Search Results

Search found 17079 results on 684 pages for 'exception logging'.

Page 226/684 | < Previous Page | 222 223 224 225 226 227 228 229 230 231 232 233  | Next Page >

  • Opening a Silverlight project causes APPCRASH is Visual Studio 2008

    - by Ed Woodcock
    Hi guys I've got to add a Silverlight project to a solution for a deployment procedure (it's a pre-build dependency for the main project). I've installed Silverlight tools v3, silverlight itself and the silverlight sdk 3, and am using Visual Studio 2008 with ReSharper and the DevArt oracle database tools. Every time I go to open the relevant silverlight .csproj file VS crashes with the following error message: Problem Event Name: APPCRASH Application Name: devenv.exe Application Version: 9.0.30729.1 Application Timestamp: 488f2b50 Fault Module Name: StackHash_20af Fault Module Version: 6.0.6001.18000 Fault Module Timestamp: 4791a7a6 Exception Code: c0000374 Exception Offset: 000b015d This also happens if I try to create a new silverlight project from scratch. Does anyone have any suggestions?

    Read the article

  • Update MySQL table from jsp

    - by vishnu
    I have these in a jsp file. But these values are not updated in the mysql table. May be it is not commiting. How can i solve this ? String passc1 = request.getParameter("passc1"); String accid = request.getParameter("accid"); int i = 0; String sql = " update customertb " + " set passwd = ?" + " where acc_no = ?;"; try { PreparedStatement ps = con.prepareStatement(sql); ps.setString(1, passc1); ps.setString(2, accid); i = ps.executeUpdate(); } catch (Exception e) { // do something with Exception here. Maybe just throw it up again } finally { con.close(); }

    Read the article

  • Fleunt NHibernate not working outside of nunit test fixtures

    - by thorkia
    Okay, here is my problem... I created a Data Layer using the RTM Fluent Nhibernate. My create session code looks like this: _session = Fluently.Configure(). Database(SQLiteConfiguration.Standard.UsingFile("Data.s3db")) .Mappings( m => { m.FluentMappings.AddFromAssemblyOf<ProductMap>(); m.FluentMappings.AddFromAssemblyOf<ProductLogMap>(); }) .ExposeConfiguration(BuildSchema) .BuildSessionFactory(); When I reference the module in a test project, then create a test fixture that looks something like this: [Test] public void CanAddProduct() { var product = new Product {Code = "9", Name = "Test 9"}; IProductRepository repository = new ProductRepository(); repository.AddProduct(product); using (ISession session = OrmHelper.OpenSession()) { var fromDb = session.Get<Product>(product.Id); Assert.IsNotNull(fromDb); Assert.AreNotSame(fromDb, product); Assert.AreEqual(fromDb.Id, product.Id); } My tests pass. When I open up the created SQLite DB, the new Product with Code 9 is in it. the tables for Product and ProductLog are there. Now, when I create a new console application, and reference the same library, do something like this: Product product = new Product() {Code = "10", Name = "Hello"}; IProductRepository repository = new ProductRepository(); repository.AddProduct(product); Console.WriteLine(product.Id); Console.ReadLine(); It doesn't work. I actually get pretty nasty exception chain. To save you lots of head aches, here is the summary: Top Level exception: An invalid or incomplete configuration was used while creating a SessionFactory. Check PotentialReasons collection, and InnerException for more detail.\r\n\r\n The PotentialReasons collection is empty The Inner exception: The IDbCommand and IDbConnection implementation in the assembly System.Data.SQLite could not be found. Ensure that the assembly System.Data.SQLite is located in the application directory or in the Global Assembly Cache. If the assembly is in the GAC, use element in the application configuration file to specify the full name of the assembly. Both the unit test library and the console application reference the exact same version of System.Data.SQLite. Both projects have the exact same DLLs in the debug folder. I even tried copying SQLite DB the unit test library created into the debug directory of the console app, and removed the build schema lines and it still fails If anyone can help me figure out why this won't work outside of my unit tests it would be greatly appreciated. This crazy bug has me at a stand still.

    Read the article

  • help me "dry" out this .net XML serialization code

    - by Sarah Vessels
    I have a base collection class and a child collection class, each of which are serializable. In a test, I discovered that simply having the child class's ReadXml method call base.ReadXml resulted in an InvalidCastException later on. First, here's the class structure: Base Class // Collection of Row objects [Serializable] [XmlRoot("Rows")] public class Rows : IList<Row>, ICollection<Row>, IEnumerable<Row>, IEquatable<Rows>, IXmlSerializable { public Collection<Row> Collection { get; protected set; } public void ReadXml(XmlReader reader) { reader.ReadToFollowing(XmlNodeName); do { using (XmlReader rowReader = reader.ReadSubtree()) { var row = new Row(); row.ReadXml(rowReader); Collection.Add(row); } } while (reader.ReadToNextSibling(XmlNodeName)); } } Derived Class // Acts as a collection of SpecificRow objects, which inherit from Row. Uses the same // Collection<Row> that Rows defines which is fine since SpecificRow : Row. [Serializable] [XmlRoot("MySpecificRowList")] public class SpecificRows : Rows, IXmlSerializable { public new void ReadXml(XmlReader reader) { // Trying to just do base.ReadXml(reader) causes a cast exception later reader.ReadToFollowing(XmlNodeName); do { using (XmlReader rowReader = reader.ReadSubtree()) { var row = new SpecificRow(); row.ReadXml(rowReader); Collection.Add(row); } } while (reader.ReadToNextSibling(XmlNodeName)); } public new Row this[int index] { // The cast in this getter is what causes InvalidCastException if I try // to call base.ReadXml from this class's ReadXml get { return (Row)Collection[index]; } set { Collection[index] = value; } } } And here's the code that causes a runtime InvalidCastException if I do not use the version of ReadXml shown in SpecificRows above (i.e., I get the exception if I just call base.ReadXml from within SpecificRows.ReadXml): TextReader reader = new StringReader(serializedResultStr); SpecificRows deserializedResults = (SpecificRows)xs.Deserialize(reader); SpecificRow = deserializedResults[0]; // this throws InvalidCastException So, the code above all compiles and runs exception-free, but it bugs me that Rows.ReadXml and SpecificRows.ReadXml are essentially the same code. The value of XmlNodeName and the new Row()/new SpecificRow() are the differences. How would you suggest I extract out all the common functionality of both versions of ReadXml? Would it be silly to create some generic class just for one method? Sorry for the lengthy code samples, I just wanted to provide the reason I can't simply call base.ReadXml from within SpecificRows.

    Read the article

  • Mysql: ROLLBACK for multiple queries

    - by Raj
    Hi I have more than three MySql queiries in a PHP script triggered by scheduled task. If a query catch an error, script throw an exception and rollback that Mysql query. It works fine. However if first query works fine, but not 2nd query, throw an exception, it rollback 2nd one but not 1st query. I am using begin_trans(), commit and rollback() for individual queries because Sometimes i need to rollback one query, sometimes all queries. Is there any way to rollback one query or all queries? Thanks in advance UPDATE: I got it working, there was no problem with in begin_trans(), commit and rollback(), the database connection config was different for one query from other queries, crazy code without any comments!!!

    Read the article

  • Is it OK to open a DB4o file for query, insert, update multiple times?

    - by Khnle
    This is the way I am thinking of using DB4o. When I need to query, I would open the file, read and close: using (IObjectContainer db = Db4oFactory.OpenFile(Db4oFactory.NewConfiguration(), YapFileName)) { try { List<Pilot> pilots = db.Query<Pilot>().ToList<Pilot>(); } finally { try { db.Close(); } catch (Exception) { }; } } At some later time, when I need to insert, then using (IObjectContainer db = Db4oFactory.OpenFile(Db4oFactory.NewConfiguration(), YapFileName)) { try { Pilot pilot1 = new Pilot("Michael Schumacher", 100); db.Store(pilot1); } finally { try { db.Close(); } catch (Exception) { }; } } In this way, I thought I will keep the file more tidy by only having it open when needed, and have it closed most of the time. But I keep getting InvalidCastException Unable to cast object of type 'Db4objects.Db4o.Reflect.Generic.GenericObject' to type 'Pilot' What's the correct way to use DB4o?

    Read the article

  • Findbugs warning: Equals method should not assume anything about the type of its argument

    - by Uri
    When running FindBugs on my project, I got a few instances of the error described above. Namely, my overriding versions of equals cast the RHS object into the same type as the object in which the overriding version is defined. However, I'm not sure whether a better design is possible, since AFAIK Java does not allow variance in method parameters, so it is not possible to define any other type for the equals parameter. Am I doing something very wrong, or is FindBugs too eager? A different way to phrase this question is: what is the correct behavior if the object passed to equals is not the same type as an LHS: Is this a false, or should there be an exception? For example: public boolean equals(Object rhs) { MyType rhsMyType = (MyType)rhs; // Should throw exception if(this.field1().equals(rhsMyType.field1())... // Or whatever }

    Read the article

  • How to get the place name by latitude and longitude using openstreetmap in android

    - by Gaurav kumar
    In my app i am using osm rather than google map.I have latitude and longitude.So from here how i will query to get the city name from osm database..please help me. final String requestString = "http://nominatim.openstreetmap.org/reverse?format=json&lat=" + Double.toString(lat) + "&lon=" + Double.toString(lon) + "&zoom=18&addressdetails=1"; RequestBuilder builder = new RequestBuilder(RequestBuilder.GET, URL.encode(requestString)); try { @SuppressWarnings("unused") Request request = builder.sendRequest(null, new RequestCallback() { @Override public void onResponseReceived(Request request, Response response) { if (response.getStatusCode() == 200) { String city = ""; try { JSONValue json = JSONParser.parseStrict(response); JSONObject address = json.isObject().get("address").isObject(); final String quotes = "^\"|\"$"; if (address.get("city") != null) { city = address.get("city").toString().replaceAll(quotes, ""); } else if (address.get("village") != null) { city = address.get("village").toString().replaceAll(quotes, ""); } } catch (Exception e) { } } } }); } catch (Exception e1) { }

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • Sending the files (At least 11 files) from folder through web service to android app.

    - by Shashank_Itmaster
    Hello All, I stuck in middle of this situation,Please help me out. My question is that I want to send files (Total 11 PDF Files) to android app using web service. I tried it with below code.Main Class from which web service is created public class MultipleFilesImpl implements MultipleFiles { public FileData[] sendPDFs() { FileData fileData = null; // List<FileData> filesDetails = new ArrayList<FileData>(); File fileFolder = new File( "C:/eclipse/workspace/AIPWebService/src/pdfs/"); // File fileTwo = new File( // "C:/eclipse/workspace/AIPWebService/src/simple.pdf"); File sendFiles[] = fileFolder.listFiles(); // sendFiles[0] = fileOne; // sendFiles[1] = fileTwo; DataHandler handler = null; char[] readLine = null; byte[] data = null; int offset = 0; int numRead = 0; InputStream stream = null; FileOutputStream outputStream = null; FileData[] filesData = null; try { System.out.println("Web Service Called Successfully"); for (int i = 0; i < sendFiles.length; i++) { handler = new DataHandler(new FileDataSource(sendFiles[i])); fileData = new FileData(); data = new byte[(int) sendFiles[i].length()]; stream = handler.getInputStream(); while (offset < data.length && (numRead = stream.read(data, offset, data.length - offset)) >= 0) { offset += numRead; } readLine = Base64Coder.encode(data); offset = 0; numRead = 0; System.out.println("'Reading File............................"); System.out.println("\n"); System.out.println(readLine); System.out.println("Data Reading Successful"); fileData.setFileName(sendFiles[i].getName()); fileData.setFileData(String.valueOf(readLine)); readLine = null; System.out.println("Data from bean " + fileData.getFileData()); outputStream = new FileOutputStream("D:/" + sendFiles[i].getName()); outputStream.write(Base64Coder.decode(fileData.getFileData())); outputStream.flush(); outputStream.close(); stream.close(); // FileData fileDetails = new FileData(); // fileDetails = fileData; // filesDetails.add(fileData); filesData = new FileData[(int) sendFiles[i].length()]; } // return fileData; } catch (FileNotFoundException e) { e.printStackTrace(); } catch (IOException e) { e.printStackTrace(); } catch (Exception e) { e.printStackTrace(); } return filesData; } } Also The Interface MultipleFiles:- public interface MultipleFiles extends Remote { public FileData[] sendPDFs() throws FileNotFoundException, IOException, Exception; } Here I am sending an array of bean "File Data",having properties viz. FileData & FileName. FileData- contains file data in encoded. FileName- encoded file name. The Bean:- (FileData) public class FileData { private String fileName; private String fileData; public String getFileName() { return fileName; } public void setFileName(String fileName) { this.fileName = fileName; } public String getFileData() { return fileData; } public void setFileData(String string) { this.fileData = string; } } The android DDMS gives out of memory exception when tried below code & when i tried to send two files then only first file is created. public class PDFActivity extends Activity { private final String METHOD_NAME = "sendPDFs"; private final String NAMESPACE = "http://webservice.uks.com/"; private final String SOAP_ACTION = NAMESPACE + METHOD_NAME; private final String URL = "http://192.168.1.123:8080/AIPWebService/services/MultipleFilesImpl"; /** Called when the activity is first created. */ @Override public void onCreate(Bundle savedInstanceState) { super.onCreate(savedInstanceState); setContentView(R.layout.main); TextView textViewOne = (TextView) findViewById(R.id.textViewOne); try { SoapObject soapObject = new SoapObject(NAMESPACE, METHOD_NAME); SoapSerializationEnvelope envelope = new SoapSerializationEnvelope( SoapEnvelope.VER11); envelope.setOutputSoapObject(soapObject); textViewOne.setText("Web Service Started"); AndroidHttpTransport httpTransport = new AndroidHttpTransport(URL); httpTransport.call(SOAP_ACTION, envelope); // SoapObject result = (SoapObject) envelope.getResponse(); Object result = envelope.getResponse(); Log.i("Result", result.toString()); // String fileName = result.getProperty("fileName").toString(); // String fileData = result.getProperty("fileData").toString(); // Log.i("File Name", fileName); // Log.i("File Data", fileData); // File pdfFile = new File(fileName); // FileOutputStream outputStream = // openFileOutput(pdfFile.toString(), // MODE_PRIVATE); // outputStream.write(Base64Coder.decode(fileData)); Log.i("File", "File Created"); // textViewTwo.setText(result); // Object result = envelope.getResponse(); // FileOutputStream outputStream = openFileOutput(name, mode) } catch (Exception e) { e.printStackTrace(); } } } Please help with some explanation or changes in my code. Thanks in Advance.

    Read the article

  • ASP.NET Connection time out after being idle for a while

    - by yazz
    My ASP.NET website while trying to connect to the database for first time after a period of inactivity throws an time out exception. I understand the connections in the connection pool get terminated after some idle time for some reason (Firewall or Oracle settings) and the pool or app doesn't have a clue about it. Is there any way to validate the connection beforehand so that the first try doesn't throw an exception? I don't have much control over the DB or Firewall settings. So I have to deal with this is my application.(would prefer if there is any web.config settings) I am using: ASP.NET 2.0. Oracle server 11g, Microsoft Enterprise Library DAAB to do all my DB operations. I did some search on this topic but didnt find any solid solution for this yet :(

    Read the article

  • How to add ACTIVE DOMAIN user to Sharepoint group

    - by standley-nguyen
    Hi all. I got an exception when executing this snippet code SPSecurity.RunWithElevatedPrivileges(delegate() { using (SPSite site = new SPSite(siteUrl.Trim())) { using (SPWeb web = site.OpenWeb()) { try { web.AllowUnsafeUpdates = true; SPUser spUser = web.AllUsers[userName]; if (spUser != null) { SPGroup spGroup = web.Groups[groupName]; if (spGroup != null) spGroup.AddUser(spUser); } } catch (Exception ex) { this.TraceData(LogLevel.Error, "Error at function Named [AddUserToSPGroupWidget.AddUserToGroup] . With Error Message: " + ex.ToString()); } finally { web.AllowUnsafeUpdates = false; } } } }); PLease guide me. Thanks in advance.

    Read the article

  • Handling exceptions raised in observers

    - by sparky
    I have a Rails (2.3.5) application where there are many groups, and each Group has_many People. I have a Group edit form where users can create new people. When a new person is created, they are sent an email (the email address is user entered on the form). This is accomplished with an observer on the Person model. The problem comes when ActionMailer throws an exception - for example if the domain does not exist. Clearly that cannot be weeded out with a validation. There would seem to be 2 ways to deal with this: A begin...rescue...end block in the observer around the mailer. The problem with this is that the only way to pass any feedback to the user would be to set a global variable - as the observer is out of the MVC flow, I can't even set a flash[:error] there. A rescue_from in the Groups controller. This works fine, but has 2 problems. Firstly, there is no way to know which person threw the exception (all I can get is the 503 exception, no way to know which person caused the problem). This would be useful information to be able to pass back to the user - at the moment, there is no way for me to let them know which email address is the problem - at the moment, I just have to chuck the lot back at them, and issue an unhelpful message saying that one of them is not correct. Secondly (and to a certain extent this make the first point moot) it seems that it is necessary to call a render in the rescue_from, or it dies with a rather bizarre "can't convert Array into String" error from webbrick, with no stack trace & nothing in the log. Thus, I have to throw it back to the user when I come across the first error and have to stop processing the rest of the emails. Neither of the solutions are optimal. It would seem that the only way to get Rails to do what I want is option 1, and loathsome global variables. This would also rely on Rails being single threaded. Can anyone suggest a better solution to this problem?

    Read the article

  • Can't Instantiate Windsor Custom Component Activator

    - by jeffn825
    Hi, I'm getting an exception calling Resolve: KernelException: Could not instantiate custom activator Inner Exception: {"Constructor on type 'MyProj.MyAdapter`1[[MyProj.MyBusinessObject, MyAsm, Version=1.0.0.0, Culture=neutral, PublicKeyToken=null]]' not found."} There's definitely a public parameterless constructor there (and I've verified this using reflection at runtime)...so I figure the problem might have to do with the fact that it's generic? I've tried getting the component model object and setting RequiresGenericArguments to true, but that hasn't gotten me anywhere. Any help would be much appreciated! Thanks.

    Read the article

  • Can't add domain users to Reporting Services 2008

    - by Jeremy
    I have SSRS 2008 setup on the database server. The server is part of the domain. Reporting Services is running under NetworkService. When I try to add a domain user using the web interface (Site Settings -- Security -- New Role Assignment), the page posts back but the user is not in the list. The server's log file contains the following Unhandled Exception: ui!ReportManager_0-1!954!01/12/2009-10:14:52:: Unhandled exception: System.Security.Principal.IdentityNotMappedException: Some or all identity references could not be translated. at System.Security.Principal.SecurityIdentifier.Translate(IdentityReferenceCollection sourceSids, Type targetType, Boolean forceSuccess) at System.Security.Principal.SecurityIdentifier.Translate(Type targetType) at System.Security.Principal.WindowsIdentity.GetName() at System.Security.Principal.WindowsIdentity.get_Name() at ReportingServicesHttpRuntime.RsWorkerRequest.GetServerVariable(String name) at System.Web.Security.WindowsAuthenticationModule.OnEnter(Object source, EventArgs eventArgs) at System.Web.HttpApplication.SyncEventExecutionStep.System.Web.HttpApplication.IExecutionStep.Execute() at System.Web.HttpApplication.ExecuteStep(IExecutionStep step, Boolean& completedSynchronously) Any one have an idea on how to fix this?

    Read the article

  • Out-of-the-box Eclipse PDT (PHP Development Tool) not capable of debugging PHP, why?

    - by Alex R
    I just finished reinstalling the "All-In-One Eclipse PDT" from zend.com. It's unable to debug even the simplest "Hello World" PHP script. How can such a major open-source app be released in such a bad shape? What am I doing wrong? This is the result of doing a "Debug As...": Problem signature: Problem Event Name: APPCRASH Application Name: php.exe Application Version: 5.2.9.9 Application Timestamp: 49dda267 Fault Module Name: ntdll.dll Fault Module Version: 6.0.6002.18005 Fault Module Timestamp: 49e03824 Exception Code: c0000130 Exception Offset: 0006f04e OS Version: 6.0.6002.2.2.0.768.3 Locale ID: 1033 Additional Information 1: 9d13 Additional Information 2: 1abee00edb3fc1158f9ad6f44f0f6be8 Additional Information 3: 9d13 Additional Information 4: 1abee00edb3fc1158f9ad6f44f0f6be8 Read our privacy statement: http://go.microsoft.com/fwlink/?linkid=50163&clcid=0x0409 I think it wants me to configure some additional stuff, but I have no clue what exactly to do.

    Read the article

  • input file cannot be found

    - by Eric Smith
    I am just messing around with reading input files with java until I got stumped at the most basic of steps... finding the input file! The input.txt file is in the same directory as my class file that is calling it yet eclipse still gives me an error that it cant be found: "Exception in thread "main" java.lang.Error: Unresolved compilation problem: Unhandled exception type FileNotFoundException" My code: package pa; import java.util.Scanner; public class Project { public static void main(String[] args) { java.io.File file = new java.io.File("input.txt"); System.out.println(file.getAbsolutePath()); Scanner input = new Scanner(file); } } input.txt is in the same package, same folder and everything. I'm confused :(

    Read the article

  • Why do I get a nullpointerexception at line ds.getPort in class L1?

    - by Fred
    import java.awt.; import java.awt.event.; import javax.swing.; import java.io.; import java.net.; import java.util.; public class Draw extends JFrame { /* * Socket stuff */ static String host; static int port; static int localport; DatagramSocket ds; Socket socket; Draw d; Paper p = new Paper(ds); public Draw(int localport, String host, int port) { d = this; this.localport = localport; this.host = host; this.port = port; try { ds = new DatagramSocket(localport); InetAddress ia = InetAddress.getByName(host); System.out.println("Attempting to connect DatagramSocket. Local port " + localport + " , foreign host " + host + ", foreign port " + port + "..."); ds.connect(ia, port); System.out.println("Success, ds.localport: " + ds.getLocalPort() + ", ds.port: " + ds.getPort() + ", address: " + ds.getInetAddress()); Reciever r = new Reciever(ds); r.start(); } catch (Exception e) { e.printStackTrace(); } setDefaultCloseOperation(EXIT_ON_CLOSE); getContentPane().add(p, BorderLayout.CENTER); setSize(640, 480); setVisible(true); } public static void main(String[] args) { int x = 0; for (String s : args){ if (x==0){ localport = Integer.parseInt(s); x++; } else if (x==1){ host = s; x++; } else if (x==2){ port = Integer.parseInt(s); } } Draw d = new Draw(localport, host, port); } } class Paper extends JPanel { DatagramSocket ds; private HashSet hs = new HashSet(); public Paper(DatagramSocket ds) { this.ds=ds; setBackground(Color.white); addMouseListener(new L1(ds)); addMouseMotionListener(new L2()); } public void paintComponent(Graphics g) { super.paintComponent(g); g.setColor(Color.black); Iterator i = hs.iterator(); while(i.hasNext()) { Point p = (Point)i.next(); g.fillOval(p.x, p.y, 2, 2); } } private void addPoint(Point p) { hs.add(p); repaint(); } class L1 extends MouseAdapter { DatagramSocket ds; public L1(DatagramSocket ds){ this.ds=ds; } public void mousePressed(MouseEvent me) { addPoint(me.getPoint()); Point p = me.getPoint(); String message = Integer.toString(p.x) + " " + Integer.toString(p.y); System.out.println(message); try{ byte[] data = message.getBytes("UTF-8"); //InetAddress ia = InetAddress.getByName(ds.host); String convertedMessage = new String(data, "UTF-8"); System.out.println("The converted string is " + convertedMessage); DatagramPacket dp = new DatagramPacket(data, data.length); System.out.println(ds.getPort()); //System.out.println(message); //System.out.println(ds.toString()); //ds.send(dp); /*System.out.println("2Sending a packet containing data: " +data +" to " + ia + ":" + d.port + "...");*/ } catch (Exception e){ e.printStackTrace(); } } } class L2 extends MouseMotionAdapter { public void mouseDragged(MouseEvent me) { addPoint(me.getPoint()); Point p = me.getPoint(); String message = Integer.toString(p.x) + " " + Integer.toString(p.y); //System.out.println(message); } } } class Reciever extends Thread{ DatagramSocket ds; byte[] buffer; Reciever(DatagramSocket ds){ this.ds = ds; buffer = new byte[65507]; } public void run(){ try { DatagramPacket packet = new DatagramPacket(buffer, buffer.length); while(true){ try { ds.receive(packet); String s = new String(packet.getData()); System.out.println(s); } catch (Exception e) { e.printStackTrace(); } } } catch (Exception e) { e.printStackTrace(); } } }

    Read the article

  • Loading embedded resource on Windows 7

    - by Flack
    Hello, I have an app that works just fine on my WinXP machine. However, when I try running it on my Win7 machine, it fails whenever it tries to load an embedded resource. The resources are all there (I can see them using Reflector). The lines that fail are all of the form: Splash.Image = new Bitmap(typeof(ContainerForm).Assembly.GetManifestResourceStream("SplashTest.Resources.Logo.gif")); And they all fail with the same exception: Exception='System.ArgumentException: Parameter is not valid. at System.Drawing.Bitmap..ctor(Stream stream) I don't understand why this is not working on my Win7 machine but does on my usual WinXP dev machine. Any ideas?

    Read the article

  • jQuery effect on iframe parent document

    - by Jabes88
    Just wondering if anyone else has experienced this or knows why I am getting an error. I'm using javascript from within an iframe to call a parent dom element then use jQuery UI's effect core to shake it. Here is an example: $(document).ready(function(){ if ($("form").length>0) { $("form").submit(function(){ var oParentDoc = $(parent.document).find("div#element"); var action = $(this).attr("action"); var postdata = $(this).serialize(); $(oParentDoc).addClass("loading"); $.post(action,postdata,function(data){ $(oParentDoc).removeClass("loading").effect("shake",{"times":3,"distance":10},60); }); return false; }); } }); It works without the effect, but when I use an effect it gives me this error: uncaught exception: [Exception... "Component returned failure code: 0x80040111 (NS_ERROR_NOT_AVAILABLE) [nsIDOMCSSStyleDeclaration.getPropertyValue]" nsresult: "0x80040111 (NS_ERROR_NOT_AVAILABLE)" Thanks in advance for any insight :)

    Read the article

  • Delphi7 - How can i copy a file that is being written to

    - by Simon
    I have an application that logs information to a daily text file every second on a master PC. A Slave PC on the network using the same application would like to copy this text file to its local drive. I can see there is going to be file access issues. These files should be no larger than 30-40MB each. the network will be 100MB ethernet. I can see there is potential for the copying process to take longer than 1 second meaning the logging PC will need to open the file for writing while it is being read. What is the best method for the file writing(logging) and file copying procedures? I know there is the standard Windows CopyFile() procedure, however this has given me file access problems. There is also TFileStream using the fmShareDenyNone flag, but this also very occasionally gives me an access problem too (like 1 per week). What is this the best way of accomplishing this task? My current File Logging: procedure FSWriteline(Filename,Header,s : String); var LogFile : TFileStream; line : String; begin if not FileExists(filename) then begin LogFile := TFileStream.Create(FileName, fmCreate or fmShareDenyNone); try LogFile.Seek(0,soFromEnd); line := Header + #13#10; LogFile.Write(line[1],Length(line)); line := s + #13#10; LogFile.Write(line[1],Length(line)); finally logfile.Free; end; end else begin line := s + #13#10; Logfile:=tfilestream.Create(Filename,fmOpenWrite or fmShareDenyNone); try logfile.Seek(0,soFromEnd); Logfile.Write(line[1], length(line)); finally Logfile.free; end; end; end; My file copy procedure: procedure DoCopy(infile, Outfile : String); begin ForceDirectories(ExtractFilePath(outfile)); //ensure folder exists if FileAge(inFile) = FileAge(OutFile) then Exit; //they are the same modified time try { Open existing destination } fo := TFileStream.Create(Outfile, fmOpenReadWrite or fmShareDenyNone); fo.Position := 0; except { otherwise Create destination } fo := TFileStream.Create(OutFile, fmCreate or fmShareDenyNone); end; try { open source } fi := TFileStream.Create(InFile, fmOpenRead or fmShareDenyNone); try cnt:= 0; fi.Position := cnt; max := fi.Size; {start copying } Repeat dod := BLOCKSIZE; // Block size if cnt+dod>max then dod := max-cnt; if dod>0 then did := fo.CopyFrom(fi, dod); cnt:=cnt+did; Percent := Round(Cnt/Max*100); until (dod=0) finally fi.free; end; finally fo.free; end; end;

    Read the article

  • Adding/removing session variables on Page OnInit/OnLoad in C#

    - by MKS
    Hi Guys, I am using C#. I am having below code in C#: protected override void OnInit(EventArgs e) { try { if (Session["boolSignOn"].ToString() == "true".ToString()) { lblPanelOpen.Text = Session["panelOpen"].ToString(); } else { lblPanelOpen.Text = Session["panelOpen"].ToString(); } } catch (Exception ex) { Logger.Error("Error processing request:" + ex.Message); } } protected override void OnLoad(EventArgs e) { try { if (!string.IsNullOrEmpty(Session["panelOpen"].ToString())) { lblPanelOpen.Text = string.Empty; Session.Remove("panelOpen"); } } catch (Exception ex) { Logger.Error("Unable to remove the session variable:" + ex.Message); } } In above code I am having a Session["panelOpen"] variable which is created from another user control and once my page is trying to render, I am storing Session["panelOpen"] in my hidden lblPanelOpen.Text on page OnInit() method, however when page is loaded completely then I am trying to remove the session variable. Please suggest!

    Read the article

< Previous Page | 222 223 224 225 226 227 228 229 230 231 232 233  | Next Page >