust you find a way to map this detail of my translation to your favorite programming language. I know it works for Java, C++, Ruby, JavaScript, Python, Go. And if you´re using a Functional Programming language it´s of course a no brainer. ? Taken from his blog post “The Craftsman 62, The Dark Path”. ?

    Read the article

  • Reading Data from DDFS ValueError: No JSON object could be decoded

    - by secumind
    I'm running dozens of map reduce jobs for a number of different purposes using disco. My data has grown enormous and I thought I would try using DDFS for a change rather than standard txt files. I've followed the DISCO map/reduce example Counting Words as a map/reduce job, without to much difficulty and with the help of others, Reading JSON specific data into DISCO I've gotten past one of my latest problems. I'm trying to read data in/out of ddfs to better chunk and distribute it but am having a bit of trouble. Here's an example file: file.txt {"favorited": false, "in_reply_to_user_id": null, "contributors": null, "truncated": false, "text": "I'll call him back tomorrow I guess", "created_at": "Mon Feb 13 05:34:27 +0000 2012", "retweeted": false, "in_reply_to_status_id_str": null, "coordinates": null, "in_reply_to_user_id_str": null, "entities": {"user_mentions": [], "hashtags": [], "urls": []}, "in_reply_to_status_id": null, "id_str": "168931016843603968", "place": null, "user": {"follow_request_sent": null, "profile_use_background_image": true, "profile_background_image_url_https": "https://si0.twimg.com/profile_background_images/305726905/FASHION-3.png", "verified": false, "profile_image_url_https": "https://si0.twimg.com/profile_images/1818996723/image_normal.jpg", "profile_sidebar_fill_color": "292727", "is_translator": false, "id": 113532729, "profile_text_color": "000000", "followers_count": 78, "protected": false, "location": "With My Niggas In Paris!", "default_profile_image": false, "listed_count": 0, "utc_offset": -21600, "statuses_count": 6733, "description": "Made in CHINA., Educated && Making My Own $$. Fear GOD && Put Him 1st. #TeamFollowBack #TeamiPhone\n", "friends_count": 74, "profile_link_color": "b03f3f", "profile_image_url": "http://a2.twimg.com/profile_images/1818996723/image_normal.jpg", "notifications": null, "show_all_inline_media": false, "geo_enabled": true, "profile_background_color": "1f9199", "id_str": "113532729", "profile_background_image_url": "http://a3.twimg.com/profile_background_images/305726905/FASHION-3.png", "name": "Bee'Jay", "lang": "en", "profile_background_tile": true, "favourites_count": 19, "screen_name": "OohMyBEEsNice", "url": "http://www.bitchimpaid.org", "created_at": "Fri Feb 12 03:32:54 +0000 2010", "contributors_enabled": false, "time_zone": "Central Time (US & Canada)", "profile_sidebar_border_color": "000000", "default_profile": false, "following": null}, "in_reply_to_screen_name": null, "retweet_count": 0, "geo": null, "id": 168931016843603968, "source": "<a href=\"http://twitter.com/#!/download/iphone\" rel=\"nofollow\">Twitter for iPhone</a>"} {"favorited": false, "in_reply_to_user_id": 50940453, "contributors": null, "truncated": false, "text": "@LegaMrvica @MimozaBand makasi om artis :D kadoo kadoo", "created_at": "Mon Feb 13 05:34:27 +0000 2012", "retweeted": false, "in_reply_to_status_id_str": "168653037894770688", "coordinates": null, "in_reply_to_user_id_str": "50940453", "entities": {"user_mentions": [{"indices": [0, 11], "screen_name": "LegaMrvica", "id": 50940453, "name": "Lega_thePianis", "id_str": "50940453"}, {"indices": [12, 23], "screen_name": "MimozaBand", "id": 375128905, "name": "Mimoza", "id_str": "375128905"}], "hashtags": [], "urls": []}, "in_reply_to_status_id": 168653037894770688, "id_str": "168931016868761600", "place": null, "user": {"follow_request_sent": null, "profile_use_background_image": true, "profile_background_image_url_https": "https://si0.twimg.com/profile_background_images/347686061/Galungan_dan_Kuningan.jpg", "verified": false, "profile_image_url_https": "https://si0.twimg.com/profile_images/1803845596/Picture_20124_normal.jpg", "profile_sidebar_fill_color": "DDFFCC", "is_translator": false, "id": 48293450, "profile_text_color": "333333", "followers_count": 182, "protected": false, "location": "\u00dcT: -6.906799,107.622383", "default_profile_image": false, "listed_count": 0, "utc_offset": -28800, "statuses_count": 3052, "description": "Fashion design maranatha '11 // traditional dancer (bali) at sanggar tampak siring & Natya Nataraja", "friends_count": 206, "profile_link_color": "0084B4", "profile_image_url": "http://a3.twimg.com/profile_images/1803845596/Picture_20124_normal.jpg", "notifications": null, "show_all_inline_media": false, "geo_enabled": true, "profile_background_color": "9AE4E8", "id_str": "48293450", "profile_background_image_url": "http://a0.twimg.com/profile_background_images/347686061/Galungan_dan_Kuningan.jpg", "name": "nana afiff", "lang": "en", "profile_background_tile": true, "favourites_count": 2, "screen_name": "hasnfebria", "url": null, "created_at": "Thu Jun 18 08:50:29 +0000 2009", "contributors_enabled": false, "time_zone": "Pacific Time (US & Canada)", "profile_sidebar_border_color": "BDDCAD", "default_profile": false, "following": null}, "in_reply_to_screen_name": "LegaMrvica", "retweet_count": 0, "geo": null, "id": 168931016868761600, "source": "<a href=\"http://blackberry.com/twitter\" rel=\"nofollow\">Twitter for BlackBerry\u00ae</a>"} {"favorited": false, "in_reply_to_user_id": 27260086, "contributors": null, "truncated": false, "text": "@justinbieber u were born to be somebody, and u're super important in beliebers' life. thanks for all biebs. I love u. follow me? 84", "created_at": "Mon Feb 13 05:34:27 +0000 2012", "retweeted": false, "in_reply_to_status_id_str": null, "coordinates": null, "in_reply_to_user_id_str": "27260086", "entities": {"user_mentions": [{"indices": [0, 13], "screen_name": "justinbieber", "id": 27260086, "name": "Justin Bieber", "id_str": "27260086"}], "hashtags": [], "urls": []}, "in_reply_to_status_id": null, "id_str": "168931016856178688", "place": null, "user": {"follow_request_sent": null, "profile_use_background_image": true, "profile_background_image_url_https": "https://si0.twimg.com/profile_background_images/416005864/Captura.JPG", "verified": false, "profile_image_url_https": "https://si0.twimg.com/profile_images/1808883280/Captura6_normal.JPG", "profile_sidebar_fill_color": "f5e7f3", "is_translator": false, "id": 406750700, "profile_text_color": "333333", "followers_count": 1122, "protected": false, "location": "Adentro de una supra.", "default_profile_image": false, "listed_count": 0, "utc_offset": -14400, "statuses_count": 20966, "description": "Mi \u00eddolo es @justinbieber , si te gusta \u00a1genial!, si no, solo respetalo. El cambi\u00f3 mi vida completamente y mi sue\u00f1o es conocerlo #TrueBelieber . ", "friends_count": 1015, "profile_link_color": "9404b8", "profile_image_url": "http://a1.twimg.com/profile_images/1808883280/Captura6_normal.JPG", "notifications": null, "show_all_inline_media": false, "geo_enabled": false, "profile_background_color": "f9fcfa", "id_str": "406750700", "profile_background_image_url": "http://a3.twimg.com/profile_background_images/416005864/Captura.JPG", "name": "neversaynever,right?", "lang": "es", "profile_background_tile": false, "favourites_count": 22, "screen_name": "True_Belieebers", "url": "http://www.wehavebieber-fever.tumblr.com", "created_at": "Mon Nov 07 04:17:40 +0000 2011", "contributors_enabled": false, "time_zone": "Santiago", "profile_sidebar_border_color": "C0DEED", "default_profile": false, "following": null}, "in_reply_to_screen_name": "justinbieber", "retweet_count": 0, "geo": null, "id": 168931016856178688, "source": "<a href=\"http://yfrog.com\" rel=\"nofollow\">Yfrog</a>"} I load it into DDFS with: # ddfs chunk data:test1 ./file.txt created: disco://localhost/ddfs/vol0/blob/44/file_txt-0$549-db27b-125e1 I test that the file is indeed loaded into ddfs with: # ddfs xcat data:test1 {"favorited": false, "in_reply_to_user_id": null, "contributors": null, "truncated": false, "text": "I'll call him back tomorrow I guess", "created_at": "Mon Feb 13 05:34:27 +0000 2012", "retweeted": false, "in_reply_to_status_id_str": null, "coordinates": null, "in_reply_to_user_id_str": null, "entities": {"user_mentions": [], "hashtags": [], "urls": []}, "in_reply_to_status_id": null, "id_str": "168931016843603968", "place": null, "user": {"follow_request_sent": null, "profile_use_background_image": true, "profile_background_image_url_https": "https://si0.twimg.com/profile_background_images/305726905/FASHION-3.png", "verified": false, "profile_image_url_https": "https://si0.twimg.com/profile_images/1818996723/image_normal.jpg", "profile_sidebar_fill_color": "292727", "is_translator": false, "id": 113532729, "profile_text_color": "000000", "followers_count": 78, "protected": false, "location": "With My Niggas In Paris!", "default_profile_image": false, "listed_count": 0, "utc_offset": -21600, "statuses_count": 6733, "description": "Made in CHINA., Educated && Making My Own $$. Fear GOD && Put Him 1st. #TeamFollowBack #TeamiPhone\n", "friends_count": 74, "profile_link_color": "b03f3f", "profile_image_url": "http://a2.twimg.com/profile_images/1818996723/image_normal.jpg", "notifications": null, "show_all_inline_media": false, "geo_enabled": true, "profile_background_color": "1f9199", "id_str": "113532729", "profile_background_image_url": "http://a3.twimg.com/profile_background_images/305726905/FASHION-3.png", "name": "Bee'Jay", "lang": "en", "profile_background_tile": true, "favourites_count": 19, "screen_name": "OohMyBEEsNice", "url": "http://www.bitchimpaid.org", "created_at": "Fri Feb 12 03:32:54 +0000 2010", "contributors_enabled": false, "time_zone": "Central Time (US & Canada)", "profile_sidebar_border_color": "000000", "default_profile": false, "following": null}, "in_reply_to_screen_name": null, "retweet_count": 0, "geo": null, "id": 168931016843603968, "source": "<a href=\"http://twitter.com/#!/download/iphone\" rel=\"nofollow\">Twitter for iPhone</a>"} {"favorited": false, "in_reply_to_user_id": 50940453, "contributors": null, "truncated": false, "text": "@LegaMrvica @MimozaBand makasi om artis :D kadoo kadoo", "created_at": "Mon Feb 13 05:34:27 +0000 2012", "retweeted": false, "in_reply_to_status_id_str": "168653037894770688", "coordinates": null, "in_reply_to_user_id_str": "50940453", "entities": {"user_mentions": [{"indices": [0, 11], "screen_name": "LegaMrvica", "id": 50940453, "name": "Lega_thePianis", "id_str": "50940453"}, {"indices": [12, 23], "screen_name": "MimozaBand", "id": 375128905, "name": "Mimoza", "id_str": "375128905"}], "hashtags": [], "urls": []}, "in_reply_to_status_id": 168653037894770688, "id_str": "168931016868761600", "place": null, "user": {"follow_request_sent": null, "profile_use_background_image": true, "profile_background_image_url_https": "https://si0.twimg.com/profile_background_images/347686061/Galungan_dan_Kuningan.jpg", "verified": false, "profile_image_url_https": "https://si0.twimg.com/profile_images/1803845596/Picture_20124_normal.jpg", "profile_sidebar_fill_color": "DDFFCC", "is_translator": false, "id": 48293450, "profile_text_color": "333333", "followers_count": 182, "protected": false, "location": "\u00dcT: -6.906799,107.622383", "default_profile_image": false, "listed_count": 0, "utc_offset": -28800, "statuses_count": 3052, "description": "Fashion design maranatha '11 // traditional dancer (bali) at sanggar tampak siring & Natya Nataraja", "friends_count": 206, "profile_link_color": "0084B4", "profile_image_url": "http://a3.twimg.com/profile_images/1803845596/Picture_20124_normal.jpg", "notifications": null, "show_all_inline_media": false, "geo_enabled": true, "profile_background_color": "9AE4E8", "id_str": "48293450", "profile_background_image_url": "http://a0.twimg.com/profile_background_images/347686061/Galungan_dan_Kuningan.jpg", "name": "nana afiff", "lang": "en", "profile_background_tile": true, "favourites_count": 2, "screen_name": "hasnfebria", "url": null, "created_at": "Thu Jun 18 08:50:29 +0000 2009", "contributors_enabled": false, "time_zone": "Pacific Time (US & Canada)", "profile_sidebar_border_color": "BDDCAD", "default_profile": false, "following": null}, "in_reply_to_screen_name": "LegaMrvica", "retweet_count": 0, "geo": null, "id": 168931016868761600, "source": "<a href=\"http://blackberry.com/twitter\" rel=\"nofollow\">Twitter for BlackBerry\u00ae</a>"} {"favorited": false, "in_reply_to_user_id": 27260086, "contributors": null, "truncated": false, "text": "@justinbieber u were born to be somebody, and u're super important in beliebers' life. thanks for all biebs. I love u. follow me? 84", "created_at": "Mon Feb 13 05:34:27 +0000 2012", "retweeted": false, "in_reply_to_status_id_str": null, "coordinates": null, "in_reply_to_user_id_str": "27260086", "entities": {"user_mentions": [{"indices": [0, 13], "screen_name": "justinbieber", "id": 27260086, "name": "Justin Bieber", "id_str": "27260086"}], "hashtags": [], "urls": []}, "in_reply_to_status_id": null, "id_str": "168931016856178688", "place": null, "user": {"follow_request_sent": null, "profile_use_background_image": true, "profile_background_image_url_https": "https://si0.twimg.com/profile_background_images/416005864/Captura.JPG", "verified": false, "profile_image_url_https": "https://si0.twimg.com/profile_images/1808883280/Captura6_normal.JPG", "profile_sidebar_fill_color": "f5e7f3", "is_translator": false, "id": 406750700, "profile_text_color": "333333", "followers_count": 1122, "protected": false, "location": "Adentro de una supra.", "default_profile_image": false, "listed_count": 0, "utc_offset": -14400, "statuses_count": 20966, "description": "Mi \u00eddolo es @justinbieber , si te gusta \u00a1genial!, si no, solo respetalo. El cambi\u00f3 mi vida completamente y mi sue\u00f1o es conocerlo #TrueBelieber . ", "friends_count": 1015, "profile_link_color": "9404b8", "profile_image_url": "http://a1.twimg.com/profile_images/1808883280/Captura6_normal.JPG", "notifications": null, "show_all_inline_media": false, "geo_enabled": false, "profile_background_color": "f9fcfa", "id_str": "406750700", "profile_background_image_url": "http://a3.twimg.com/profile_background_images/416005864/Captura.JPG", "name": "neversaynever,right?", "lang": "es", "profile_background_tile": false, "favourites_count": 22, "screen_name": "True_Belieebers", "url": "http://www.wehavebieber-fever.tumblr.com", "created_at": "Mon Nov 07 04:17:40 +0000 2011", "contributors_enabled": false, "time_zone": "Santiago", "profile_sidebar_border_color": "C0DEED", "default_profile": false, "following": null}, "in_reply_to_screen_name": "justinbieber", "retweet_count": 0, "geo": null, "id": 168931016856178688, "source": "<a href=\"http://yfrog.com\" rel=\"nofollow\">Yfrog</a> At this point everything is great, I load up the script that resulted from a previous Stack Post: from disco.core import Job, result_iterator import gzip def map(line, params): import unicodedata import json r = json.loads(line).get('text') s = unicodedata.normalize('NFD', r).encode('ascii', 'ignore') for word in s.split(): yield word, 1 def reduce(iter, params): from disco.util import kvgroup for word, counts in kvgroup(sorted(iter)): yield word, sum(counts) if __name__ == '__main__': job = Job().run(input=["tag://data:test1"], map=map, reduce=reduce) for word, count in result_iterator(job.wait(show=True)): print word, count NOTE: That this script runs file if the input=["file.txt"], however when I run it with "tag://data:test1" I get the following error: # DISCO_EVENTS=1 python count_normal_words.py Job@549:db30e:25bd8: Status: [map] 0 waiting, 1 running, 0 done, 0 failed 2012/11/25 21:43:26 master New job initialized! 2012/11/25 21:43:26 master Starting job 2012/11/25 21:43:26 master Starting map phase 2012/11/25 21:43:26 master map:0 assigned to solice 2012/11/25 21:43:26 master ERROR: Job failed: Worker at 'solice' died: Traceback (most recent call last): File "/home/DISCO/data/solice/01/Job@549:db30e:25bd8/usr/local/lib/python2.7/site-packages/disco/worker/__init__.py", line 329, in main job.worker.start(task, job, **jobargs) File "/home/DISCO/data/solice/01/Job@549:db30e:25bd8/usr/local/lib/python2.7/site-packages/disco/worker/__init__.py", line 290, in start self.run(task, job, **jobargs) File "/home/DISCO/data/solice/01/Job@549:db30e:25bd8/usr/local/lib/python2.7/site-packages/disco/worker/classic/worker.py", line 286, in run getattr(self, task.mode)(task, params) File "/home/DISCO/data/solice/01/Job@549:db30e:25bd8/usr/local/lib/python2.7/site-packages/disco/worker/classic/worker.py", line 299, in map for key, val in self['map'](entry, params): File "count_normal_words.py", line 12, in map File "/usr/lib64/python2.7/json/__init__.py", line 326, in loads return _default_decoder.decode(s) File "/usr/lib64/python2.7/json/decoder.py", line 366, in decode obj, end = self.raw_decode(s, idx=_w(s, 0).end()) File "/usr/lib64/python2.7/json/decoder.py", line 384, in raw_decode raise ValueError("No JSON object could be decoded") ValueError: No JSON object could be decoded 2012/11/25 21:43:26 master WARN: Job killed Status: [map] 1 waiting, 0 running, 0 done, 1 failed Traceback (most recent call last): File "count_normal_words.py", line 28, in <module> for word, count in result_iterator(job.wait(show=True)): File "/usr/local/lib/python2.7/site-packages/disco/core.py", line 348, in wait timeout, poll_interval * 1000) File "/usr/local/lib/python2.7/site-packages/disco/core.py", line 309, in check_results raise JobError(Job(name=jobname, master=self), "Status %s" % status) disco.error.JobError: Job Job@549:db30e:25bd8 failed: Status dead The Error states: ValueError: No JSON object could be decoded. Again, this works fine using the text file as input but now DDFS. Any ideas, I'm open to suggestions?

    Read the article

  • Java Compiler Creation Help..Please

    - by Brian
    I need some help with my code here...What we are trying to do is make a compiler that will read a file containing Machine Code and converting it to 100 lines of 4 bits example: this code is the machine code being converting to opcode and operands. I need some help please.. thanks 799 798 198 499 1008 1108 899 909 898 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 Everything compiles but when I go and run my Test.java I get the following OutPut: Exception in thread "main" java.util.NoSuchElementException: No line found at java.util.Scanner.nextLine(Scanner.java:1516) at Compiler.FirstPass(Compiler.java:22) at Compiler.compile(Compiler.java:11) at Test.main(Test.java:5) Here is my class Compiler: import java.io.*; import java.io.DataOutputStream; import java.util.NoSuchElementException; import java.util.Scanner; class Compiler{ private int lc = 0; private int dc = 99; public void compile(String filename) { SymbolList symbolTable = FirstPass(filename); SecondPass(symbolTable, filename); } public SymbolList FirstPass(String filename) { File file = new File(filename); SymbolList temp = new SymbolList(); int dc = 99; int lc = 0; try{ Scanner scan = new Scanner(file); String line = scan.nextLine(); String[] linearray = line.split(" "); while(line!=null){ if(!linearray[0].equals("REM")){ if(!this.isInstruction(linearray[0])){ linearray[0]=removeColon(linearray[0]); if(this.isInstruction(linearray[1])){ temp.add(new Symbol(linearray[0], lc, null)); lc++; } else { temp.add(new Symbol(linearray[0], dc, Integer.valueOf((linearr\ ay[2])))); dc--; } } else { if(!linearray[0].equals("REM")) lc++; } } try{ line = scan.nextLine(); } catch(NoSuchElementException e){ line=null; break; } linearray = line.split(" "); } } catch (FileNotFoundException e) { // TODO Auto-generated catch block e.printStackTrace(); } return temp; } public String makeFilename(String filename) { return filename + ".ex"; } public String removeColon(String str) { if(str.charAt(str.length()-1) == ':'){ return str.substring(0, str.length()-1); } else { return str; } } public void SecondPass(SymbolList symbolTable, String filename){ try { int dc = 99; //Open file for reading File file = new File(filename); Scanner scan = new Scanner(file); //Make filename of new executable file String newfile = makeFilename(filename); //Open Output Stream for writing new file. FileOutputStream os = new FileOutputStream(filename); DataOutputStream dos = new DataOutputStream(os); //Read First line. Split line by Spaces into linearray. String line = scan.nextLine(); String[] linearray = line.split(" "); while(scan.hasNextLine()){ if(!linearray[0].equals("REM")){ int inst=0, opcode, loc; if(isInstruction(linearray[0])){ opcode = getOpcode(linearray[0]); loc = symbolTable.searchName(linearray[1]).getMemloc(); inst = (opcode*100)+loc; } else if(!isInstruction(linearray[0])){ if(isInstruction(linearray[1])){ opcode = getOpcode(linearray[1]); if(linearray[1].equals("STOP")) inst=0000; else { loc = symbolTable.searchName(linearray[2]).getMemloc(); inst = (opcode*100)+loc; } } if(linearray[1].equals("DC")) dc--; } System.out.println(inst); dos.writeInt(inst); linearray = line.split(" "); } if(scan.hasNextLine()) { line = scan.nextLine(); } } scan.close(); for(int i = lc; i <= dc; i++) { dos.writeInt(0); } for(int i = dc+1; i<100; i++){ dos.writeInt(symbolTable.searchLocation(i).getValue()); if(i!=99) dos.writeInt(0); } dos.close(); os.close(); } catch (Exception e) { // TODO Auto-generated catch block e.printStackTrace(); } } public int getOpcode(String inst){ int toreturn = -1; if(isInstruction(inst)){ if(inst.equals("STOP")) toreturn=0; if(inst.equals("LD")) toreturn=1; if(inst.equals("STO")) toreturn=2; if(inst.equals("ADD")) toreturn=3; if(inst.equals("SUB")) toreturn=4; if(inst.equals("MPY")) toreturn=5; if(inst.equals("DIV")) toreturn=6; if(inst.equals("IN")) toreturn=7; if(inst.equals("OUT")) toreturn=8; if(inst.equals("B")) toreturn=9; if(inst.equals("BGTR")) toreturn=10; if(inst.equals("BZ")) toreturn=11; return toreturn; } else { return -1; } } public boolean isInstruction(String totest){ boolean toreturn = false; String[] labels = {"IN", "LD", "SUB", "BGTR", "BZ", "OUT", "B", "STO", "STOP", "AD\ D", "MTY", "DIV"}; for(int i = 0; i < 12; i++){ if(totest.equals(labels[i])) toreturn = true; } return toreturn; } } And here is my class Computer: import java.io.*; import java.util.NoSuchElementException; import java.util.Scanner; class Computer{ private Cpu cpu; private Input in; private OutPut out; private Memory mem; public Computer() throws IOException { Memory mem = new Memory(100); Input in = new Input(); OutPut out = new OutPut(); Cpu cpu = new Cpu(); System.out.println(in.getInt()); } public void run() throws IOException { cpu.reset(); cpu.setMDR(mem.read(cpu.getMAR())); cpu.fetch2(); while (!cpu.stop()) { cpu.decode(); if (cpu.OutFlag()) OutPut.display(mem.read(cpu.getMAR())); if (cpu.InFlag()) mem.write(cpu.getMDR(),in.getInt()); if (cpu.StoreFlag()) { mem.write(cpu.getMAR(),in.getInt()); cpu.getMDR(); } else { cpu.setMDR(mem.read(cpu.getMAR())); cpu.execute(); cpu.fetch(); cpu.setMDR(mem.read(cpu.getMAR())); cpu.fetch2(); } } } public void load() { mem.loadMemory(); } } Here is my Memory class: import java.io.*; import java.util.NoSuchElementException; import java.util.Scanner; class Memory{ private MemEl[] memArray; private int size; private int[] mem; public Memory(int s) {size = s; memArray = new MemEl[s]; for(int i = 0; i < s; i++) memArray[i] = new MemEl(); } public void write (int loc,int val) {if (loc >=0 && loc < size) memArray[loc].write(val); else System.out.println("Index Not in Domain"); } public int read (int loc) {return memArray[loc].read(); } public void dump() { for(int i = 0; i < size; i++) if(i%1 == 0) System.out.println(memArray[i].read()); else System.out.print(memArray[i].read()); } public void writeTo(int location, int value) { mem[location] = value; } public int readFrom(int location) { return mem[location]; } public int size() { return mem.length; } public void loadMemory() { this.write(0, 799); this.write(1, 798); this.write(2, 198); this.write(3, 499); this.write(4, 1008); this.write(5, 1108); this.write(6, 899); this.write(7, 909); this.write(8, 898); this.write(9, 0000); } public void loadFromFile(String filename){ try { FileReader fr = new FileReader(filename); BufferedReader br = new BufferedReader(fr); String read=null; int towrite=0; int l=0; do{ try{ read=br.readLine(); towrite = Integer.parseInt(read); }catch(Exception e){ } this.write(l, towrite); l++; }while(l<100); }catch (Exception e) { // TODO Auto-generated catch block e.printStackTrace(); } } } Here is my Test class: public class Test{ public static void main(String[] args) throws java.io.IOException { Compiler compiler = new Compiler(); compiler.compile("program.txt"); } }

    Read the article

  • Chef-solo cannot locate an nginx recipe template

    - by crftr
    I have been recently experimenting with Chef. I thought I would attempt to rebuild my personal web server using chef-solo. It's an AWS instance running the Amazon 64bit Linux AMI. My first objective is to install nginx. I have cloned the Opscode cookbook repository, and am using their nginx cookbook. My problem appears to be that chef-solo cannot find a template after it has started the process. The command I'm using is chef-solo -j /etc/chef/dna.json dna.json { "nginx": { "user": "ec2-user" }, "recipes": [ "nginx" ] } solo.rb file_cache_path "/var/chef-solo" cookbook_path "/var/chef-solo/cookbooks" ...the output [root@ip-10-202-221-135 chef-solo]# chef-solo -j /etc/chef/dna.json /usr/lib64/ruby/gems/1.9.1/gems/systemu-2.2.0/lib/systemu.rb:29: Use RbConfig instead of obsolete and deprecated Config. [Fri, 27 Jan 2012 19:41:36 +0000] INFO: *** Chef 0.10.8 *** [Fri, 27 Jan 2012 19:41:37 +0000] INFO: Setting the run_list to ["nginx"] from JSON [Fri, 27 Jan 2012 19:41:37 +0000] INFO: Run List is [recipe[nginx]] [Fri, 27 Jan 2012 19:41:37 +0000] INFO: Run List expands to [nginx] [Fri, 27 Jan 2012 19:41:37 +0000] INFO: Starting Chef Run for ip-10-202-221-135.ec2.internal [Fri, 27 Jan 2012 19:41:37 +0000] INFO: Running start handlers [Fri, 27 Jan 2012 19:41:37 +0000] INFO: Start handlers complete. [Fri, 27 Jan 2012 19:41:37 +0000] INFO: Missing gem 'mysql' [Fri, 27 Jan 2012 19:41:38 +0000] INFO: Processing package[nginx] action install (nginx::default line 21) [Fri, 27 Jan 2012 19:41:39 +0000] INFO: Processing directory[/var/log/nginx] action create (nginx::default line 23) [Fri, 27 Jan 2012 19:41:39 +0000] INFO: Processing template[/usr/sbin/nxensite] action create (nginx::default line 30) [Fri, 27 Jan 2012 19:41:39 +0000] INFO: Processing template[/usr/sbin/nxdissite] action create (nginx::default line 30) [Fri, 27 Jan 2012 19:41:39 +0000] INFO: Processing template[nginx.conf] action create (nginx::default line 38) [Fri, 27 Jan 2012 19:41:39 +0000] INFO: Processing template[/etc/nginx/sites-available/default] action create (nginx::default line 46) [Fri, 27 Jan 2012 19:41:39 +0000] INFO: template[/etc/nginx/sites-available/default] mode changed to 644 [Fri, 27 Jan 2012 19:41:39 +0000] ERROR: template[/etc/nginx/sites-available/default] (nginx::default line 46) has had an error [Fri, 27 Jan 2012 19:41:39 +0000] ERROR: template[/etc/nginx/sites-available/default] (/var/chef-solo/cookbooks/nginx/recipes/default.rb:46:in `from_file') had an error: template[/etc/nginx/sites-available/default] (nginx::default line 46) had an error: Errno::ENOENT: No such file or directory - (/tmp/chef-rendered-template20120127-29441-1yp55vz, /etc/nginx/sites-available/default) /usr/lib64/ruby/1.9.1/fileutils.rb:519:in `rename' /usr/lib64/ruby/1.9.1/fileutils.rb:519:in `block in mv' /usr/lib64/ruby/1.9.1/fileutils.rb:1515:in `block in fu_each_src_dest' /usr/lib64/ruby/1.9.1/fileutils.rb:1531:in `fu_each_src_dest0' /usr/lib64/ruby/1.9.1/fileutils.rb:1513:in `fu_each_src_dest' /usr/lib64/ruby/1.9.1/fileutils.rb:508:in `mv' /usr/lib64/ruby/gems/1.9.1/gems/chef-0.10.8/lib/chef/provider/template.rb:47:in `block in action_create' /usr/lib64/ruby/gems/1.9.1/gems/chef-0.10.8/lib/chef/mixin/template.rb:48:in `block in render_template' /usr/lib64/ruby/1.9.1/tempfile.rb:316:in `open' /usr/lib64/ruby/gems/1.9.1/gems/chef-0.10.8/lib/chef/mixin/template.rb:45:in `render_template' /usr/lib64/ruby/gems/1.9.1/gems/chef-0.10.8/lib/chef/provider/template.rb:99:in `render_with_context' /usr/lib64/ruby/gems/1.9.1/gems/chef-0.10.8/lib/chef/provider/template.rb:39:in `action_create' /usr/lib64/ruby/gems/1.9.1/gems/chef-0.10.8/lib/chef/resource.rb:440:in `run_action' /usr/lib64/ruby/gems/1.9.1/gems/chef-0.10.8/lib/chef/runner.rb:45:in `run_action' /usr/lib64/ruby/gems/1.9.1/gems/chef-0.10.8/lib/chef/runner.rb:81:in `block (2 levels) in converge' /usr/lib64/ruby/gems/1.9.1/gems/chef-0.10.8/lib/chef/runner.rb:81:in `each' /usr/lib64/ruby/gems/1.9.1/gems/chef-0.10.8/lib/chef/runner.rb:81:in `block in converge' /usr/lib64/ruby/gems/1.9.1/gems/chef-0.10.8/lib/chef/resource_collection.rb:94:in `block in execute_each_resource' /usr/lib64/ruby/gems/1.9.1/gems/chef-0.10.8/lib/chef/resource_collection/stepable_iterator.rb:116:in `call' /usr/lib64/ruby/gems/1.9.1/gems/chef-0.10.8/lib/chef/resource_collection/stepable_iterator.rb:116:in `call_iterator_block' /usr/lib64/ruby/gems/1.9.1/gems/chef-0.10.8/lib/chef/resource_collection/stepable_iterator.rb:85:in `step' /usr/lib64/ruby/gems/1.9.1/gems/chef-0.10.8/lib/chef/resource_collection/stepable_iterator.rb:104:in `iterate' /usr/lib64/ruby/gems/1.9.1/gems/chef-0.10.8/lib/chef/resource_collection/stepable_iterator.rb:55:in `each_with_index' /usr/lib64/ruby/gems/1.9.1/gems/chef-0.10.8/lib/chef/resource_collection.rb:92:in `execute_each_resource' /usr/lib64/ruby/gems/1.9.1/gems/chef-0.10.8/lib/chef/runner.rb:76:in `converge' /usr/lib64/ruby/gems/1.9.1/gems/chef-0.10.8/lib/chef/client.rb:312:in `converge' /usr/lib64/ruby/gems/1.9.1/gems/chef-0.10.8/lib/chef/client.rb:160:in `run' /usr/lib64/ruby/gems/1.9.1/gems/chef-0.10.8/lib/chef/application/solo.rb:192:in `block in run_application' /usr/lib64/ruby/gems/1.9.1/gems/chef-0.10.8/lib/chef/application/solo.rb:183:in `loop' /usr/lib64/ruby/gems/1.9.1/gems/chef-0.10.8/lib/chef/application/solo.rb:183:in `run_application' /usr/lib64/ruby/gems/1.9.1/gems/chef-0.10.8/lib/chef/application.rb:67:in `run' /usr/lib64/ruby/gems/1.9.1/gems/chef-0.10.8/bin/chef-solo:25:in `<top (required)>' /usr/bin/chef-solo:19:in `load' /usr/bin/chef-solo:19:in `<main>' [Fri, 27 Jan 2012 19:41:39 +0000] ERROR: Running exception handlers [Fri, 27 Jan 2012 19:41:39 +0000] ERROR: Exception handlers complete [Fri, 27 Jan 2012 19:41:39 +0000] FATAL: Stacktrace dumped to /var/chef-solo/chef-stacktrace.out [Fri, 27 Jan 2012 19:41:39 +0000] FATAL: Errno::ENOENT: template[/etc/nginx/sites-available/default] (nginx::default line 46) had an error: Errno::ENOENT: No such file or directory - (/tmp/chef-rendered-template20120127-29441-1yp55vz, /etc/nginx/sites-available/default) What am I doing incorrectly?

    Read the article

  • Which Single Source Publishing tools and strategies are available?

    - by Another Registered User
    I'm about to write a 1000-Pages Documentation about a huge programming framework. The goal is to bring this documentation online into an web platform, so that online users can search through it and read it online. At the same time, the text has to be made public in PDF format for download. And at the same time, the whole thing needs to go into a printed book as well (print on demand, they want a giant PDF file with the whole book). The PDF files: The whole content is divided into several chapters. Every chapter will be available as a standalone PDF eBook. And finally, all chapters will be available in one huge printed book. Is LaTeX capable for something like that? Can it be used for Single Source Publishing? Or would I have to take a look at other technologies like DocBook, etc.?

    Read the article

  • forced reformat without login / and bootcamp

    - by debug
    ok.. im pretty good with stuff like this, but I have a question. I have mac mini with 10.5.(x) on one partition, and bootcamp (windows) on the other. My boss wants me to reformat the whole mac (10.6 (x)), which is usually easy. He does not remember his password to login, which means I cannot log in and allocate the bootcamp back to one partition using Disk Utility, then reformat the whole drive. When I insert the Snow leopard CD, I can only wipe out one partition, my question is: Is there a way to force a wipe out of both drives in the boot sequence? Any help to wipe out this whole drive and do a clean install would be helpful.. Thanks superusers!

    Read the article

  • How does MySQL 5.5 and InnoDB on Linux use RAM?

    - by Loren
    Does MySQL 5.5 InnoDB keep indexes in memory and tables on disk? Does it ever do it's own in-memory caching of part or whole tables? Or does it completely rely on the OS page cache (I'm guessing that it does since Facebook's SSD cache that was built for MySQL was done at the OS-level: https://github.com/facebook/flashcache/)? Does Linux by default use all of the available RAM for the page cache? So if RAM size exceeds table size + memory used by processes, then when MySQL server starts and reads the whole table for the first time it will be from disk, and from that point on the whole table is in RAM? So using Alchemy Database (SQL on top of Redis, everything always in RAM: http://code.google.com/p/alchemydatabase/) shouldn't be much faster than MySQL, given the same size RAM and database?

    Read the article

  • Convert text to table

    - by Quattro
    I would like convert text into a table. Here is a link to the text http://www.tcdb.org/public/tcdb Short example: >gnl|TC-DB|A0CIB0|1.A.17.3.1 Chromosome undetermined scaffold_19, whole genome shotgun sequence OS=Paramecium tetraurelia GN=GSPATT00007662001 PE=4 SV=1 MDDQNQPILQEQPKPKQKKPLLNTKMVKKQKMQNKKEENLREILNFYTNQVDARKFLQKM KAVVDSNQQEKKYQDDFLNPNEYNEMQDIYEDYNMGDLVIVFPNPDADGVKNPPITYKEA PLTKTNFYSKIGNVSYENDIDELCVDEMEYLRNMRNVDGEHMDQDHVKEEI >gnl|TC-DB|A0CS82|9.B.82.1.5 Chromosome undetermined scaffold_26, whole genome shotgun sequence - Paramecium tetraurelia. MIIEEQIEEKMIYKAIHRVKVNYQKKIDRYILYKKSRWFFNLLLMLLYAYRIQNIGGFYI VTYIYCVYQLQLLIDYFTPLGLPPVNLEDEEEDDDQFQNDFSELPTTLSNKNELNDKEFR PLLRTTSEFKVWQKSVFSVIFAYFCTYIPIWDIPVYWPFLFCYFFVIVGMSIRKYIKHMK KYGYTILDFTKKK I wanted to have columns for example delimited with pipe | or ; |>gnl|TC-DB|A0CIB0|1.A.17.3.1| Chromosome undetermined scaffold_19, whole genome shotgun sequence OS=Paramecium tetraurelia GN=GSPATT00007662001 PE=4 SV=1| MDDQNQPILQEQPKPKQKKPLLNTKMVKKQKMQNKKEENLREILNFYTNQVDARKFLQKM KAVVDSNQQEKKYQDDFLNPNEYNEMQDIYEDYNMGDLVIVFPNPDADGVKNPPITYKEA PLTKTNFYSKIGNVSYENDIDELCVDEMEYLRNMRNVDGEHMDQDHVKEEI I am working with Windows and I don't know how to do it I just know every row starts with > I want to substitute the first whitespace in a row with a delimiter like | or ; after the first regular expression new line in a row, I want also a delimiter everything between the regular expression first new line and > should go into a new column (it's a sequence of a protein)

    Read the article

< Previous Page | 205 206 207 208 209 210 211 212 213 214 215 216  | Next Page >