Search Results

Search found 1787 results on 72 pages for 'inline if'.

Page 21/72 | < Previous Page | 17 18 19 20 21 22 23 24 25 26 27 28  | Next Page >

  • How-to hide the close icon for task flows opened in dialogs

    - by frank.nimphius
    Normal 0 false false false EN-US X-NONE X-NONE /* Style Definitions */ table.MsoNormalTable {mso-style-name:"Table Normal"; mso-tstyle-rowband-size:0; mso-tstyle-colband-size:0; mso-style-noshow:yes; mso-style-priority:99; mso-style-qformat:yes; mso-style-parent:""; mso-padding-alt:0in 5.4pt 0in 5.4pt; mso-para-margin:0in; mso-para-margin-bottom:.0001pt; mso-pagination:widow-orphan; font-size:11.0pt; font-family:"Calibri","sans-serif"; mso-ascii-font-family:Calibri; mso-ascii-theme-font:minor-latin; mso-fareast-font-family:"Times New Roman"; mso-fareast-theme-font:minor-fareast; mso-hansi-font-family:Calibri; mso-hansi-theme-font:minor-latin; mso-bidi-font-family:"Times New Roman"; mso-bidi-theme-font:minor-bidi;} ADF bounded task flows can be opened in an external dialog and return values to the calling application as documented in chapter 19 of Oracle Fusion Middleware Fusion Developer's Guide for Oracle Application Development Framework11g: http://download.oracle.com/docs/cd/E15523_01/web.1111/b31974/taskflows_dialogs.htm#BABBAFJB Setting the task flow call activity property Run as Dialog to true and the Display Type property to inline-popup opens the bounded task flow in an inline popup. To launch the dialog, a command item is used that references the control flow case to the task flow call activity <af:commandButton text="Lookup" id="cb6"         windowEmbedStyle="inlineDocument" useWindow="true"         windowHeight="300" windowWidth="300"         action="lookup" partialSubmit="true"/> By default, the dialog that contains the task flow has a close icon defined that if pressed closes the dialog and returns to the calling page. However, no event is sent to the calling page to handle the close case. To avoid users closing the dialog without the calling application to be notified in a return listener, the close icon shown in the opened dialog can be hidden using ADF Faces skinning. Normal 0 false false false EN-US X-NONE X-NONE /* Style Definitions */ table.MsoNormalTable {mso-style-name:"Table Normal"; mso-tstyle-rowband-size:0; mso-tstyle-colband-size:0; mso-style-noshow:yes; mso-style-priority:99; mso-style-qformat:yes; mso-style-parent:""; mso-padding-alt:0in 5.4pt 0in 5.4pt; mso-para-margin:0in; mso-para-margin-bottom:.0001pt; mso-pagination:widow-orphan; font-size:11.0pt; font-family:"Calibri","sans-serif"; mso-ascii-font-family:Calibri; mso-ascii-theme-font:minor-latin; mso-fareast-font-family:"Times New Roman"; mso-fareast-theme-font:minor-fareast; mso-hansi-font-family:Calibri; mso-hansi-theme-font:minor-latin; mso-bidi-font-family:"Times New Roman"; mso-bidi-theme-font:minor-bidi;} The following skin selector hides the close icon in the dialog af|panelWindow::close-icon-style{ display:none; } To learn about skinning, see chapter 20 of Oracle Fusion Middleware Web User Interface Developer's Guide for Oracle Application Development Framework http://download.oracle.com/docs/cd/E15523_01/web.1111/b31973/af_skin.htm#BAJFEFCJ However, the skin selector that is shown above hides the close icon from all af:panelWindow usages, which may not be intended. To only hide the close icon from dialogs opened by a bounded task flow call activity, the ADF Faces component styleClass property can be used. The af:panelWindow component shown below has a "withCloseWindow" style class property name defined. This name is referenced in the following skin selector, ensuring that the close icon is displayed af|panelWindow.withCloseIcon::close-icon-style{ display:block; } In summary, to hide the close icon shown for bounded task flows that are launched in inline popup dialogs, the default display behavior of the close icon of the af:panelWindow needs to be reversed. Instead to always display the close icon, the close icon is always hidden, using the first skin selector. To show the disclosed icon in other usages of the af:panelWindow component, the component is flagged with a styleClass property value as shown below <af:popup id="p1">   <af:panelWindow id="pw1" contentWidth="300" contentHeight="300"                                 styleClass="withCloseIcon"/> </af:popup> The "withCloseIcon" value is referenced in the second skin definition af|panelWindow.withCloseIcon::close-icon-style{ display:block; } The complete entry of the skin CSS file looks as shown below: af|panelWindow::close-icon-style{ display:none; } af|panelWindow.withCloseIcon::close-icon-style{ display:block; }

    Read the article

  • What's New in ASP.NET 4

    - by Navaneeth
    The .NET Framework version 4 includes enhancements for ASP.NET 4 in targeted areas. Visual Studio 2010 and Microsoft Visual Web Developer Express also include enhancements and new features for improved Web development. This document provides an overview of many of the new features that are included in the upcoming release. This topic contains the following sections: ASP.NET Core Services ASP.NET Web Forms ASP.NET MVC Dynamic Data ASP.NET Chart Control Visual Web Developer Enhancements Web Application Deployment with Visual Studio 2010 Enhancements to ASP.NET Multi-Targeting ASP.NET Core Services ASP.NET 4 introduces many features that improve core ASP.NET services such as output caching and session state storage. Extensible Output Caching Since the time that ASP.NET 1.0 was released, output caching has enabled developers to store the generated output of pages, controls, and HTTP responses in memory. On subsequent Web requests, ASP.NET can serve content more quickly by retrieving the generated output from memory instead of regenerating the output from scratch. However, this approach has a limitation — generated content always has to be stored in memory. On servers that experience heavy traffic, the memory requirements for output caching can compete with memory requirements for other parts of a Web application. ASP.NET 4 adds extensibility to output caching that enables you to configure one or more custom output-cache providers. Output-cache providers can use any storage mechanism to persist HTML content. These storage options can include local or remote disks, cloud storage, and distributed cache engines. Output-cache provider extensibility in ASP.NET 4 lets you design more aggressive and more intelligent output-caching strategies for Web sites. For example, you can create an output-cache provider that caches the "Top 10" pages of a site in memory, while caching pages that get lower traffic on disk. Alternatively, you can cache every vary-by combination for a rendered page, but use a distributed cache so that the memory consumption is offloaded from front-end Web servers. You create a custom output-cache provider as a class that derives from the OutputCacheProvider type. You can then configure the provider in the Web.config file by using the new providers subsection of the outputCache element For more information and for examples that show how to configure the output cache, see outputCache Element for caching (ASP.NET Settings Schema). For more information about the classes that support caching, see the documentation for the OutputCache and OutputCacheProvider classes. By default, in ASP.NET 4, all HTTP responses, rendered pages, and controls use the in-memory output cache. The defaultProvider attribute for ASP.NET is AspNetInternalProvider. You can change the default output-cache provider used for a Web application by specifying a different provider name for defaultProvider attribute. In addition, you can select different output-cache providers for individual control and for individual requests and programmatically specify which provider to use. For more information, see the HttpApplication.GetOutputCacheProviderName(HttpContext) method. The easiest way to choose a different output-cache provider for different Web user controls is to do so declaratively by using the new providerName attribute in a page or control directive, as shown in the following example: <%@ OutputCache Duration="60" VaryByParam="None" providerName="DiskCache" %> Preloading Web Applications Some Web applications must load large amounts of data or must perform expensive initialization processing before serving the first request. In earlier versions of ASP.NET, for these situations you had to devise custom approaches to "wake up" an ASP.NET application and then run initialization code during the Application_Load method in the Global.asax file. To address this scenario, a new application preload manager (autostart feature) is available when ASP.NET 4 runs on IIS 7.5 on Windows Server 2008 R2. The preload feature provides a controlled approach for starting up an application pool, initializing an ASP.NET application, and then accepting HTTP requests. It lets you perform expensive application initialization prior to processing the first HTTP request. For example, you can use the application preload manager to initialize an application and then signal a load-balancer that the application was initialized and ready to accept HTTP traffic. To use the application preload manager, an IIS administrator sets an application pool in IIS 7.5 to be automatically started by using the following configuration in the applicationHost.config file: <applicationPools> <add name="MyApplicationPool" startMode="AlwaysRunning" /> </applicationPools> Because a single application pool can contain multiple applications, you specify individual applications to be automatically started by using the following configuration in the applicationHost.config file: <sites> <site name="MySite" id="1"> <application path="/" serviceAutoStartEnabled="true" serviceAutoStartProvider="PrewarmMyCache" > <!-- Additional content --> </application> </site> </sites> <!-- Additional content --> <serviceAutoStartProviders> <add name="PrewarmMyCache" type="MyNamespace.CustomInitialization, MyLibrary" /> </serviceAutoStartProviders> When an IIS 7.5 server is cold-started or when an individual application pool is recycled, IIS 7.5 uses the information in the applicationHost.config file to determine which Web applications have to be automatically started. For each application that is marked for preload, IIS7.5 sends a request to ASP.NET 4 to start the application in a state during which the application temporarily does not accept HTTP requests. When it is in this state, ASP.NET instantiates the type defined by the serviceAutoStartProvider attribute (as shown in the previous example) and calls into its public entry point. You create a managed preload type that has the required entry point by implementing the IProcessHostPreloadClient interface, as shown in the following example: public class CustomInitialization : System.Web.Hosting.IProcessHostPreloadClient { public void Preload(string[] parameters) { // Perform initialization. } } After your initialization code runs in the Preload method and after the method returns, the ASP.NET application is ready to process requests. Permanently Redirecting a Page Content in Web applications is often moved over the lifetime of the application. This can lead to links to be out of date, such as the links that are returned by search engines. In ASP.NET, developers have traditionally handled requests to old URLs by using the Redirect method to forward a request to the new URL. However, the Redirect method issues an HTTP 302 (Found) response (which is used for a temporary redirect). This results in an extra HTTP round trip. ASP.NET 4 adds a RedirectPermanent helper method that makes it easy to issue HTTP 301 (Moved Permanently) responses, as in the following example: RedirectPermanent("/newpath/foroldcontent.aspx"); Search engines and other user agents that recognize permanent redirects will store the new URL that is associated with the content, which eliminates the unnecessary round trip made by the browser for temporary redirects. Session State Compression By default, ASP.NET provides two options for storing session state across a Web farm. The first option is a session state provider that invokes an out-of-process session state server. The second option is a session state provider that stores data in a Microsoft SQL Server database. Because both options store state information outside a Web application's worker process, session state has to be serialized before it is sent to remote storage. If a large amount of data is saved in session state, the size of the serialized data can become very large. ASP.NET 4 introduces a new compression option for both kinds of out-of-process session state providers. By using this option, applications that have spare CPU cycles on Web servers can achieve substantial reductions in the size of serialized session state data. You can set this option using the new compressionEnabled attribute of the sessionState element in the configuration file. When the compressionEnabled configuration option is set to true, ASP.NET compresses (and decompresses) serialized session state by using the .NET Framework GZipStreamclass. The following example shows how to set this attribute. <sessionState mode="SqlServer" sqlConnectionString="data source=dbserver;Initial Catalog=aspnetstate" allowCustomSqlDatabase="true" compressionEnabled="true" /> ASP.NET Web Forms Web Forms has been a core feature in ASP.NET since the release of ASP.NET 1.0. Many enhancements have been in this area for ASP.NET 4, such as the following: The ability to set meta tags. More control over view state. Support for recently introduced browsers and devices. Easier ways to work with browser capabilities. Support for using ASP.NET routing with Web Forms. More control over generated IDs. The ability to persist selected rows in data controls. More control over rendered HTML in the FormView and ListView controls. Filtering support for data source controls. Enhanced support for Web standards and accessibility Setting Meta Tags with the Page.MetaKeywords and Page.MetaDescription Properties Two properties have been added to the Page class: MetaKeywords and MetaDescription. These two properties represent corresponding meta tags in the HTML rendered for a page, as shown in the following example: <head id="Head1" runat="server"> <title>Untitled Page</title> <meta name="keywords" content="keyword1, keyword2' /> <meta name="description" content="Description of my page" /> </head> These two properties work like the Title property does, and they can be set in the @ Page directive. For more information, see Page.MetaKeywords and Page.MetaDescription. Enabling View State for Individual Controls A new property has been added to the Control class: ViewStateMode. You can use this property to disable view state for all controls on a page except those for which you explicitly enable view state. View state data is included in a page's HTML and increases the amount of time it takes to send a page to the client and post it back. Storing more view state than is necessary can cause significant decrease in performance. In earlier versions of ASP.NET, you could reduce the impact of view state on a page's performance by disabling view state for specific controls. But sometimes it is easier to enable view state for a few controls that need it instead of disabling it for many that do not need it. For more information, see Control.ViewStateMode. Support for Recently Introduced Browsers and Devices ASP.NET includes a feature that is named browser capabilities that lets you determine the capabilities of the browser that a user is using. Browser capabilities are represented by the HttpBrowserCapabilities object which is stored in the HttpRequest.Browser property. Information about a particular browser's capabilities is defined by a browser definition file. In ASP.NET 4, these browser definition files have been updated to contain information about recently introduced browsers and devices such as Google Chrome, Research in Motion BlackBerry smart phones, and Apple iPhone. Existing browser definition files have also been updated. For more information, see How to: Upgrade an ASP.NET Web Application to ASP.NET 4 and ASP.NET Web Server Controls and Browser Capabilities. The browser definition files that are included with ASP.NET 4 are shown in the following list: •blackberry.browser •chrome.browser •Default.browser •firefox.browser •gateway.browser •generic.browser •ie.browser •iemobile.browser •iphone.browser •opera.browser •safari.browser A New Way to Define Browser Capabilities ASP.NET 4 includes a new feature referred to as browser capabilities providers. As the name suggests, this lets you build a provider that in turn lets you write custom code to determine browser capabilities. In ASP.NET version 3.5 Service Pack 1, you define browser capabilities in an XML file. This file resides in a machine-level folder or an application-level folder. Most developers do not need to customize these files, but for those who do, the provider approach can be easier than dealing with complex XML syntax. The provider approach makes it possible to simplify the process by implementing a common browser definition syntax, or a database that contains up-to-date browser definitions, or even a Web service for such a database. For more information about the new browser capabilities provider, see the What's New for ASP.NET 4 White Paper. Routing in ASP.NET 4 ASP.NET 4 adds built-in support for routing with Web Forms. Routing is a feature that was introduced with ASP.NET 3.5 SP1 and lets you configure an application to use URLs that are meaningful to users and to search engines because they do not have to specify physical file names. This can make your site more user-friendly and your site content more discoverable by search engines. For example, the URL for a page that displays product categories in your application might look like the following example: http://website/products.aspx?categoryid=12 By using routing, you can use the following URL to render the same information: http://website/products/software The second URL lets the user know what to expect and can result in significantly improved rankings in search engine results. the new features include the following: The PageRouteHandler class is a simple HTTP handler that you use when you define routes. You no longer have to write a custom route handler. The HttpRequest.RequestContext and Page.RouteData properties make it easier to access information that is passed in URL parameters. The RouteUrl expression provides a simple way to create a routed URL in markup. The RouteValue expression provides a simple way to extract URL parameter values in markup. The RouteParameter class makes it easier to pass URL parameter values to a query for a data source control (similar to FormParameter). You no longer have to change the Web.config file to enable routing. For more information about routing, see the following topics: ASP.NET Routing Walkthrough: Using ASP.NET Routing in a Web Forms Application How to: Define Routes for Web Forms Applications How to: Construct URLs from Routes How to: Access URL Parameters in a Routed Page Setting Client IDs The new ClientIDMode property makes it easier to write client script that references HTML elements rendered for server controls. Increasing use of Microsoft Ajax makes the need to do this more common. For example, you may have a data control that renders a long list of products with prices and you want to use client script to make a Web service call and update individual prices in the list as they change without refreshing the entire page. Typically you get a reference to an HTML element in client script by using the document.GetElementById method. You pass to this method the value of the id attribute of the HTML element you want to reference. In the case of elements that are rendered for ASP.NET server controls earlier versions of ASP.NET could make this difficult or impossible. You were not always able to predict what id values ASP.NET would generate, or ASP.NET could generate very long id values. The problem was especially difficult for data controls that would generate multiple rows for a single instance of the control in your markup. ASP.NET 4 adds two new algorithms for generating id attributes. These algorithms can generate id attributes that are easier to work with in client script because they are more predictable and that are easier to work with because they are simpler. For more information about how to use the new algorithms, see the following topics: ASP.NET Web Server Control Identification Walkthrough: Making Data-Bound Controls Easier to Access from JavaScript Walkthrough: Making Controls Located in Web User Controls Easier to Access from JavaScript How to: Access Controls from JavaScript by ID Persisting Row Selection in Data Controls The GridView and ListView controls enable users to select a row. In previous versions of ASP.NET, row selection was based on the row index on the page. For example, if you select the third item on page 1 and then move to page 2, the third item on page 2 is selected. In most cases, is more desirable not to select any rows on page 2. ASP.NET 4 supports Persisted Selection, a new feature that was initially supported only in Dynamic Data projects in the .NET Framework 3.5 SP1. When this feature is enabled, the selected item is based on the row data key. This means that if you select the third row on page 1 and move to page 2, nothing is selected on page 2. When you move back to page 1, the third row is still selected. This is a much more natural behavior than the behavior in earlier versions of ASP.NET. Persisted selection is now supported for the GridView and ListView controls in all projects. You can enable this feature in the GridView control, for example, by setting the EnablePersistedSelection property, as shown in the following example: <asp:GridView id="GridView2" runat="server" PersistedSelection="true"> </asp:GridView> FormView Control Enhancements The FormView control is enhanced to make it easier to style the content of the control with CSS. In previous versions of ASP.NET, the FormView control rendered it contents using an item template. This made styling more difficult in the markup because unexpected table row and table cell tags were rendered by the control. The FormView control supports RenderOuterTable, a property in ASP.NET 4. When this property is set to false, as show in the following example, the table tags are not rendered. This makes it easier to apply CSS style to the contents of the control. <asp:FormView ID="FormView1" runat="server" RenderTable="false"> For more information, see FormView Web Server Control Overview. ListView Control Enhancements The ListView control, which was introduced in ASP.NET 3.5, has all the functionality of the GridView control while giving you complete control over the output. This control has been made easier to use in ASP.NET 4. The earlier version of the control required that you specify a layout template that contained a server control with a known ID. The following markup shows a typical example of how to use the ListView control in ASP.NET 3.5. <asp:ListView ID="ListView1" runat="server"> <LayoutTemplate> <asp:PlaceHolder ID="ItemPlaceHolder" runat="server"></asp:PlaceHolder> </LayoutTemplate> <ItemTemplate> <% Eval("LastName")%> </ItemTemplate> </asp:ListView> In ASP.NET 4, the ListView control does not require a layout template. The markup shown in the previous example can be replaced with the following markup: <asp:ListView ID="ListView1" runat="server"> <ItemTemplate> <% Eval("LastName")%> </ItemTemplate> </asp:ListView> For more information, see ListView Web Server Control Overview. Filtering Data with the QueryExtender Control A very common task for developers who create data-driven Web pages is to filter data. This traditionally has been performed by building Where clauses in data source controls. This approach can be complicated, and in some cases the Where syntax does not let you take advantage of the full functionality of the underlying database. To make filtering easier, a new QueryExtender control has been added in ASP.NET 4. This control can be added to EntityDataSource or LinqDataSource controls in order to filter the data returned by these controls. Because the QueryExtender control relies on LINQ, but you do not to need to know how to write LINQ queries to use the query extender. The QueryExtender control supports a variety of filter options. The following lists QueryExtender filter options. Term Definition SearchExpression Searches a field or fields for string values and compares them to a specified string value. RangeExpression Searches a field or fields for values in a range specified by a pair of values. PropertyExpression Compares a specified value to a property value in a field. If the expression evaluates to true, the data that is being examined is returned. OrderByExpression Sorts data by a specified column and sort direction. CustomExpression Calls a function that defines custom filter in the page. For more information, see QueryExtenderQueryExtender Web Server Control Overview. Enhanced Support for Web Standards and Accessibility Earlier versions of ASP.NET controls sometimes render markup that does not conform to HTML, XHTML, or accessibility standards. ASP.NET 4 eliminates most of these exceptions. For details about how the HTML that is rendered by each control meets accessibility standards, see ASP.NET Controls and Accessibility. CSS for Controls that Can be Disabled In ASP.NET 3.5, when a control is disabled (see WebControl.Enabled), a disabled attribute is added to the rendered HTML element. For example, the following markup creates a Label control that is disabled: <asp:Label id="Label1" runat="server"   Text="Test" Enabled="false" /> In ASP.NET 3.5, the previous control settings generate the following HTML: <span id="Label1" disabled="disabled">Test</span> In HTML 4.01, the disabled attribute is not considered valid on span elements. It is valid only on input elements because it specifies that they cannot be accessed. On display-only elements such as span elements, browsers typically support rendering for a disabled appearance, but a Web page that relies on this non-standard behavior is not robust according to accessibility standards. For display-only elements, you should use CSS to indicate a disabled visual appearance. Therefore, by default ASP.NET 4 generates the following HTML for the control settings shown previously: <span id="Label1" class="aspNetDisabled">Test</span> You can change the value of the class attribute that is rendered by default when a control is disabled by setting the DisabledCssClass property. CSS for Validation Controls In ASP.NET 3.5, validation controls render a default color of red as an inline style. For example, the following markup creates a RequiredFieldValidator control: <asp:RequiredFieldValidator ID="RequiredFieldValidator1" runat="server"   ErrorMessage="Required Field" ControlToValidate="RadioButtonList1" /> ASP.NET 3.5 renders the following HTML for the validator control: <span id="RequiredFieldValidator1"   style="color:Red;visibility:hidden;">RequiredFieldValidator</span> By default, ASP.NET 4 does not render an inline style to set the color to red. An inline style is used only to hide or show the validator, as shown in the following example: <span id="RequiredFieldValidator1"   style"visibility:hidden;">RequiredFieldValidator</span> Therefore, ASP.NET 4 does not automatically show error messages in red. For information about how to use CSS to specify a visual style for a validation control, see Validating User Input in ASP.NET Web Pages. CSS for the Hidden Fields Div Element ASP.NET uses hidden fields to store state information such as view state and control state. These hidden fields are contained by a div element. In ASP.NET 3.5, this div element does not have a class attribute or an id attribute. Therefore, CSS rules that affect all div elements could unintentionally cause this div to be visible. To avoid this problem, ASP.NET 4 renders the div element for hidden fields with a CSS class that you can use to differentiate the hidden fields div from others. The new classvalue is shown in the following example: <div class="aspNetHidden"> CSS for the Table, Image, and ImageButton Controls By default, in ASP.NET 3.5, some controls set the border attribute of rendered HTML to zero (0). The following example shows HTML that is generated by the Table control in ASP.NET 3.5: <table id="Table2" border="0"> The Image control and the ImageButton control also do this. Because this is not necessary and provides visual formatting information that should be provided by using CSS, the attribute is not generated in ASP.NET 4. CSS for the UpdatePanel and UpdateProgress Controls In ASP.NET 3.5, the UpdatePanel and UpdateProgress controls do not support expando attributes. This makes it impossible to set a CSS class on the HTMLelements that they render. In ASP.NET 4 these controls have been changed to accept expando attributes, as shown in the following example: <asp:UpdatePanel runat="server" class="myStyle"> </asp:UpdatePanel> The following HTML is rendered for this markup: <div id="ctl00_MainContent_UpdatePanel1" class="expandoclass"> </div> Eliminating Unnecessary Outer Tables In ASP.NET 3.5, the HTML that is rendered for the following controls is wrapped in a table element whose purpose is to apply inline styles to the entire control: FormView Login PasswordRecovery ChangePassword If you use templates to customize the appearance of these controls, you can specify CSS styles in the markup that you provide in the templates. In that case, no extra outer table is required. In ASP.NET 4, you can prevent the table from being rendered by setting the new RenderOuterTable property to false. Layout Templates for Wizard Controls In ASP.NET 3.5, the Wizard and CreateUserWizard controls generate an HTML table element that is used for visual formatting. In ASP.NET 4 you can use a LayoutTemplate element to specify the layout. If you do this, the HTML table element is not generated. In the template, you create placeholder controls to indicate where items should be dynamically inserted into the control. (This is similar to how the template model for the ListView control works.) For more information, see the Wizard.LayoutTemplate property. New HTML Formatting Options for the CheckBoxList and RadioButtonList Controls ASP.NET 3.5 uses HTML table elements to format the output for the CheckBoxList and RadioButtonList controls. To provide an alternative that does not use tables for visual formatting, ASP.NET 4 adds two new options to the RepeatLayout enumeration: UnorderedList. This option causes the HTML output to be formatted by using ul and li elements instead of a table. OrderedList. This option causes the HTML output to be formatted by using ol and li elements instead of a table. For examples of HTML that is rendered for the new options, see the RepeatLayout enumeration. Header and Footer Elements for the Table Control In ASP.NET 3.5, the Table control can be configured to render thead and tfoot elements by setting the TableSection property of the TableHeaderRow class and the TableFooterRow class. In ASP.NET 4 these properties are set to the appropriate values by default. CSS and ARIA Support for the Menu Control In ASP.NET 3.5, the Menu control uses HTML table elements for visual formatting, and in some configurations it is not keyboard-accessible. ASP.NET 4 addresses these problems and improves accessibility in the following ways: The generated HTML is structured as an unordered list (ul and li elements). CSS is used for visual formatting. The menu behaves in accordance with ARIA standards for keyboard access. You can use arrow keys to navigate menu items. (For information about ARIA, see Accessibility in Visual Studio and ASP.NET.) ARIA role and property attributes are added to the generated HTML. (Attributes are added by using JavaScript instead of included in the HTML, to avoid generating HTML that would cause markup validation errors.) Styles for the Menu control are rendered in a style block at the top of the page, instead of inline with the rendered HTML elements. If you want to use a separate CSS file so that you can modify the menu styles, you can set the Menu control's new IncludeStyleBlock property to false, in which case the style block is not generated. Valid XHTML for the HtmlForm Control In ASP.NET 3.5, the HtmlForm control (which is created implicitly by the <form runat="server"> tag) renders an HTML form element that has both name and id attributes. The name attribute is deprecated in XHTML 1.1. Therefore, this control does not render the name attribute in ASP.NET 4. Maintaining Backward Compatibility in Control Rendering An existing ASP.NET Web site might have code in it that assumes that controls are rendering HTML the way they do in ASP.NET 3.5. To avoid causing backward compatibility problems when you upgrade the site to ASP.NET 4, you can have ASP.NET continue to generate HTML the way it does in ASP.NET 3.5 after you upgrade the site. To do so, you can set the controlRenderingCompatibilityVersion attribute of the pages element to "3.5" in the Web.config file of an ASP.NET 4 Web site, as shown in the following example: <system.web>   <pages controlRenderingCompatibilityVersion="3.5"/> </system.web> If this setting is omitted, the default value is the same as the version of ASP.NET that the Web site targets. (For information about multi-targeting in ASP.NET, see .NET Framework Multi-Targeting for ASP.NET Web Projects.) ASP.NET MVC ASP.NET MVC helps Web developers build compelling standards-based Web sites that are easy to maintain because it decreases the dependency among application layers by using the Model-View-Controller (MVC) pattern. MVC provides complete control over the page markup. It also improves testability by inherently supporting Test Driven Development (TDD). Web sites created using ASP.NET MVC have a modular architecture. This allows members of a team to work independently on the various modules and can be used to improve collaboration. For example, developers can work on the model and controller layers (data and logic), while the designer work on the view (presentation). For tutorials, walkthroughs, conceptual content, code samples, and a complete API reference, see ASP.NET MVC 2. Dynamic Data Dynamic Data was introduced in the .NET Framework 3.5 SP1 release in mid-2008. This feature provides many enhancements for creating data-driven applications, such as the following: A RAD experience for quickly building a data-driven Web site. Automatic validation that is based on constraints defined in the data model. The ability to easily change the markup that is generated for fields in the GridView and DetailsView controls by using field templates that are part of your Dynamic Data project. For ASP.NET 4, Dynamic Data has been enhanced to give developers even more power for quickly building data-driven Web sites. For more information, see ASP.NET Dynamic Data Content Map. Enabling Dynamic Data for Individual Data-Bound Controls in Existing Web Applications You can use Dynamic Data features in existing ASP.NET Web applications that do not use scaffolding by enabling Dynamic Data for individual data-bound controls. Dynamic Data provides the presentation and data layer support for rendering these controls. When you enable Dynamic Data for data-bound controls, you get the following benefits: Setting default values for data fields. Dynamic Data enables you to provide default values at run time for fields in a data control. Interacting with the database without creating and registering a data model. Automatically validating the data that is entered by the user without writing any code. For more information, see Walkthrough: Enabling Dynamic Data in ASP.NET Data-Bound Controls. New Field Templates for URLs and E-mail Addresses ASP.NET 4 introduces two new built-in field templates, EmailAddress.ascx and Url.ascx. These templates are used for fields that are marked as EmailAddress or Url using the DataTypeAttribute attribute. For EmailAddress objects, the field is displayed as a hyperlink that is created by using the mailto: protocol. When users click the link, it opens the user's e-mail client and creates a skeleton message. Objects typed as Url are displayed as ordinary hyperlinks. The following example shows how to mark fields. [DataType(DataType.EmailAddress)] public object HomeEmail { get; set; } [DataType(DataType.Url)] public object Website { get; set; } Creating Links with the DynamicHyperLink Control Dynamic Data uses the new routing feature that was added in the .NET Framework 3.5 SP1 to control the URLs that users see when they access the Web site. The new DynamicHyperLink control makes it easy to build links to pages in a Dynamic Data site. For information, see How to: Create Table Action Links in Dynamic Data Support for Inheritance in the Data Model Both the ADO.NET Entity Framework and LINQ to SQL support inheritance in their data models. An example of this might be a database that has an InsurancePolicy table. It might also contain CarPolicy and HousePolicy tables that have the same fields as InsurancePolicy and then add more fields. Dynamic Data has been modified to understand inherited objects in the data model and to support scaffolding for the inherited tables. For more information, see Walkthrough: Mapping Table-per-Hierarchy Inheritance in Dynamic Data. Support for Many-to-Many Relationships (Entity Framework Only) The Entity Framework has rich support for many-to-many relationships between tables, which is implemented by exposing the relationship as a collection on an Entity object. New field templates (ManyToMany.ascx and ManyToMany_Edit.ascx) have been added to provide support for displaying and editing data that is involved in many-to-many relationships. For more information, see Working with Many-to-Many Data Relationships in Dynamic Data. New Attributes to Control Display and Support Enumerations The DisplayAttribute has been added to give you additional control over how fields are displayed. The DisplayNameAttribute attribute in earlier versions of Dynamic Data enabled you to change the name that is used as a caption for a field. The new DisplayAttribute class lets you specify more options for displaying a field, such as the order in which a field is displayed and whether a field will be used as a filter. The attribute also provides independent control of the name that is used for the labels in a GridView control, the name that is used in a DetailsView control, the help text for the field, and the watermark used for the field (if the field accepts text input). The EnumDataTypeAttribute class has been added to let you map fields to enumerations. When you apply this attribute to a field, you specify an enumeration type. Dynamic Data uses the new Enumeration.ascx field template to create UI for displaying and editing enumeration values. The template maps the values from the database to the names in the enumeration. Enhanced Support for Filters Dynamic Data 1.0 had built-in filters for Boolean columns and foreign-key columns. The filters did not let you specify the order in which they were displayed. The new DisplayAttribute attribute addresses this by giving you control over whether a column appears as a filter and in what order it will be displayed. An additional enhancement is that filtering support has been rewritten to use the new QueryExtender feature of Web Forms. This lets you create filters without requiring knowledge of the data source control that the filters will be used with. Along with these extensions, filters have also been turned into template controls, which lets you add new ones. Finally, the DisplayAttribute class mentioned earlier allows the default filter to be overridden, in the same way that UIHint allows the default field template for a column to be overridden. For more information, see Walkthrough: Filtering Rows in Tables That Have a Parent-Child Relationship and QueryableFilterRepeater. ASP.NET Chart Control The ASP.NET chart server control enables you to create ASP.NET pages applications that have simple, intuitive charts for complex statistical or financial analysis. The chart control supports the following features: Data series, chart areas, axes, legends, labels, titles, and more. Data binding. Data manipulation, such as copying, splitting, merging, alignment, grouping, sorting, searching, and filtering. Statistical formulas and financial formulas. Advanced chart appearance, such as 3-D, anti-aliasing, lighting, and perspective. Events and customizations. Interactivity and Microsoft Ajax. Support for the Ajax Content Delivery Network (CDN), which provides an optimized way for you to add Microsoft Ajax Library and jQuery scripts to your Web applications. For more information, see Chart Web Server Control Overview. Visual Web Developer Enhancements The following sections provide information about enhancements and new features in Visual Studio 2010 and Visual Web Developer Express. The Web page designer in Visual Studio 2010 has been enhanced for better CSS compatibility, includes additional support for HTML and ASP.NET markup snippets, and features a redesigned version of IntelliSense for JScript. Improved CSS Compatibility The Visual Web Developer designer in Visual Studio 2010 has been updated to improve CSS 2.1 standards compliance. The designer better preserves HTML source code and is more robust than in previous versions of Visual Studio. HTML and JScript Snippets In the HTML editor, IntelliSense auto-completes tag names. The IntelliSense Snippets feature auto-completes whole tags and more. In Visual Studio 2010, IntelliSense snippets are supported for JScript, alongside C# and Visual Basic, which were supported in earlier versions of Visual Studio. Visual Studio 2010 includes over 200 snippets that help you auto-complete common ASP.NET and HTML tags, including required attributes (such as runat="server") and common attributes specific to a tag (such as ID, DataSourceID, ControlToValidate, and Text). You can download additional snippets, or you can write your own snippets that encapsulate the blocks of markup that you or your team use for common tasks. For more information on HTML snippets, see Walkthrough: Using HTML Snippets. JScript IntelliSense Enhancements In Visual 2010, JScript IntelliSense has been redesigned to provide an even richer editing experience. IntelliSense now recognizes objects that have been dynamically generated by methods such as registerNamespace and by similar techniques used by other JavaScript frameworks. Performance has been improved to analyze large libraries of script and to display IntelliSense with little or no processing delay. Compatibility has been significantly increased to support almost all third-party libraries and to support diverse coding styles. Documentation comments are now parsed as you type and are immediately leveraged by IntelliSense. Web Application Deployment with Visual Studio 2010 For Web application projects, Visual Studio now provides tools that work with the IIS Web Deployment Tool (Web Deploy) to automate many processes that had to be done manually in earlier versions of ASP.NET. For example, the following tasks can now be automated: Creating an IIS application on the destination computer and configuring IIS settings. Copying files to the destination computer. Changing Web.config settings that must be different in the destination environment. Propagating changes to data or data structures in SQL Server databases that are used by the Web application. For more information about Web application deployment, see ASP.NET Deployment Content Map. Enhancements to ASP.NET Multi-Targeting ASP.NET 4 adds new features to the multi-targeting feature to make it easier to work with projects that target earlier versions of the .NET Framework. Multi-targeting was introduced in ASP.NET 3.5 to enable you to use the latest version of Visual Studio without having to upgrade existing Web sites or Web services to the latest version of the .NET Framework. In Visual Studio 2008, when you work with a project targeted for an earlier version of the .NET Framework, most features of the development environment adapt to the targeted version. However, IntelliSense displays language features that are available in the current version, and property windows display properties available in the current version. In Visual Studio 2010, only language features and properties available in the targeted version of the .NET Framework are shown. For more information about multi-targeting, see the following topics: .NET Framework Multi-Targeting for ASP.NET Web Projects ASP.NET Side-by-Side Execution Overview How to: Host Web Applications That Use Different Versions of the .NET Framework on the Same Server How to: Deploy Web Site Projects Targeted for Earlier Versions of the .NET Framework

    Read the article

  • Cakephp, JQuery JCarousel Lite, Error

    - by ion
    I am using the following code to make an unordered list into a carousel with jcarousel lite and jquery: <?php echo $this->Html->script(array('jquery-1.4.2.min','jquery.easing.1.1','jcarousellite_1.0.1.pack','jquery.mousewheel.min'), array('inline' => false)); ?> <?php echo $this->Html->scriptStart(array('inline' => false)); ?> $(document).ready(function() { $(".mouseWheelButtons .jCarouselLite").jCarouselLite({ btnNext: ".mouseWheelButtons .next", btnPrev: ".mouseWheelButtons .prev", mouseWheel: true, circular: false, start: 0, visible: 5, easing: "easein" }); }); <?php echo $this->Html->scriptEnd(); ?> However I'm getting the following javascript error in firebug: a[0] is undefined Does anyone know what is causing the error. I am using the packed version of jcarousel lite. The thing is that the code worked in cakephp 1.2 but now i'm using 1.3 and I have updated the syntax using scriptstart, scriptEnd and Html-script.

    Read the article

  • Downloading file from server (asp.net) to IE8 Content-Disposition problem with file name

    - by David
    I am downloading a file from the server/database via aspx page. When using the content-disposition inline the document opens in correct application but the file name is the same as the web page. I want the document to open in say MS Word but with the correct file name. Here is the code that I am using Response.Buffer = true; Response.ClearContent(); Response.ClearHeaders(); Response.Clear(); Response.ContentType = MimeType(fileName); //function to return the correct MIME TYPE Response.AddHeader("Content-Disposition", @"inline;filename=" + fileName); Response.AddHeader("Content-Length", image.Length.ToString()); Response.BinaryWrite(image); Response.Flush(); Response.Close(); So again, I want the file to open in MS Word with the correct document file name so that the user can properly save/view. Ideas? thanks

    Read the article

  • jqmodal IE (7 or 8) flashes black before modal loaded

    - by brad
    This is killing me. In both IE7 and 8, using jqModal, the screen flashes black before the modal content is loaded. I've set up a test app to show you what's happening. I've taken jqModal EXACTLY from the site, no changes whatsoever, no external css that could be affecting my app. It works perfectly in every other browser (including IE6). http://jqmtest.heroku.com/ So, first two links are ajax calls, second is straight up inline HTML. (I originally thought it was the ajax that was affecting it, but that doesn't seem to be the case, I then thought it was slow loading ajax, hence to two differen ajax links) What's crazy is that the jqmodal site itself works perfectly in IE, no flashing of black, but I can't see what I'm doing wrong. Code is straight forward html: <body> <div id="ajaxModal" class="jqmWindow"></div> <div id="inlineModal" class="jqmWindow"> <div style="height:300px;position:relative;"> <p>Here's some inline content</p> <a href="#" onclick='$("#inlineModal").jqmHide();return false;' style="position:absolute;bottom:10px;right:10px">Close</a> </div> </div> <div style="width:600px;height:400px;margin:auto;background:#eee;"> <p><a href="/ajax/short" class="jqModal">Short loading modal</a></p> <br /> <p><a href="/ajax/long" class="jqModal">Longer loading modal</a></p> <br /> <p><a href="#" class="jqInline">inline modal</a></p> </div> </body> Javascript: <script type="text/javascript"> $(function(){ $("#ajaxModal").jqm({ajax:'@href', modal:true}); $("#inlineModal").jqm({modal:true, trigger:'.jqInline'}); }); </script> CSS is exactly the same as the one downloaded from jqModal's site so I'll omit it, but you can see it on my app Has anyone experienced this? I don't get how his works and mine doesn't.

    Read the article

  • Ul Li last element not aligning properly

    - by Chase
    I am having a problem where the last li element in a ul is pushing itself to the left further than the rest of all my pieces. Attached is a screen shot and my code. I have tried using the last-child element but it doesn't work in Safari or Chrome. #attending ul { display: inline; margin: 0 5px 0 0; padding-left: 0px; } #attending ul li { display: inline; list-style-image:none; padding: 5px; } #attending li:last-child { margin-right:-4px; } Suggestions? TIA, Chase http://desmond.yfrog.com/Himg338/scaled.php?tn=0&server=338&filename=screenshot20100526at808.jpg&xsize=640&ysize=640

    Read the article

  • mingw spitting countless warnings about ignoring "dll import" attribute

    - by hasen j
    I'm using mingw32-make to compile a qt project that uses opengl, it compiles correctly and everything, but it spits countless warning messages of the form: c:/qt3/include/qcolor.h:67: warning: inline function `int qGray(int, int, int)' declared as dllimport: attribute ignored For this particular instance, the function declaration is: Q_EXPORT inline int qGray( int r, int g, int b )// convert R,G,B to gray 0..255 { return (r*11+g*16+b*5)/32; } My question is, why is it spitting all these warning? how can I silence them without silencing other legitimate warnings (i.e. warnings that are related directly to my code and could be potential problems)? More importantly, why is mingw ignoring the dll import attribute in the first place?

    Read the article

  • Colorbox class don't work with ajax/dom object

    - by almal
    i usually use colorbox tool for open "popup windows" in my page and all are fine. In my new project the situation is little different because i use js/ajax/dom for create dinamically my objects in handleRequestStateChange() function. After import js,jquery and css for colorbox, in the head of my js page i write: $(document).ready(function () { $(window).scroll(function () { //oP1 = document.createTextNode(posizione_menu.offsetTop); //divIpt.appendChild(oMtx1); $(".divHcss").css("position", "fixed").css("top", "0px").css("z-index", "999"); }); //Examples of how to assign the Colorbox event to elements $(".group1").colorbox({rel:'group1'}); $(".group2").colorbox({rel:'group2', transition:"fade"}); $(".group3").colorbox({rel:'group3', transition:"none", width:"75%", height:"75%"}); $(".group4").colorbox({rel:'group4', slideshow:true}); $(".ajax").colorbox(); $(".youtube").colorbox({iframe:true, innerWidth:640, innerHeight:390}); $(".vimeo").colorbox({iframe:true, innerWidth:500, innerHeight:409}); $(".iframe").colorbox({iframe:true, width:"80%", height:"80%"}); $(".inline").colorbox({inline:true, width:"50%"}); $(".callbacks").colorbox({ onOpen:function(){ alert('onOpen: colorbox is about to open'); }, onLoad:function(){ alert('onLoad: colorbox has started to load the targeted content'); }, onComplete:function(){ alert('onComplete: colorbox has displayed the loaded content'); }, onCleanup:function(){ alert('onCleanup: colorbox has begun the close process'); }, onClosed:function(){ alert('onClosed: colorbox has completely closed'); } }); $('.non-retina').colorbox({rel:'group5', transition:'none'}) $('.retina').colorbox({rel:'group5', transition:'none', retinaImage:true, retinaUrl:true}); //Example of preserving a JavaScript event for inline calls. $("#click").click(function(){ $('#click').css({"background-color":"#f00", "color":"#fff", "cursor":"inherit"}).text("Open this window again and this message will still be here."); return false; }); }); and after in handleRequestStateChange() i create my a element and assign to a div: var a = createElement('a'); //a.style.display = "block"; a.setAttribute('class','iframe'); a.setAttribute('href',"php/whois.php?P1="+oStxt.value); var divIp3 = createElement('div', 'divIp3', 'divIp3css'); var divIp31 = createElement('div', 'divIp31', 'divIp31css'); divIp3.appendChild(divIp31); divIp3.appendChild(a); a.appendChild(divIp31); The divIp31 become linkable but the href open page in a normal browser tab and not using attribute class for colorbox. Someone have an idea about? Thanks in advance AM

    Read the article

  • Turn off enclosing <p> tags in CKEditor 3.0

    - by Kosi2801
    Is there a possibility to turn off the automatic enclosing of all written content within <p></p> in CKEditor 3.x? I tried CKEDITOR.config.enterMode = CKEDITOR.ENTER_BR; but this just changes the inline linebreaks to <br /> while leaving the enclosing paragraph. Currently writing "Test" produces this output <p> Test</p> but I want it to be simply Test Is there a configuration property for this or would another inline editor to be better suited for this?

    Read the article

  • how to open a .pdf file in a panel or iframe using asp.net c#

    - by rahul
    I am trying to open a .pdf file on a button click. I want to open a .pdf file into a panel or some iframe. With the following code i can only open .pdf file in a separate window or in a save as mode. string filepath = Server.MapPath("News.pdf"); FileInfo file = new FileInfo(filepath); if (file.Exists) { Response.ClearContent(); Response.AddHeader("Content-Disposition", "inline; filename=" + file.Name); Response.AddHeader("Content-Length", file.Length.ToString()); Response.ContentType = ReturnExtension(file.Extension.ToLower()); Response.TransmitFile(file.FullName); Response.End(); } how to assign a iframe to the below line Response.AddHeader("Content-Disposition", "inline; filename=" + file.Name);

    Read the article

  • Can't update textbox in TinyMCE

    - by Michael Tot Korsgaard
    I'm using TinyMCE, the text area is replaced with a TextBox, but when I try to update the database with the new text from my textbox, it wont update. Can anyone help me? My code looks like this <%@ Page Title="" Language="C#" MasterPageFile="~/Main.Master" AutoEventWireup="true" CodeBehind="default.aspx.cs" Inherits="Test_TinyMCE._default" ValidateRequest="false" %> <asp:Content ID="Content1" ContentPlaceHolderID="head" runat="server"> <script src="JavaScript/tiny_mce/tiny_mce.js" type="text/javascript"></script> <script type="text/javascript"> tinyMCE.init({ // General options mode: "textareas", theme: "advanced", plugins: "pagebreak,style,layer,table,save,advhr,advimage,advlink,emotions,iespell,insertdatetime,pre view,media,searchreplace,print,contextmenu,paste,directionality,fullscreen,noneditable,visualchars,no nbreaking,xhtmlxtras,template,wordcount,advlist,autosave", // Theme options theme_advanced_buttons1: "save,newdocument,|,bold,italic,underline,strikethrough,|,justifyleft,justifycenter,justifyright,justifyfull,styleselect,formatselect,fontselect,fontsizeselect", theme_advanced_buttons2: "cut,copy,paste,pastetext,pasteword,|,search,replace,|,bullist,numlist,|,outdent,indent,blockquote,|,undo,redo,|,link,unlink,anchor,image,cleanup,help,code,|,insertdate,inserttime,preview,|,forecolor,backcolor", theme_advanced_buttons3: "tablecontrols,|,hr,removeformat,visualaid,|,sub,sup,|,charmap,emotions,iespell,media,advhr,|,print,|,ltr,rtl,|,fullscreen", theme_advanced_buttons4: "insertlayer,moveforward,movebackward,absolute,|,styleprops,|,cite,abbr,acronym,del,ins,attribs,|,visualchars,nonbreaking,template,pagebreak,restoredraft", theme_advanced_toolbar_location: "top", theme_advanced_toolbar_align: "left", theme_advanced_statusbar_location: "bottom", theme_advanced_resizing: true, // Example content CSS (should be your site CSS) // using false to ensure that the default browser settings are used for best Accessibility // ACCESSIBILITY SETTINGS content_css: false, // Use browser preferred colors for dialogs. browser_preferred_colors: true, detect_highcontrast: true, // Drop lists for link/image/media/template dialogs template_external_list_url: "lists/template_list.js", external_link_list_url: "lists/link_list.js", external_image_list_url: "lists/image_list.js", media_external_list_url: "lists/media_list.js", // Style formats style_formats: [ { title: 'Bold text', inline: 'b' }, { title: 'Red text', inline: 'span', styles: { color: '#ff0000'} }, { title: 'Red header', block: 'h1', styles: { color: '#ff0000'} }, { title: 'Example 1', inline: 'span', classes: 'example1' }, { title: 'Example 2', inline: 'span', classes: 'example2' }, { title: 'Table styles' }, { title: 'Table row 1', selector: 'tr', classes: 'tablerow1' } ], // Replace values for the template plugin template_replace_values: { username: "Some User", staffid: "991234" } }); </script> </asp:Content> <asp:Content ID="Content2" ContentPlaceHolderID="ContentPlaceHolder1" runat="server"> <div> <asp:TextBox ID="TextBox1" runat="server" TextMode="MultiLine"></asp:TextBox> <br /> <asp:LinkButton ID="LinkButton1" runat="server" onclick="LinkButton1_Click">Update</asp:LinkButton> </div> </asp:Content> My codebhind looks like this using System; using System.Collections.Generic; using System.Linq; using System.Web; using System.Web.UI; using System.Web.UI.WebControls; namespace Test_TinyMCE { public partial class _default : System.Web.UI.Page { protected void Page_Load(object sender, EventArgs e) { TextBox1.Text = Database.GetFirst().Text; } protected void LinkButton1_Click(object sender, EventArgs e) { Database.Update(Database.GetFirst().ID, TextBox1.Text); TextBox1.Text = Database.GetFirst().Text; } } } And finally the "Database" class im using looks like this using System; using System.Collections.Generic; using System.Linq; using System.Web; using System.Configuration; using System.Data.SqlClient; namespace Test_TinyMCE { public class Database { public int ID { get; set; } public string Text { get; set; } public static void Update(int ID, string Text) { SqlConnection connection = new SqlConnection(ConfigurationManager.AppSettings["DatabaseConnection"]); connection.Open(); try { SqlCommand command = new SqlCommand("Update Text set Text=@text where ID=@id"); command.Connection = connection; command.Parameters.Add(new SqlParameter("id", ID)); command.Parameters.Add(new SqlParameter("text", Text)); command.ExecuteNonQuery(); } finally { connection.Close(); } } public static Database GetFirst() { SqlConnection connection = new SqlConnection(ConfigurationManager.AppSettings["DatabaseConnection"]); connection.Open(); try { SqlCommand command = new SqlCommand("Select Top 1 ID, Text from Text order by ID asc"); command.Connection = connection; SqlDataReader reader = command.ExecuteReader(); if (reader.Read()) { Database item = new Database(); item.ID = reader.GetInt32(0); item.Text = reader.GetString(1); return item; } else { return null; } } finally { connection.Close(); } } } } I really hope that someone out there can help me

    Read the article

  • JQGrid and JQuery Autocomplete

    - by Neff
    When implementing JQGrid 4.3.0, Jquery 1.6.2, and JQuery UI 1.8.16 Ive come across an issue with the Inline edit. When the inline edit is activated, some of the elements get assigned an auto complete. When the inline edit is canceld or saved, the auto complete does not always go away (selecting text by double clicking it then hitting delete, then hitting escape to exit row edit). Leaving the auto complete controls in edit mode when the row is no longer considered in edit mode. Perhaps you can tell me if there is a problem with the initialization or if I you are aware of an event post-"afterrestorefunc" that the fields can be returned to their "original" state. Original state being displayed as data in the JQGrid row. I've tried removing the DOM after row close, .remove() and .empty(): ... "afterrestorefunc": function(){ $('.ui-autocomplete-input').remove(); } ... but that causes other issues, such as the jqgrid is not able to find the cell when serializing the row for data or edit, and requires a refresh of the page, not just jqgrid, to be able to once again see the data from that row. Auto complete functionality for the element is created on the double click of the row: function CreateCustomSearchElement(value, options, selectiontype) { ... var el; el = document.createElement("input"); ... $(el).autocomplete({ source: function (request, response) { $.ajax({ url: '<%=ResolveUrl("~/Services/AutoCompleteService.asmx/GetAutoCompleteResponse") %>', data: "{ 'prefixText': '" + request.term + "', 'contextKey': '" + options.name + "'}", dataType: "json", type: "POST", contentType: "application/json; charset=utf-8", success: function (data) { response($.map(data.d, function (item) { return { label: Trim(item), value: Trim(item), searchVal: Trim(item) } })) } }); }, select: function (e, item) { //Select is on the event of selection where the value and label have already been determined. }, minLength: 1, change: function (event, ui) { //if the active element was not the search button //... } }).keyup(function (e) { if (e.keyCode == 8 || e.keyCode == 46) { //If the user hits backspace or delete, check the value of the textbox before setting the searchValue //... } }).keydown(function (e) { //if keycode is enter key and there is a value, you need to validate the data through select or change(onblur) if (e.keyCode == '13' && ($(el).val())) { return false; } if (e.keyCode == '220') { return false } }); } Other Sources: http://www.trirand.com/jqgridwiki/doku.php?id=wiki:inline_editing http://api.jqueryui.com/autocomplete/ Update: I tried only creating the autocomplete when the element was focused, and removing it when onblur. That did not resolve the issue either. It seems to just need the autocomplete dropdown to be triggered.

    Read the article

  • pure-specifier on function-definition

    - by bebul
    While compiling on GCC I get the error: pure-specifier on function-definition, but not when I compile the same code using VS2005. class Dummy { //error: pure-specifier on function-definition, VS2005 compiles virtual void Process() = 0 {}; }; But when the definition of this pure virtual function is not inline, it works: class Dummy { virtual void Process() = 0; }; void Dummy::Process() {} //compiles on both GCC and VS2005 What does the error means? Why cannot I do it inline? Is it legal to evade the compile issue as shown in the second code sample?

    Read the article

  • C++ template partial specialization error

    - by JP19
    Hi, The following code is giving me a compilation error: class Q64 is not a valid type for a template constant parameter template<int GRIDD, class T> INLINE T grid_residue(T amount) { T rem = amount%(GRIDD); if (rem > GRIDD/2) rem -= GRIDD; return rem; } template<int GRIDD, Q64> INLINE Q64 grid_residue(Q64 amount) { return Q64(grid_residue<GRIDD, int64_t>(to_int(amount))); } Whats wrong? I am trying to specialize grid_residue for class Q64. thanks

    Read the article

  • JQuery .html() method and external scripts

    - by Marco
    Hi, i'm loading, using the JQuery ajax() method, an external page with both html and javascript code: <script type="text/javascript" src="myfile.js"></script> <p>This is some HTML</p> <script type="text/javascript"> alert("This is inline JS"); </script> and setting the results into a div element, using the html() method. While the html() method properly evaluates the inline JS code, it doesn't download and evaluate the external JS file "myfile.js". Any tip for this issue?

    Read the article

  • Wordpress css and ie6

    - by marc-andre menard
    my website : http://www.equipe94.com have a two column layout and in ie6 the right column is flushed at the button... it look like and inline problem, but even WITH the inline widget.. it's still at the bottom.. any idea to fix a wordpress template to play well with ie6 ? thanks in advance n.b. As mentioned in the comment... my page don't validate... after fixing the multiples problems now I validate in XHTML 1.0 Strict... but the problem is still there !

    Read the article

  • Does changing the order of class private data members breaks ABI

    - by Dmitry Yudakov
    I have a class with number of private data members (some of them static), accessed by virtual and non-virtual member functions. There's no inline functions and no friend classes. class A { int number; string str; static const int static_const_number; public: // got virtual and non-virtual functions, working with these memebers virtual void func1(); void func2(); // no inline functions or friends }; Does changing the order of private data members breaks ABI in this case? class A { string str; static const int static_const_number; int number; // <-- integer member moved here ... };

    Read the article

  • Migrating from Maven to SBT

    - by Vasil Remeniuk
    Hi people, As you know, SBT is compatible with Maven in some way -- SBT recognizes simple Maven POMs and can use dependencies and repositories specified in them. However, SBT wiki says that, if inline dependency is specified in SBT project definition, POM will be ignored (so using both in this case is impossible): Maven and Ivy configurations (pom.xml and ivy.xml) are ignored when inline dependency declarations are present. Does anyone know, if any kind of converter from Maven POM to SBT project definition exists (translating POM's XML into project definition Scala code)? I'm considering writing such script (that will help to migrate my old Scala/Maven projects to SBT), but want to know first, if this functionality already exists. Thanks in advance.

    Read the article

  • How to get `gcc` to generate `bts` instruction for x86-64 from standard C?

    - by Norman Ramsey
    Inspired by a recent question, I'd like to know if anyone knows how to get gcc to generate the x86-64 bts instruction (bit test and set) on the Linux x86-64 platforms, without resorting to inline assembly or to nonstandard compiler intrinsics. Related questions: Why doesn't gcc do this for a simple |= operation were the right-hand side has exactly 1 bit set? How to get bts using compiler intrinsics or the asm directive Portability is more important to me than bts, so I won't use and asm directive, and if there's another solution, I prefer not to use compiler instrinsics. EDIT: The C source language does not support atomic operations, so I'm not particularly interested in getting atomic test-and-set (even though that's the original reason for test-and-set to exist in the first place). If I want something atomic I know I have no chance of doing it with standard C source: it has to be an intrinsic, a library function, or inline assembly. (I have implemented atomic operations in compilers that support multiple threads.)

    Read the article

  • HTML list wrapping problem

    - by Daniel
    I have a HTML list with this style: font-weight: bold; padding: 0px; margin: 0px; list-style-type: none; display: block; width:700px; font-size: 14px; white-space: pre-wrap; and the cells have this style: display: inline; and I have spacer cells between each cell with this style: padding-right: 20px; display: inline; My problem is that when the list is too long for its 700 pixels, it wraps. I want this, but I dont want the objects to be on two separate lines. I have tried the CSS white-space property, but nothing seems to work. Any ideas?

    Read the article

  • loading an asp after starting a session

    - by Noam Smadja
    the jQuery $("#loginform").submit(function(){ $.ajax({ type: "POST", url: "loginrespajax.asp", data: $("#loginform").serialize(), success: function(){ $("#loginform").hide("slow"); $("#loginform").load("userheader.asp"); $("#loginform").show("slow"); } }); }); thats userheader.asp <div class="userlinks"> <%if (session("userlevel")) then%> <% select case session("userlevel") case 1 %> <a href="managenews.asp"><%langstring("header_news")%></a> | <a href="managebooks.asp"><%langstring("header_books")%></a> | <a href="manageusers.asp"><%langstring("manage_users")%></a> | <a href="manageorders.asp"><%langstring("manage_orders")%></a> | <a href="managelanguage.asp"><%langstring("manage_language")%></a> | <a href="youthregistration.asp"><%langstring("youthreg_header")%></a> | <a href="manageregistrants.asp"><%langstring("youthlist_header")%></a> | <% case 2 %> <a href="managenews.asp"><%langstring("header_news")%></a> | <a href="managebooks.asp"><%langstring("header_books")%></a> | <a href="youthregistration.asp"><%langstring("youthreg_header")%></a> | <a href="manageregistrants.asp"><%langstring("youthlist_header")%></a> | <% case 3 %> <a href="youthregistration.asp"><%langstring("youthreg_header")%></a> | <a href="manageregistrants.asp"><%langstring("youthlist_header")%></a> | <% End select %> <a href="editprofile.asp"><%langstring("editprofile_header")%></a> | <a href="changepassword.asp"><%langstring("changepassword_header")%></a> | <a href="logout.asp"><%langstring("logout_header")%></a> <%else%> <form action="loginrespajax.asp" method="POST" name="loginform" id="loginform" class="loginform" onSubmit="return false;"> <input type="text" name="username" value="username" class="input inline" onFocus="clearText(this);"> <input type="password" name="password" value="password" class="input inline" onFocus="clearText(this);"> <input type="submit" value="Log In" class="submit inline"> </form> <%End if%> </div> i am submiting the login form using AJAX and the jQuery partially works. it does hide and show again. but it prints the ELSE part of in userheader.asp. the session does start, for sure :)

    Read the article

  • to change the style of div

    - by ramyatk06
    hi guys, I have 2 buttons and 2 divs div1 and div2.On click button1 div1 is made visible and div2 invisible,On clicking button2 div2 is made visible and div1 is invisible. For that i used javascript. function showdiv2() { document.getElementById("div2").style.visibility="visible"; document.getElementById("div2").style.display="inline"; document.getElementById("div1").style.visibility="hidden"; document.getElementById("div1").style.display = "none"; document.getElementById("lbl_msg").innerHTML = "" } function showdiv1() { document.getElementById("div1").style.visibility="visible"; document.getElementById("div1").style.display="inline"; document.getElementById("div2").style.visibility="hidden"; document.getElementById("div2").style.display = "none"; document.getElementById("lbl_msg").innerHTML = "" } In div2 i have a gridview in which i have a linkbutton named lnkDelete.In its click control is going to div1.In click of lnkDelete,i want to make div1 invisible,but on clicking button1 div1 should be visible.Can anybody help to make div1 invisible in clickevent of lnkDelete in codebehind?

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • Bullets WILL NOT dissapear in firefox

    - by DunlopBurns
    Hoping you can help me with a problem. I cannot get rid of Bullets in Firefox, i don't want any anywhere, hence my list-style-type: none!important being everywhere. It only appears in Firefox as far as i can tell. the HTML.... <!DOCTYPE html PUBLIC "-//W3C//DTD XHTML 1.0 Transitional//EN" "http://www.w3.org/TR/xhtml1/DTD/xhtml1-transitional.dtd"> <html xmlns="http://www.w3.org/1999/xhtml" lang="en" xml:lang="en"> <head> <title>littleprints.nl</title> <meta name="description" content="----" /> <meta name="keywords" content="----" /> <meta http-equiv="Content-Type" content="text/html; charset=iso-8859-1" /> <script type="text/javascript" src="http://ajax.googleapis.com/ajax/libs/jquery/1.4/jquery.min.js"></script> <script type="text/javascript" src="js/slimbox2.js"></script> <link rel="stylesheet" href="css/slimbox2.css" type="text/css" media="screen" /> <link rel="stylesheet" href="layout.css"/> <link rel="stylesheet" href="style.css"/> </head> <body> <div id="container"> <div id="inline1"> <div id="mainpic"> <img src="myimages/circle.jpg" width="100%" alt="Circle bracelet"/> </div> <div id="intro"> <p>Hi and welcome to little prints NL. we make this and that all by hand with 100% silver. my name is Donna Burns and i work by commision, ive been studying for 4 years and am currently learning to become a goldsmith.</p> </div> </div> <div id="inline2"> <p>Click for more...</p> <div id="images"> <a href="myimages/photos/dogtag.jpg" rel="lightbox-gal" title="Beautiful, isn't it?" ><img src="myimages/work/chunky.gif" alt="chunky"/></a> <a href="myimages/photos/hearts.jpg" rel="lightbox-gal" title="Beautiful, isn't it?" ><img src="myimages/work/hearts.gif" alt="hearts"/></a> <a href="myimages/photos/close.jpg" rel="lightbox-gal" title="Beautiful, isn't it?" ><img src="myimages/work/close.gif" alt="close"/></a> <a href="myimages/photos/pearl.jpg" rel="lightbox-gal" title="Beautiful, isn't it?" >&nbsp;</a> <a href="myimages/photos/flower.jpg" rel="lightbox-gal" title="Beautiful, isn't it?" >&nbsp;</a> <a href="myimages/photos/frontcircle.jpg" rel="lightbox-gal" title="Beautiful, isn't it?" >&nbsp;</a> <a href="myimages/photos/dogtag.jpg" rel="lightbox-gal" title="Beautiful, isn't it?" >&nbsp;</a> </div> </div> </div><!--end container--> <div id="footer"> <div id="footalign"> <div id="social"> <ul> <li> <a href="http://www.facebook.com/littleprints" title="Little Prints"> <img src="myimages/facebook.png" width="50px" height="50px" alt="FB"/> </a> </li> <li> <a href="contact.html" title="contact"> <img src="myimages/at.gif" alt="@"/> </a> </li> </ul> </div> <div id="contact"> <p><br/>To enquire about a charm either phone:<br/> 0787463289<br/> or use one of the methods to the side.</p> </div> </div> </div> </body> </html> the CSS... * {margin: 0; padding: 0; border: 0;} html, body { background-color: #000000;image; text-align: center; font: 16px/1.8 Verdana, Arial, Helvetica, sans-serif; list-style-type: none!important; text-decoration: none;} #container { position: relative; width: 900px; top: 0; min-height: 100%; margin-left: auto; margin-right: auto; padding-top: 20px; background-image: URL(myimages/back2.gif); margin-bottom: 180px; } #footer { background-color: #555555; position: relative; clear: both; bottom: 0; width: 900px; height: auto; margin-left: auto; margin-right: auto; margin-bottom: 20px; padding-bottom: 22px; margin-top: -180px; } #inline1{ display: inline-block; margin-top: 250px; margin-bottom: 20px; } #inline2 { display: inline-block; margin-top: 30px; margin-bottom: 50px; } #mainpic { float: left; width: 68%; margin-left: 20px; } #intro { float: right; width: 20%; margin-left: auto; margin-right: 50px; margin-top: 20px; } #images { margin-bottom: 20px; margin-left: auto; margin-right: auto; } #footalign { display: inline; width:900px; list-style-type: none; } #contact { text-align: center; background-color:#555555; float: middle; list-style-type: none; } #social{ background-color:#555555; float: right; list-style: none; padding:0; padding-right: 5px; text-align:center; list-style-type: none!important; } #social img{ border: none; list-style-type: none!important; margin: 3px; } #social ul{ border: none; list-style-type: none!important; } #social a{ display:inline-block; -webkit-transition:all .5s ease-out; -moz-transition:all .5s ease-out; -ms-transition:all .5s ease-out; -o-transition:all .5s ease-out; transition:all .5s ease-out; list-style-type: none!important; } #social a:hover{ display:inline-block; -webkit-transform:translate(-10px,0px); -moz-transform:translate(0px,-10px); -ms-transform:translate(-10px,0px); -o-transform:translate(-10px,0px); transform:translate(-10px,0px); list-style-type: none!important; } #form { margin-top: 250px; margin-bottom: 50px; } .nav1 {font-family: sans-serif;font-size: 22px;text-shadow: 2px 2px 5px #000000;} a:link {text-decoration:none; color:#000000; padding:3px;} a:visited {text-decoration:none; color:#000000;} a:active {text-decoration:none; color:#555555;} a:hover {text-decoration:none; color:#555555;} .nav2 {font-family: sans-serif;font-size: 22px;text-shadow: 2px 2px 5px #ffffff;} a:link {text-decoration:none; color:#ffffff; padding:3px;} a:visited {text-decoration:none; color:#ffffff;} a:active {text-decoration:none; color:#555555;} a:hover {text-decoration:none; color:#555555;} .p1 { color: #ffffff; } div#images img { max-width: 500px; height: auto; }

    Read the article

< Previous Page | 17 18 19 20 21 22 23 24 25 26 27 28  | Next Page >