Search Results

Search found 1014 results on 41 pages for 'trim'.

Page 22/41 | < Previous Page | 18 19 20 21 22 23 24 25 26 27 28 29  | Next Page >

  • How to add ACTIVE DIRECTORY user to Sharepoint group

    - by standley-nguyen
    Hi all. I got an exception when executing this snippet code SPSecurity.RunWithElevatedPrivileges(delegate() { using (SPSite site = new SPSite(siteUrl.Trim())) { using (SPWeb web = site.OpenWeb()) { try { web.AllowUnsafeUpdates = true; SPUser spUser = web.AllUsers[userName]; if (spUser != null) { SPGroup spGroup = web.Groups[groupName]; if (spGroup != null) spGroup.AddUser(spUser); } } catch (Exception ex) { this.TraceData(LogLevel.Error, "Error at function Named [AddUserToSPGroupWidget.AddUserToGroup] . With Error Message: " + ex.ToString()); } finally { web.AllowUnsafeUpdates = false; } } } }); PLease guide me. Thanks in advance.

    Read the article

  • Problem with ajax form on Codeigniter

    - by Code Burn
    Everytime I test the email is send correctly. (I have tested in PC: IE6, IE7, IE8, Safari, Firefox, Chrome. MAC: Safari, Firefox, Chrome.) Nome: Jon Doe Empresa: Star Cargo: Developer Email: [email protected] Telefone: 090909222988 Assunto: Subject here.. But I keep recieving emails like this from costumers: Nome: Empresa: Cargo: Email: Telefone: Assunto: CONTACT_FORM.PHP <form name="frm" id="frm"> <div class="campoFormulario nomeDeCampo texto textocinzaescuro" >Nome<font style="color:#EE3063;">*</font></div> <div class="campoFormulario inputDeCampo" ><input class="texto textocinzaescuro" size="31" name="Cnome" id="Cnome" value=""/></div> <div class="campoFormulario nomeDeCampo texto textocinzaescuro" >Empresa<font style="color:#EE3063;">*</font></div> <div class="campoFormulario inputDeCampo" ><input class="texto textocinzaescuro" size="31" name="CEmpresa" id="CEmpresa" value=""/></div> <div class="campoFormulario nomeDeCampo texto textocinzaescuro" >Cargo</div> <div class="campoFormulario inputDeCampo" ><input class="texto textocinzaescuro" size="31" name="CCargo" id="CCargo" value=""/></div> <div class="campoFormulario nomeDeCampo texto textocinzaescuro" >Email<font style="color:#EE3063;">*</font></div> <div class="campoFormulario inputDeCampo" ><input class="texto textocinzaescuro" size="31" name="CEmail" id="CEmail" value=""/></div> <div class="campoFormulario nomeDeCampo texto textocinzaescuro" >Telefone</div> <div class="campoFormulario inputDeCampo" ><input class="texto textocinzaescuro" size="31" name="CTelefone" id="CTelefone" value=""/></div> <div class="campoFormulario nomeDeCampo texto textocinzaescuro" >Assunto<font style="color:#EE3063;">*</font></div> <div class="campoFormulario inputDeCampo" ><textarea class="texto textocinzaescuro" name="CAssunto" id="CAssunto" rows="2" cols="28"></textarea></div> <div class="campoFormulario nomeDeCampo texto textocinzaescuro" >&nbsp;</div> <div class="campoFormulario inputDeCampo" style="text-align:right;" ><input id="Cbutton" class="texto textocinzaescuro" type="submit" name="submit" value="Enviar" /></div> </form> <script type="text/javascript"> $(function() { $("#Cbutton").click(function() { if(validarForm()){ var Cnome = $("input#Cnome").val(); var CEmpresa = $("input#CEmpresa").val(); var CEmail = $("input#CEmail").val(); var CCargo = $("input#CCargo").val(); var CTelefone = $("input#CTelefone").val(); var CAssunto = $("textarea#CAssunto").val(); var dataString = 'nome='+ Cnome + '&Empresa=' + CEmpresa + '&Email=' + CEmail + '&Cargo=' + CCargo + '&Telefone=' + CTelefone + '&Assunto=' + CAssunto; //alert (dataString);return false; $.ajax({ type: "POST", url: "http://www.myserver.com/index.php/pt/envia", data: dataString, success: function() { $('#frm').remove(); $('#blocoform').append("<br />Obrigado. <img id='checkmark' src='http://www.myserver.com/public/images/estrutura/ok.gif' /><br />Será contactado brevemente.<br /><br /><br /><br /><br /><br />") .hide() .fadeIn(1500); } }); } return false; }); }); function validarForm(){ var error = 0; if(!validateNome(document.getElementById("Cnome"))){ error = 1 ;} if(!validateNome(document.getElementById("CEmpresa"))){ error = 1 ;} if(!validateEmail(document.getElementById("CEmail"))){ error = 1 ;} if(!validateNome(document.getElementById("CAssunto"))){ error = 1 ;} if(error == 0){ //frm.submit(); return true; }else{ alert('Preencha os campos correctamente.'); return false; } } function validateNome(fld){ if( fld.value.length == 0 ){ fld.style.backgroundColor = '#FFFFCC'; //alert('Descrição é um campo obrigatório.'); return false; }else { fld.style.background = 'White'; return true; } } function trim(s) { return s.replace(/^\s+|\s+$/, ''); } function validateEmail(fld) { var tfld = trim(fld.value); var emailFilter = /^[^@]+@[^@.]+\.[^@]*\w\w$/ ; var illegalChars= /[\(\)\<\>\,\;\:\\\"\[\]]/ ; if (fld.value == "") { fld.style.background = '#FFFFCC'; //alert('Email é um campo obrigatório.'); return false; } else if (!emailFilter.test(tfld)) { //alert('Email inválido.'); fld.style.background = '#FFFFCC'; return false; } else if (fld.value.match(illegalChars)) { fld.style.background = '#FFFFCC'; //alert('Email inválido.'); return false; } else { fld.style.background = 'White'; return true; } } </script> FUNCTION ENVIA (email sender): function envia() { $this->load->helper(array('form', 'url')); $nome = $_POST['nome']; $empresa = $_POST['Empresa']; $cargo = $_POST['Cargo']; $email = $_POST['Email']; $telefone = $_POST['Telefone']; $assunto = $_POST['Assunto']; $mensagem = " Nome:".$nome." Empresa:".$empresa." Cargo:".$cargo." Email:".$email." Telefone:".$telefone." Assunto:".$assunto.""; $headers = 'From: [email protected]' . "\r\n" . 'Reply-To: no-reply' . "\r\n" . 'X-Mailer: PHP/' . phpversion(); mail('[email protected]', $mensagem, $headers); }

    Read the article

  • How to parse a string into a nullable int in C# (.NET 3.5)

    - by Glenn Slaven
    I'm wanting to parse a string into a nullable int in C#. ie. I want to get back either the int value of the string or null if it can't be parsed. I was kind of hoping that this would work int? val = stringVal as int?; But that won't work, so the way I'm doing it now is I've written this extension method public static int? ParseNullableInt(this string value) { if (value == null || value.Trim() == string.Empty) { return null; } else { try { return int.Parse(value); } catch { return null; } } } Is there a better way of doing this? EDIT: Thanks for the TryParse suggestions, I did know about that, but it worked out about the same. I'm more interested in knowing if there is a built-in framework method that will parse directly into a nullable int?

    Read the article

  • IIS7 - Specifying content-length header in ASP causes "connection reset" error

    - by MisterZimbu
    I'm migrating a series of websites from an existing IIS5 server to a brand new IIS7 web server. One of the pages pulls a data file from a blob in the database and serves it to the end user: Response.ContentType = rs("contentType") Response.AddHeader "Content-Disposition", "attachment;filename=" & Trim(rs("docName"))&rs("suffix")' let the browser know the file name Response.AddHeader "Content-Length", cstr(rs("docsize"))' let the browser know the file size Testing this in the new IIS7 install, I get a "Connection Reset" error in both Internet Explorer and Firefox. The document is served up correctly if the Content-Length header is removed (but then the user won't get a useful progress bar). Any ideas on how to correct this; whether it be a server configuration option or via code? Thanks.

    Read the article

  • Can someone explain me the parameter RETURN_VALUE ?

    - by Ronnie Chester Lynwood
    hello. I want to know what does RETURN_VALUE means! I'm stucked at this thing. how to use RETURN_VALUE on MSSQL SP ? thanks.. ASP: Set cmdDB = Server.CreateObject("ADODB.Command") With cmdDB .ActiveConnection = ADOConM .CommandText = "usp_jaljava_member_select" .CommandType = adCmdStoredProc .Parameters.Append .CreateParameter("RETURN_VALUE", adInteger, adParamReturnValue, 0) .Parameters.Append .CreateParameter("@TLoginName", adVarChar, adParamInput, 15,lcase(TLoginName)) .Parameters.Append .CreateParameter("@TPassword", adVarChar, adParamInput, 20,TPassword) .Parameters.Append .CreateParameter("@retval", adVarChar, adParamOutput, 50) ' .Parameters.Append .CreateParameter("@TPinCode", adVarChar, adParamInput, 15,TPinCode) .Execute,,adExecuteNoRecords RetVal = .Parameters("@retval") Ret = Trim(.Parameters("RETURN_VALUE")) 'Set .ActiveConnection = Nothing End With Set cmdDB = Nothing UTid = RetVal MSSQL SP: CREATE PROCEDURE usp_jaljava_member_select @TLoginName varchar(15), @TPassword varchar(20), @retval varchar(50) OUTPUT --@TPinCode varchar(15) AS

    Read the article

  • string extension method - Not available through WebMethod

    - by Peter Bridger
    I've written a simple extension method for a web project, it sits in a class file called StringExtensions.cs which contains the following code: using System; using System.Collections.Generic; using System.Linq; using System.Web; /// <summary> /// Useful extensions for string /// </summary> static class StringExtensions { /// <summary> /// Is string empty /// </summary> /// <param name="value"></param> /// <returns></returns> public static bool IsEmpty(this string value) { return value.Trim().Length == 0; } } I can access this extension method from all the classes I have within the App_Code directory. However I have a web page called JSON.aspx that contains a series of [WebMethods] - within these I cannot see the extension method - I must be missing something very obvious!

    Read the article

  • make changes to html before append with jquery

    - by Pradyut Bhattacharya
    I m calling a page using ajax and making changes to it using jquery but the changes are not reflected after appending(append) it to a div as the changes are done to the html but the html var remains the same. how do i make the changes to the html var and then append to the DOM if i use the code directly to the DOM then there will be changes in the previous elements in the DOM the code $.ajax({ type: "POST", url: 'more_images.jsp', data: ({uid:uid, aid:aid, imgid:imgid}) , cache: false, success: function(html) { html = $.trim(html); $(html).filter('.corner-all').corner('5px'); $(html).filter('ol.c_album > li .img_c').corner('3px'); $(html).filter("ol.c_album > li ").find('a').attr('target', '_blank'); $('#images_list').append(html); } }); thanks Pradyut

    Read the article

  • Unexpected { expected ( ?

    - by Luke
    Parse error: syntax error, unexpected '{', expecting '(' in /home/a7237281/public_html/include/session.php on line 313 this is the error i get, relating to this code //check the emails $field = "email"; //Use field name for email $field2 = "email2"; if(!$subemail || strlen($subemail = trim($subemail)) == 0) { $form->setError($field, "* Email not entered"); } else if { /* Check if valid email address */ $regex = "^[_+a-z0-9-]+(\.[_+a-z0-9-]+)*" ."@[a-z0-9-]+(\.[a-z0-9-]{1,})*" ."\.([a-z]{2,}){1}$"; if(!eregi($regex,$subemail)) { $form->setError($field, "* Email invalid"); } else if ($subemail !== $subemail2) { $form->setError($field2, "* Emails does not match"); } $subemail = stripslashes($subemail); } /* Check if email is already in use */ else($database->emailTaken($subemail)) { $form->setError($field, "* Email address already in use"); } And its referring to the { after the first else if. I have edited with the entire piece of code, what could i do now?

    Read the article

  • gridview check duplicates not using sql

    - by Tomasusa
    I have a code: foreach (GridViewRow dr in gvCategories.Rows)<br/> { <br/> if (dr.Cells[0].Text == txtEnterCategory.Text.Trim())<br/> <br/> isError=true; <br/> <br/> } Debugging: dr.Cells[0].Text is always "", even there are records. How to use a loop to check each row to find if a record exists in the gridview not using sql?

    Read the article

  • What's wrong in this iban validation code?

    - by Jackoder
    Hello coders, I'm working on a php iban validator but i have a problem I wrote like this: function IbanValidator($value) { $iban = false; $value= strtoupper(trim($value)); # Change US text into your country code if(preg_match('/^US\d{7}0[A-Z0-9]{16}$/', $value)) { $number= substr($value,4,22).'2927'.substr($value,2,2); $number= str_replace( array('A','B','C','D','E','F','G','H','I','J','K','L','M','N','O','P','Q','R','S','T','U','V','W','X','Y','Z'), array(10,11,12,13,14,15,16,17,18,19,20,21,22,23,24,25,26,27,28,29,30,31,32,33,34,35), $number ); $iban = (1 == bcmod($number,97)) ? true; } return $iban; } Thanks.

    Read the article

  • How to add ACTIVE DOMAIN user to Sharepoint group

    - by standley-nguyen
    Hi all. I got an exception when executing this snippet code SPSecurity.RunWithElevatedPrivileges(delegate() { using (SPSite site = new SPSite(siteUrl.Trim())) { using (SPWeb web = site.OpenWeb()) { try { web.AllowUnsafeUpdates = true; SPUser spUser = web.AllUsers[userName]; if (spUser != null) { SPGroup spGroup = web.Groups[groupName]; if (spGroup != null) spGroup.AddUser(spUser); } } catch (Exception ex) { this.TraceData(LogLevel.Error, "Error at function Named [AddUserToSPGroupWidget.AddUserToGroup] . With Error Message: " + ex.ToString()); } finally { web.AllowUnsafeUpdates = false; } } } }); PLease guide me. Thanks in advance.

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • user agent checking for ios6

    - by Akash Saikia
    I am trying to check whether client opening the page is using iOS6 or not. var startIndex = navigator.userAgent.search(/OS/i) + 2; var endIndex = navigator.userAgent.search(/like/i); var iOSVersion = parseInt(navigator.userAgent.substr(startIndex,endIndex - startIndex).trim()); this.iOSVersion = true; if(!isNaN(iOSVersion)){ this.iOSVersion = iOSVersion; } else if(Ext.is.Desktop){ this.iOSVersion = true; } The above code works well for all the versions of browsers. But incase of using it in iOS6, it shows as iOS5. Searched for the same thing, but I didn't find a solution. May be I am still not done with searching for this, doing side by side search and hoping if some one has faced this issue before. Any suggestions or updations?

    Read the article

  • Properly trimming PCM data from a ByteArray

    - by Lowgain
    I have a situation where I need to trim a small amount of audio from the beginning of a recorded clip (generally somewhere between 110-150ms, it is an inconsistent amount). I'm recording in 44100 frequency and 16 bitrate. This is the code I'm using: public function get trimmedData():ByteArray { var ba:ByteArray = new ByteArray(); var bitPosition:uint = 44100 * 16 * (recordGap / 1000); bitPosition -= int(bitPosition % 16); //should keep snapped to nearest sample, I hope ba.writeBytes(_rawData, (bitPosition / 8)); return ba; } This seems to work time-wise, but all the recorded audio gets staticy and gross. Is something off about my rounding? This is the first time I've needed to alter raw PCM data so I'm not sure about the finer details of it. Thanks!

    Read the article

  • Beginform is not working in Asp.net mvc control whenI am trying to send the values

    - by kumar
    Hello friends i have a beginform is soemthing like this, <% using (Html.BeginForm("edit", (Model.ExceptionCategoryID == "EXP") ? "expense" : "pricing", FormMethod.Post, new { @id="exc-" + Model.ExceptionID})) { %> <input type="hidden" id="Status" runat="server"/> <%= Html.ValidationSummary(true)%> input submit button <input id="bSubmit" type="submit" class="button" value="Save" /> <script type="text/javascript"> $(document).ready(function() { $('#bSubmit').click(function() { var Status = "<%=Model.ExceptionStatus.Trim()%>"; alert(Status); $('#1_Status').attr('value',Status); }); </script> on sbmit I am trying to send the Status value.. on controler var sta = Request.Form[0]; I am getting something like 3%24Status in the From key.. why its hapeening ? thanks

    Read the article

  • [MFC] Combining 2 memory DCs ?

    - by OverTheEdge
    I'm writing a control where there's a lot of custom drawing going through. Because of this I need to trim down the amount of "screen writes" that go about. Currently there is only one memory DC that is used to write to screen so as to avoid flicker when the control is redrawn. I want to know if it is a possiblity to use 2 or more memory DCs to write updates independently and then bitblt them to screen. This way the need to render non-changed parts of the screen is minimized. thanx in advacne, the_Saint

    Read the article

  • Java String Replace and null characters

    - by praspa
    Testing out someone elses code (of course it was ...) , I noticed a few JSP pages printing funky non-ascii characters. Taking a dip into the source I found this tidbit. // remove any periods from first name e.g. Mr. John --> Mr John firstName = firstName.trim().replace('.','\0'); Does replacing a character in a String with a null character even work in Java? I know that '\0' will terminate a c-string. Would this be the culprit to the funky characters? Thanks PR

    Read the article

  • this.optional() in jQuery validation method doesn't seem to work

    - by HiveHicks
    Hello, I've got a little problem here. I've got the following rule for one of my fields: StartDate: { required: isDelayed, dateRU: true } isDelayed() returns false, so I guess StartDate field should be optional. However if I check it inside my dateRU method: $.validator.addMethod( "dateRU", function(value, element) { return this.optional(element) || isValidDate($.trim(value)); }, "Date is incorrect" ); this.optional(element) always returns false for StartDate. I can't figure out what's wrong. Any ideas? UPD. Does optional() returns true only if element is not required AND IS EMPTY? 'Cause that may be my problem.

    Read the article

  • Filtering and copying with PowerShell

    - by Bergius
    In my quest to improve my PowerShell skills, here's an example of an ugly solution to a simple problem. Any suggestions how to improve the oneliner are welcome. Mission: trim a huge icon library down to something a bit more manageable. The original directory structure looks like this: /Apps and Utilities /Compile /32 Bit Alpha png /Compile 16 n p.png /+ 10 or more files /+ 5 more formats with 10 or more files each /+ 20 or so icon names /+ 22 more categories I want to copy the 32 Bit Alpha pngs and flatten the directory structure a bit. Here's my quick and very dirty solution: $dest = mkdir c:\icons; gci -r | ? { $_.Name -eq '32 Bit Alph a png' } | % { mkdir ("$dest\" + $_.Parent.Parent.Name + "\" + $_.Parent.Name); $_ } | gci | % { cp $_. FullName -dest ("$dest\" + $_.Directory.Parent.Parent + "\" + $_.Directory.Parent) } Not nice, but it solved my problem. Resulting structure: /Apps and Utilities /Compile /Compile 16 n p.png /etc /etc /etc How would you do it?

    Read the article

  • CDATA xml parsing extra greater than problem

    - by Ruchir Shah
    Hi, I am creating an xml using php and parsing that xml in iphone application code. In description field there is some html tags and text. I am using following line to convert this html tags in to xml tag using CDATA. $response .= '<desc><![CDATA['.trim($feed['fulltext']).']]></desc>'; Now, here my $feed['fulltext'] value is like this <span class="ABC">...text...</span> In xml I am getting following response, <desc><![CDATA[><span class"ABC">...text...</span>]]></desc> You can see here, I am getting an extra greater-than symbol just before the value of $feed['fulltext'] starts. (like this: ...text...) Any solution or suggestion for this? Thanks in advance. Cheers.

    Read the article

  • Php is stripping one letter "g" from my rtrim function but not other chars

    - by Chase
    I'm trying to trim some youtube URLs that I am reading in from a playlist. The first 3 work fine and all their URLs either end in caps or numbers but this one that ends in a lower case g is getting trimmed one character shorter than the rest. for ($z=0; $z <= 3; $z++) { $ythref2 = rtrim($tubeArray["feed"]["entry"][$z]["link"][0]["href"], '&feature=youtube_gdata'); The URL is http://www.youtube.com/watch?v=CuE88oVCVjg&feature=youtube_gdata .. and it should get trimmed down to .. http://www.youtube.com/watch?v=CuE88oVCVjg but instead it is coming out as http://www.youtube.com/watch?v=CuE88oVCVj. I think it may be the ampersand symbol but I am not sure.

    Read the article

  • I need someone for explain this ASP function to me.

    - by Ronnie Chester Lynwood
    Hello! I've got an ASP document that 5 years old. Actually I'm working with PHP but I must use ASP for a Windows Application. So I need someone to explain this function to me. Thanks anyway. //DNS SETTINGS ARE INCLUDED ALREADY. function Check_Is_Web_Locked() dim cmdDB , Ret OpenDatabase Set cmdDB = Server.CreateObject("ADODB.Command") With cmdDB .ActiveConnection = DBCon .CommandText = "TICT_CHECK_WEB_STATUS" .CommandType = adCmdStoredProc .Parameters.Append .CreateParameter("RETURN_VALUE", adInteger, adParamReturnValue, 0) .Execute,,adExecuteNoRecords Ret = Trim(.Parameters("RETURN_VALUE")) End With Set cmdDB = Nothing CloseDatabase Check_Is_Web_Locked = Ret end function What does this functions do? Is "TICT_CHECK_WEB_STATUS" a StoredProcedure? If it's what are the coulumns that function looking for?

    Read the article

  • XmlTextReader issue

    - by Stanislav Palatnik
    I'm try to parse this xml, but c# keeps throwing an exception saying it has invalid characters. I can't copy the text from the messagebox directly, so I've screened it. http://img29.imageshack.us/img29/694/xmler.jpg Here's the code to get the string string strRetPage = System.Text.Encoding.GetEncoding(1251).GetString(RecvBytes, 0, bytes); while (bytes > 0) { bytes = socket.Receive(RecvBytes, RecvBytes.Length, 0); strRetPage = strRetPage + System.Text.Encoding.GetEncoding(1251).GetString(RecvBytes, 0, bytes); } int start = strRetPage.IndexOf("<?xml"); string servReply = strRetPage.Substring(start); servReply = servReply.Trim(); servReply = servReply.Replace("\r", ""); servReply = servReply.Replace("\n", ""); servReply = servReply.Replace("\t", ""); XmlTextReader txtRdr = new XmlTextReader(servReply);

    Read the article

  • How to code an ALL option into a Combo Box

    - by Edmond
    I have a combo box on my form with the choice of choosing organization 10, 20, 30.... I have added ALL to the combo list box, but am having trouble implementing an all statement in VBA. Below is the case statement I have to get info from organizations 10, 20, 30. How do I get ALL to generate?? Case Is = 1 If cboOrg.ListIndex < 0 Then Call msg("Please select your organization!") Exit Sub End If sQ = sQ & " CC LIKE '" & cboOrg.Value & "*'" ORGCC = Trim(cboOrg.Value)

    Read the article

  • PHP use of undefined constant error

    - by user272899
    Using a great script to grab details from imdb, I would like to thank Fabian Beiner. Just one error i have encountered with it is: Use of undefined constant sys_get_temp_dir assumed 'sys_get_temp_dir' in '/path/to/directory' on line 49 This is the complete script <?php /** * IMDB PHP Parser * * This class can be used to retrieve data from IMDB.com with PHP. This script will fail once in * a while, when IMDB changes *anything* on their HTML. Guys, it's time to provide an API! * * @link http://fabian-beiner.de * @copyright 2010 Fabian Beiner * @author Fabian Beiner (mail [AT] fabian-beiner [DOT] de) * @license MIT License * * @version 4.1 (February 1st, 2010) * */ class IMDB { private $_sHeader = null; private $_sSource = null; private $_sUrl = null; private $_sId = null; public $_bFound = false; private $_oCookie = '/tmp/imdb-grabber-fb.tmp'; const IMDB_CAST = '#<a href="/name/(\w+)/" onclick="\(new Image\(\)\)\.src=\'/rg/castlist/position-(\d|\d\d)/images/b\.gif\?link=/name/(\w+)/\';">(.*)</a>#Ui'; const IMDB_COUNTRY = '#<a href="/Sections/Countries/(\w+)/">#Ui'; const IMDB_DIRECTOR = '#<a href="/name/(\w+)/" onclick="\(new Image\(\)\)\.src=\'/rg/directorlist/position-(\d|\d\d)/images/b.gif\?link=name/(\w+)/\';">(.*)</a><br/>#Ui'; const IMDB_GENRE = '#<a href="/Sections/Genres/(\w+|\w+\-\w+)/">(\w+|\w+\-\w+)</a>#Ui'; const IMDB_MPAA = '#<h5><a href="/mpaa">MPAA</a>:</h5>\s*<div class="info-content">\s*(.*)\s*</div>#Ui'; const IMDB_PLOT = '#<h5>Plot:</h5>\s*<div class="info-content">\s*(.*)\s*<a#Ui'; const IMDB_POSTER = '#<a name="poster" href="(.*)" title="(.*)"><img border="0" alt="(.*)" title="(.*)" src="(.*)" /></a>#Ui'; const IMDB_RATING = '#<b>(\d\.\d/10)</b>#Ui'; const IMDB_RELEASE_DATE = '#<h5>Release Date:</h5>\s*\s*<div class="info-content">\s*(.*) \((.*)\)#Ui'; const IMDB_RUNTIME = '#<h5>Runtime:</h5>\s*<div class="info-content">\s*(.*)\s*</div>#Ui'; const IMDB_SEARCH = '#<b>Media from&nbsp;<a href="/title/tt(\d+)/"#i'; const IMDB_TAGLINE = '#<h5>Tagline:</h5>\s*<div class="info-content">\s*(.*)\s*</div>#Ui'; const IMDB_TITLE = '#<title>(.*) \((.*)\)</title>#Ui'; const IMDB_URL = '#http://(.*\.|.*)imdb.com/(t|T)itle(\?|/)(..\d+)#i'; const IMDB_VOTES = '#&nbsp;&nbsp;<a href="ratings" class="tn15more">(.*) votes</a>#Ui'; const IMDB_WRITER = '#<a href="/name/(\w+)/" onclick="\(new Image\(\)\)\.src=\'/rg/writerlist/position-(\d|\d\d)/images/b\.gif\?link=name/(\w+)/\';">(.*)</a>#Ui'; const IMDB_REDIRECT = '#Location: (.*)#'; /** * Public constructor. * * @param string $sSearch */ public function __construct($sSearch) { if (function_exists(sys_get_temp_dir)) { $this->_oCookie = tempnam(sys_get_temp_dir(), 'imdb'); } $sUrl = $this->findUrl($sSearch); if ($sUrl) { $bFetch = $this->fetchUrl($this->_sUrl); $this->_bFound = true; } } /** * Little REGEX helper. * * @param string $sRegex * @param string $sContent * @param int $iIndex; */ private function getMatch($sRegex, $sContent, $iIndex = 1) { preg_match($sRegex, $sContent, $aMatches); if ($iIndex > count($aMatches)) return; if ($iIndex == null) { return $aMatches; } return $aMatches[(int)$iIndex]; } /** * Little REGEX helper, I should find one that works for both... ;/ * * @param string $sRegex * @param int $iIndex; */ private function getMatches($sRegex, $iIndex = null) { preg_match_all($sRegex, $this->_sSource, $aMatches); if ((int)$iIndex) return $aMatches[$iIndex]; return $aMatches; } /** * Save an image. * * @param string $sUrl */ private function saveImage($sUrl) { $sUrl = trim($sUrl); $bolDir = false; if (!is_dir(getcwd() . '/posters')) { if (mkdir(getcwd() . '/posters', 0777)) { $bolDir = true; } } $sFilename = getcwd() . '/posters/' . preg_replace("#[^0-9]#", "", basename($sUrl)) . '.jpg'; if (file_exists($sFilename)) { return 'posters/' . basename($sFilename); } if (is_dir(getcwd() . '/posters') OR $bolDir) { if (function_exists('curl_init')) { $oCurl = curl_init($sUrl); curl_setopt_array($oCurl, array ( CURLOPT_VERBOSE => 0, CURLOPT_HEADER => 0, CURLOPT_RETURNTRANSFER => 1, CURLOPT_TIMEOUT => 5, CURLOPT_CONNECTTIMEOUT => 5, CURLOPT_REFERER => $sUrl, CURLOPT_BINARYTRANSFER => 1)); $sOutput = curl_exec($oCurl); curl_close($oCurl); $oFile = fopen($sFilename, 'x'); fwrite($oFile, $sOutput); fclose($oFile); return 'posters/' . basename($sFilename); } else { $oImg = imagecreatefromjpeg($sUrl); imagejpeg($oImg, $sFilename); return 'posters/' . basename($sFilename); } return false; } return false; } /** * Find a valid Url out of the passed argument. * * @param string $sSearch */ private function findUrl($sSearch) { $sSearch = trim($sSearch); if ($aUrl = $this->getMatch(self::IMDB_URL, $sSearch, 4)) { $this->_sId = 'tt' . preg_replace('[^0-9]', '', $aUrl); $this->_sUrl = 'http://www.imdb.com/title/' . $this->_sId .'/'; return true; } else { $sTemp = 'http://www.imdb.com/find?s=all&q=' . str_replace(' ', '+', $sSearch) . '&x=0&y=0'; $bFetch = $this->fetchUrl($sTemp); if( $this->isRedirect() ) { return true; } else if ($bFetch) { if ($strMatch = $this->getMatch(self::IMDB_SEARCH, $this->_sSource)) { $this->_sUrl = 'http://www.imdb.com/title/tt' . $strMatch . '/'; unset($this->_sSource); return true; } } } return false; } /** * Find if result is redirected directly to exact movie. */ private function isRedirect() { if ($strMatch = $this->getMatch(self::IMDB_REDIRECT, $this->_sHeader)) { $this->_sUrl = $strMatch; unset($this->_sSource); unset($this->_sHeader); return true; } return false; } /** * Fetch data from given Url. * Uses cURL if installed, otherwise falls back to file_get_contents. * * @param string $sUrl * @param int $iTimeout; */ private function fetchUrl($sUrl, $iTimeout = 15) { $sUrl = trim($sUrl); if (function_exists('curl_init')) { $oCurl = curl_init($sUrl); curl_setopt_array($oCurl, array ( CURLOPT_VERBOSE => 0, CURLOPT_HEADER => 1, CURLOPT_FRESH_CONNECT => true, CURLOPT_RETURNTRANSFER => 1, CURLOPT_TIMEOUT => (int)$iTimeout, CURLOPT_CONNECTTIMEOUT => (int)$iTimeout, CURLOPT_REFERER => $sUrl, CURLOPT_FOLLOWLOCATION => 0, CURLOPT_COOKIEFILE => $this->_oCookie, CURLOPT_COOKIEJAR => $this->_oCookie, CURLOPT_USERAGENT => 'Mozilla/5.0 (Windows; U; Windows NT 6.1; en-US; rv:1.9.2) Gecko/20100115 Firefox/3.6' )); $sOutput = curl_exec($oCurl); if ($sOutput === false) { return false; } $aInfo = curl_getinfo($oCurl); if ($aInfo['http_code'] != 200 && $aInfo['http_code'] != 302) { return false; } $sTmpHeader = strpos($sOutput, "\r\n\r\n"); $this->_sHeader = substr($sOutput, 0, $sTmpHeader); $this->_sSource = str_replace("\n", '', substr($sOutput, $sTmpHeader+1)); curl_close($oCurl); return true; } else { $sOutput = @file_get_contents($sUrl, 0); if (strpos($http_response_header[0], '200') === false){ return false; } $this->_sSource = str_replace("\n", '', (string)$sOutput); return true; } return false; } /** * Returns the cast. */ public function getCast($iOutput = null, $bMore = true) { if ($this->_sSource) { $sReturned = $this->getMatches(self::IMDB_CAST, 4); if (is_array($sReturned)) { if ($iOutput) { foreach ($sReturned as $i => $sName) { if ($i >= $iOutput) break; $sReturn[] = $sName; } return implode(' / ', $sReturn) . (($bMore) ? '&hellip;' : ''); } return implode(' / ', $sReturned); } return $sReturned; } return 'n/A'; } /** * Returns the cast as links. */ public function getCastAsUrl($iOutput = null, $bMore = true) { if ($this->_sSource) { $sReturned1 = $this->getMatches(self::IMDB_CAST, 4); $sReturned2 = $this->getMatches(self::IMDB_CAST, 3); if (is_array($sReturned1)) { if ($iOutput) { foreach ($sReturned1 as $i => $sName) { if ($i >= $iOutput) break; $aReturn[] = '<a href="http://www.imdb.com/name/' . $sReturned2[$i] . '/">' . $sName . '</a>';; } return implode(' / ', $aReturn) . (($bMore) ? '&hellip;' : ''); } return implode(' / ', $sReturned); } return '<a href="http://www.imdb.com/name/' . $sReturned2 . '/">' . $sReturned1 . '</a>';; } return 'n/A'; } /** * Returns the countr(y|ies). */ public function getCountry() { if ($this->_sSource) { $sReturned = $this->getMatches(self::IMDB_COUNTRY, 1); if (is_array($sReturned)) { return implode(' / ', $sReturned); } return $sReturned; } return 'n/A'; } /** * Returns the countr(y|ies) as link(s). */ public function getCountryAsUrl() { if ($this->_sSource) { $sReturned = $this->getMatches(self::IMDB_COUNTRY, 1); if (is_array($sReturned)) { foreach ($sReturned as $sCountry) { $aReturn[] = '<a href="http://www.imdb.com/Sections/Countries/' . $sCountry . '/">' . $sCountry . '</a>'; } return implode(' / ', $aReturn); } return '<a href="http://www.imdb.com/Sections/Countries/' . $sReturned . '/">' . $sReturned . '</a>'; } return 'n/A'; } /** * Returns the director(s). */ public function getDirector() { if ($this->_sSource) { $sReturned = $this->getMatches(self::IMDB_DIRECTOR, 4); if (is_array($sReturned)) { return implode(' / ', $sReturned); } return $sReturned; } return 'n/A'; } /** * Returns the director(s) as link(s). */ public function getDirectorAsUrl() { if ($this->_sSource) { $sReturned1 = $this->getMatches(self::IMDB_DIRECTOR, 4); $sReturned2 = $this->getMatches(self::IMDB_DIRECTOR, 1); if (is_array($sReturned1)) { foreach ($sReturned1 as $i => $sDirector) { $aReturn[] = '<a href="http://www.imdb.com/name/' . $sReturned2[$i] . '/">' . $sDirector . '</a>'; } return implode(' / ', $aReturn); } return '<a href="http://www.imdb.com/name/' . $sReturned2 . '/">' . $sReturned1 . '</a>'; } return 'n/A'; } /** * Returns the genre(s). */ public function getGenre() { if ($this->_sSource) { $sReturned = $this->getMatches(self::IMDB_GENRE, 1); if (is_array($sReturned)) { return implode(' / ', $sReturned); } return $sReturned; } return 'n/A'; } /** * Returns the genre(s) as link(s). */ public function getGenreAsUrl() { if ($this->_sSource) { $sReturned = $this->getMatches(self::IMDB_GENRE, 1); if (is_array($sReturned)) { foreach ($sReturned as $i => $sGenre) { $aReturn[] = '<a href="http://www.imdb.com/Sections/Genres/' . $sGenre . '/">' . $sGenre . '</a>'; } return implode(' / ', $aReturn); } return '<a href="http://www.imdb.com/Sections/Genres/' . $sReturned . '/">' . $sReturned . '</a>'; } return 'n/A'; } /** * Returns the mpaa. */ public function getMpaa() { if ($this->_sSource) { return implode('' , $this->getMatches(self::IMDB_MPAA, 1)); } return 'n/A'; } /** * Returns the plot. */ public function getPlot() { if ($this->_sSource) { return implode('' , $this->getMatches(self::IMDB_PLOT, 1)); } return 'n/A'; } /** * Download the poster, cache it and return the local path to the image. */ public function getPoster() { if ($this->_sSource) { if ($sPoster = $this->saveImage(implode("", $this->getMatches(self::IMDB_POSTER, 5)), 'poster.jpg')) { return $sPoster; } return implode('', $this->getMatches(self::IMDB_POSTER, 5)); } return 'n/A'; } /** * Returns the rating. */ public function getRating() { if ($this->_sSource) { return implode('', $this->getMatches(self::IMDB_RATING, 1)); } return 'n/A'; } /** * Returns the release date. */ public function getReleaseDate() { if ($this->_sSource) { return implode('', $this->getMatches(self::IMDB_RELEASE_DATE, 1)); } return 'n/A'; } /** * Returns the runtime of the current movie. */ public function getRuntime() { if ($this->_sSource) { return implode('', $this->getMatches(self::IMDB_RUNTIME, 1)); } return 'n/A'; } /** * Returns the tagline. */ public function getTagline() { if ($this->_sSource) { return implode('', $this->getMatches(self::IMDB_TAGLINE, 1)); } return 'n/A'; } /** * Get the release date of the current movie. */ public function getTitle() { if ($this->_sSource) { return implode('', $this->getMatches(self::IMDB_TITLE, 1)); } return 'n/A'; } /** * Returns the url. */ public function getUrl() { return $this->_sUrl; } /** * Get the votes of the current movie. */ public function getVotes() { if ($this->_sSource) { return implode('', $this->getMatches(self::IMDB_VOTES, 1)); } return 'n/A'; } /** * Get the year of the current movie. */ public function getYear() { if ($this->_sSource) { return implode('', $this->getMatches(self::IMDB_TITLE, 2)); } return 'n/A'; } /** * Returns the writer(s). */ public function getWriter() { if ($this->_sSource) { $sReturned = $this->getMatches(self::IMDB_WRITER, 4); if (is_array($sReturned)) { return implode(' / ', $sReturned); } return $sReturned; } return 'n/A'; } /** * Returns the writer(s) as link(s). */ public function getWriterAsUrl() { if ($this->_sSource) { $sReturned1 = $this->getMatches(self::IMDB_WRITER, 4); $sReturned2 = $this->getMatches(self::IMDB_WRITER, 1); if (is_array($sReturned1)) { foreach ($sReturned1 as $i => $sWriter) { $aReturn[] = '<a href="http://www.imdb.com/name/' . $sReturned2[$i] . '/">' . $sWriter . '</a>'; } return implode(' / ', $aReturn); } return '<a href="http://www.imdb.com/name/' . $sReturned2 . '/">' . $sReturned1 . '</a>'; } return 'n/A'; } } ?>

    Read the article

< Previous Page | 18 19 20 21 22 23 24 25 26 27 28 29  | Next Page >