Search Results

Search found 23967 results on 959 pages for 'multiple languages'.

Page 226/959 | < Previous Page | 222 223 224 225 226 227 228 229 230 231 232 233  | Next Page >

  • using getScript to import plugin on page using multiple versions of jQuery

    - by mikez302
    I am developing an app on a page that uses jQuery 1.2.6, but I would like to use jQuery 1.4.2 for my app. I really don't like to use multiple versions of jQuery like this but the copy on the page (1.2.6) is something I have no control over. I decided to isolate my code like this: <!DOCTYPE HTML PUBLIC "-//W3C//DTD HTML 4.01 Transitional//EN" "http://www.w3.org/TR/html4/loose.dtd"> <html><head> <script type="text/javascript" src="jquery-1.2.6.min.js> <script type="text/javascript" src="pageStuff.js"> </head> <body> Welcome to our page. <div id="app"> <script type="text/javascript" src="http://ajax.googleapis.com/ajax/libs/jquery/1.4.2/jquery.js"></script> <script type="text/javascript" src="myStuff.js"> </div> </body></html> The file myStuff.js has my own code that is supposed to use jQuery 1.4.2, and it looks like this: (function($) { //wrap everything in function to add ability to use $ var with noConflict var jQuery = $; //my code })(jQuery.noConflict(true)); This is an extremely simplified version, but I hope you get the idea of what I did. For a while, everything worked fine. However, I decided to want to use a jQuery plugin in a separate file. I tested it and it acted funny. After some experimentation, I found out that the plugin was using the old version of jQuery, when I wanted it to use the new version. Does anyone know how to import and run a js file from the context within the function wrapping the code in myStuff.js? In case this matters to anyone, here is how I know the plugin is using the old version, and what I did to try to solve the problem: I made a file called test.js, consisting of this line: alert($.fn.jquery); I tried referencing the file in a script tag the way external Javascript is usually included, below myStuff.js, and it came up as 1.2.6, like I expected. I then got rid of that script tag and put this line in myStuff.js: $.getScript("test.js"); and it still came back as 1.2.6. That wasn't a big surprise -- according to jQuery's documentation, scripts included that way are executed in the global context. I then tried doing this instead: var testFn = $.proxy($.getScript, this); testFn("test.js"); and it still came back as 1.2.6. After some tinkering, I found out that the "this" keyword referred to the window, which I assume means the global context. I am looking for something to put in place of "this" to refer to the context of the enclosing function, or some other way to make the code in the file run from the enclosing function. I noticed that if I copy and paste the code, it works fine, but it is a big plugin that is used in many places, and I would prefer not to clutter up my file with their code. I am out of ideas. Does anyone else know how to do this?

    Read the article

  • Multiple data series in real time plot

    - by Gr3n
    Hi, I'm kind of new to Python and trying to create a plotting app for values read via RS232 from a sensor. I've managed (after some reading and copying examples online) to get a plot working that updates on a timer which is great. My only trouble is that I can't manage to get multiple data series into the same plot. Does anyone have a solution to this? This is the code that I've worked out this far: import os import pprint import random import sys import wx # The recommended way to use wx with mpl is with the WXAgg backend import matplotlib matplotlib.use('WXAgg') from matplotlib.figure import Figure from matplotlib.backends.backend_wxagg import FigureCanvasWxAgg as FigCanvas, NavigationToolbar2WxAgg as NavigationToolbar import numpy as np import pylab DATA_LENGTH = 100 REDRAW_TIMER_MS = 20 def getData(): return int(random.uniform(1000, 1020)) class GraphFrame(wx.Frame): # the main frame of the application def __init__(self): wx.Frame.__init__(self, None, -1, "Usart plotter", size=(800,600)) self.Centre() self.data = [] self.paused = False self.create_menu() self.create_status_bar() self.create_main_panel() self.redraw_timer = wx.Timer(self) self.Bind(wx.EVT_TIMER, self.on_redraw_timer, self.redraw_timer) self.redraw_timer.Start(REDRAW_TIMER_MS) def create_menu(self): self.menubar = wx.MenuBar() menu_file = wx.Menu() m_expt = menu_file.Append(-1, "&Save plot\tCtrl-S", "Save plot to file") self.Bind(wx.EVT_MENU, self.on_save_plot, m_expt) menu_file.AppendSeparator() m_exit = menu_file.Append(-1, "E&xit\tCtrl-X", "Exit") self.Bind(wx.EVT_MENU, self.on_exit, m_exit) self.menubar.Append(menu_file, "&File") self.SetMenuBar(self.menubar) def create_main_panel(self): self.panel = wx.Panel(self) self.init_plot() self.canvas = FigCanvas(self.panel, -1, self.fig) # pause button self.pause_button = wx.Button(self.panel, -1, "Pause") self.Bind(wx.EVT_BUTTON, self.on_pause_button, self.pause_button) self.Bind(wx.EVT_UPDATE_UI, self.on_update_pause_button, self.pause_button) self.hbox1 = wx.BoxSizer(wx.HORIZONTAL) self.hbox1.Add(self.pause_button, border=5, flag=wx.ALL | wx.ALIGN_CENTER_VERTICAL) self.vbox = wx.BoxSizer(wx.VERTICAL) self.vbox.Add(self.canvas, 1, flag=wx.LEFT | wx.TOP | wx.GROW) self.vbox.Add(self.hbox1, 0, flag=wx.ALIGN_LEFT | wx.TOP) self.panel.SetSizer(self.vbox) #self.vbox.Fit(self) def create_status_bar(self): self.statusbar = self.CreateStatusBar() def init_plot(self): self.dpi = 100 self.fig = Figure((3.0, 3.0), dpi=self.dpi) self.axes = self.fig.add_subplot(111) self.axes.set_axis_bgcolor('white') self.axes.set_title('Usart data', size=12) pylab.setp(self.axes.get_xticklabels(), fontsize=8) pylab.setp(self.axes.get_yticklabels(), fontsize=8) # plot the data as a line series, and save the reference # to the plotted line series # self.plot_data = self.axes.plot( self.data, linewidth=1, color="blue", )[0] def draw_plot(self): # redraws the plot xmax = len(self.data) if len(self.data) > DATA_LENGTH else DATA_LENGTH xmin = xmax - DATA_LENGTH ymin = 0 ymax = 4096 self.axes.set_xbound(lower=xmin, upper=xmax) self.axes.set_ybound(lower=ymin, upper=ymax) # enable grid #self.axes.grid(True, color='gray') # Using setp here is convenient, because get_xticklabels # returns a list over which one needs to explicitly # iterate, and setp already handles this. # pylab.setp(self.axes.get_xticklabels(), visible=True) self.plot_data.set_xdata(np.arange(len(self.data))) self.plot_data.set_ydata(np.array(self.data)) self.canvas.draw() def on_pause_button(self, event): self.paused = not self.paused def on_update_pause_button(self, event): label = "Resume" if self.paused else "Pause" self.pause_button.SetLabel(label) def on_save_plot(self, event): file_choices = "PNG (*.png)|*.png" dlg = wx.FileDialog( self, message="Save plot as...", defaultDir=os.getcwd(), defaultFile="plot.png", wildcard=file_choices, style=wx.SAVE) if dlg.ShowModal() == wx.ID_OK: path = dlg.GetPath() self.canvas.print_figure(path, dpi=self.dpi) self.flash_status_message("Saved to %s" % path) def on_redraw_timer(self, event): if not self.paused: newData = getData() self.data.append(newData) self.draw_plot() def on_exit(self, event): self.Destroy() def flash_status_message(self, msg, flash_len_ms=1500): self.statusbar.SetStatusText(msg) self.timeroff = wx.Timer(self) self.Bind( wx.EVT_TIMER, self.on_flash_status_off, self.timeroff) self.timeroff.Start(flash_len_ms, oneShot=True) def on_flash_status_off(self, event): self.statusbar.SetStatusText('') if __name__ == '__main__': app = wx.PySimpleApp() app.frame = GraphFrame() app.frame.Show() app.MainLoop()

    Read the article

  • Hover/Fadeto/Toggle Multiple Class Changing

    - by Slick Willis
    So my problem is rather simple and complex at the same time. I am trying to create links that fade in when you mouseover them and fade out when you mouseout of them. At the same time that you are going over them I would like a pic to slide from the left. This is the easy part, I have every thing working. The image fades and another image slides. I did this by using a hover, fadeto, and toggle("slide"). I would like to do this in a table format with multiple images being able to be scrolled over and sliding images out. The problem is that I am calling my sliding image to a class and when I hover over the letters both images slide out. Does anybody have a solution for this? I posted the code that I used below: <html> <head> <script type='text/javascript' src='http://accidentalwords.squarespace.com/storage/jquery/jquery-1.4.2.min.js'></script> <script type='text/javascript' src='http://accidentalwords.squarespace.com/storage/jquery/jquery-custom-181/jquery-ui-1.8.1.custom.min.js'></script> <style type="text/css"> .text-slide { display: none; margin: 0px; width: 167px; height: 50px; } </style> <script> $(document).ready(function(){ $(".letterbox-fade").fadeTo(1,0.25); $(".letterbox-fade").hover(function () { $(this).stop().fadeTo(250,1); $(".text-slide").toggle("slide", {}, 1000); }, function() { $(this).stop().fadeTo(250,0.25); $(".text-slide").toggle("slide", {}, 1000); }); }); </script> </head> <body style="background-color: #181818"> <table> <tr> <td><div class="letterbox-fade"><img src="http://accidentalwords.squarespace.com/storage/sidebar/icons/A-Letterbox-Selected.png" /></div></td> <td><div class="text-slide"><img src="http://accidentalwords.squarespace.com/storage/sidebar/icons/TEST.png" /></div></td> </tr> <tr> <td><div class="letterbox-fade"><img src="http://accidentalwords.squarespace.com/storage/sidebar/icons/B-Letterbox-Selected.png" /></div></td> <td><div class="text-slide"><img src="http://accidentalwords.squarespace.com/storage/sidebar/icons/TEST.png" /></div></td> </tr> </table> </body> </html>

    Read the article

  • opengl - Rendering multiple cubes

    - by opiop65
    I have this code (Doesn't work at all) static void initGl() { glViewport(0, 0, Display.getWidth(), Display.getHeight()); glMatrixMode(GL_PROJECTION); glLoadIdentity(); GLU.gluPerspective(45.0f, Display.getWidth() / Display.getHeight(), 1.0f, 1000.0f); glMatrixMode(GL_MODELVIEW); glLoadIdentity(); glClearColor(0.0f, 0.0f, 0.0f, 0.0f); glClearDepth(1.0f); glDepthFunc(GL_LEQUAL); glEnable(GL_DEPTH_TEST); glShadeModel(GL_SMOOTH); glHint(GL_PERSPECTIVE_CORRECTION_HINT, GL_NICEST); } public static void renderGL() { glViewport(0, 0, Display.getWidth(), Display.getHeight()); glClearColor(0.0f, 0.0f, 0.0f, 0.5f); glLoadIdentity(); glTranslatef(0.0f, 0.0f, -60.0f); drawCube(); } public static void drawCube() { for (int x = 0; x < 100; x++) { for (int y = 0; y < 100; y++) { for (int z = 0; z < 100; z++) { glBegin(GL_QUADS); glColor3f(1, 0, 0); glVertex3f(-x, -y, z); glVertex3f(x, -y, z); glVertex3f(x, y, z); glVertex3f(-x, y, z); glColor3f(1, 0, 1); glVertex3f(x, -y, -z); glVertex3f(-x, -y, -z); glVertex3f(-x, y, -z); glVertex3f(x, y, -z); glColor3f(1, 1, 1); glVertex3f(-x, y, z); glVertex3f(x, y, z); glVertex3f(x, y, -z); glVertex3f(-x, y, -z); glColor3f(0, 0, 1); glVertex3f(x, -y, z); glVertex3f(-x, -y, z); glVertex3f(-x, -y, -z); glVertex3f(x, -y, -z); glColor3f(1, 1, 0); glVertex3f(x, -y, z); glVertex3f(x, -y, -z); glVertex3f(x, y, -z); glVertex3f(x, y, z); glColor3f(0, 2, 1); glVertex3f(-x, -y, -z); glVertex3f(-x, -y, z); glVertex3f(-x, y, z); glVertex3f(-x, y, -z); glEnd(); } } } All it does it freeze up the program and eventually it will render the red side of the cube. This obviously has to do with gltranslatef, but I don't know why that isn't working. My question is, how do I render multiple cubes at once? Are there any tutorials out there on voxel engines? Sorry for the horrible code, I realize I probably need a array to do this. I'm quite new at opengl.

    Read the article

  • multiple timer to one process (without linking to rt)

    - by Richard
    Hi, is there any way to register multiple timer to a single process? I have tried following code, yet without success. (Use "gcc -lrt" to compile it...). Program output nothing, which should atleast print "test". Is it possibly due to the dependence to linking to rt? #define TT_SIGUSR1 (SIGRTMAX) #define TT_SIGUSR2 (SIGRTMAX - 1) #define TIME_INTERVAL_1 1 #define TIME_INTERVAL_2 2 #include <signal.h> #include <time.h> #include <stdio.h> #include <unistd.h> #include <linux/unistd.h> #include <sys/syscall.h> #include <sys/time.h> #include <sys/types.h> #include <sched.h> #include <signal.h> #include <setjmp.h> #include <errno.h> #include <assert.h> timer_t create_timer(int signo) { timer_t timerid; struct sigevent se; se.sigev_signo = signo; if (timer_create(CLOCK_REALTIME, &se, &timerid) == -1) { fprintf(stderr, "Failed to create timer\n"); exit(-1); } return timerid; } void set_timer(timer_t timerid, int seconds) { struct itimerspec timervals; timervals.it_value.tv_sec = seconds; timervals.it_value.tv_nsec = 0; timervals.it_interval.tv_sec = seconds; timervals.it_interval.tv_nsec = 0; if (timer_settime(timerid, 0, &timervals, NULL) == -1) { fprintf(stderr, "Failed to start timer\n"); exit(-1); } return; } void install_sighandler2(int signo, void(*handler)(int)) { struct sigaction sigact; sigemptyset(&sigact.sa_mask); sigact.sa_flags = SA_SIGINFO; //register the Signal Handler sigact.sa_sigaction = handler; // Set up sigaction to catch signal first timer if (sigaction(signo, &sigact, NULL) == -1) { printf("sigaction failed"); return -1; } } void install_sighandler(int signo, void(*handler)(int)) { sigset_t set; struct sigaction act; /* Setup the handler */ act.sa_handler = handler; act.sa_flags = SA_RESTART; sigaction(signo, &act, 0); /* Unblock the signal */ sigemptyset(&set); sigaddset(&set, signo); sigprocmask(SIG_UNBLOCK, &set, NULL); return; } void signal_handler(int signo) { printf("receiving sig %d", signo); } int main() { printf("test"); timer_t timer1 = create_timer(TT_SIGUSR1); timer_t timer2 = create_timer(TT_SIGUSR2); set_timer(timer1, TIME_INTERVAL_1); set_timer(timer2, TIME_INTERVAL_2); install_sighandler2(TT_SIGUSR1, signal_handler); install_sighandler(TT_SIGUSR2, signal_handler); while (1) ; return 0; }

    Read the article

  • Get Two row with multiple column in asp.net c#

    - by Gaurav Naik
    How to get data from database with two rows and multiple column with seperator will be there after the 1 row end as an example: <div class="_thum_bar"> <div class="box1"> <div class="_t1_box"><a href="#!/condom_details"><img src="images/pack/pack1.png" border="0"></a></div> <div class="_t2_box"> <h1>Dotted Condom</h1> <p>Dotted condoms for additional friction. Pure ecstasy makes this a KamaSutra all time favourite.</p> <h2><a href="#!/condom_details">Add to cart</a></h2> </div> </div> <div class="box2"> <div class="_t1_box"><a href="#!/condom_details"><img src="images/pack/pack1.png" border="0"></a></div> <div class="_t2_box"> <h1>Dotted Condom</h1> <p>Dotted condoms for additional friction. Pure ecstasy makes this a KamaSutra all time favourite.</p> <h2><a href="#!/condom_details">Add to cart</a></h2> </div> </div> <div class="box3"> <div class="_t1_box"><a href="#"><img src="images/pack/pack1.png" border="0"></a></div> <div class="_t2_box"> <h1>Dotted Condom</h1> <p>Dotted condoms for additional friction. Pure ecstasy makes this a KamaSutra all time favourite.</p> <h2><a href="#!/condom_details">Add to cart</a></h2> </div> </div> </div> <div class="_t_spacer">&nbsp;</div> <div class="_thum_bar"> <div class="box1"> <div class="_t1_box"><a href="#!/condom_details"><img src="images/pack/pack1.png" border="0"></a></div> <div class="_t2_box"> <h1>Dotted Condom</h1> <p>Dotted condoms for additional friction. Pure ecstasy makes this a KamaSutra all time favourite.</p> <h2><a href="#!/condom_details">Add to cart</a></h2> </div> </div> <div class="box2"> <div class="_t1_box"><a href="#!/condom_details"><img src="images/pack/pack1.png" border="0"></a></div> <div class="_t2_box"> <h1>Dotted Condom</h1> <p>Dotted condoms for additional friction. Pure ecstasy makes this a KamaSutra all time favourite.</p> <h2><a href="#!/condom_details">Add to cart</a></h2> </div> </div> </div> <div class="_t_spacer">&nbsp;</div>

    Read the article

  • PHP-How to Pass Multiple Value In Form Field

    - by Tall boY
    hi i have a php based sorting method with drop down menu to sort no of rows, it is working fine. i have another sorting links to sort id & title, it is also working fine. but together they are not working fine. what happens is that when i sort(say by title) using links, result gets sorted by title, then if i sort rows using drop down menu rows get sorted but result gets back to default of id sort. sorting codes for id & tite is if ($orderby == 'title' && $sortby == 'asc') {echo " <li id='scurrent'><a href='?rpp=$rowsperpage&order=title&sort=asc'>title-asc:</a></li> ";} else {echo " <li><a href='?rpp=$rowsperpage&order=title&sort=asc'>title-asc:</a></li> ";} if ($orderby == 'title' && $sortby == 'desc') {echo " <li id='scurrent'><a href='?rpp=$rowsperpage&order=title&sort=desc'>title-desc:</a></li> ";} else {echo " <li><a href='?rpp=$rowsperpage&order=title&sort=desc'>title-desc:</a></li> ";} if ($orderby == 'id' && $sortby == 'asc') {echo " <li id='scurrent'><a href='?rpp=$rowsperpage&order=id&sort=asc'>id-asc:</a></li> ";} else {echo " <li><a href='?rpp=$rowsperpage&order=id&sort=asc'>id-asc:</a></li> ";} if ($orderby == 'id' && $sortby == 'desc') {echo " <li id='scurrent'><a href='?rpp=$rowsperpage&order=id&sort=desc'>id-desc:</a></li> ";} else {echo " <li><a href='?rpp=$rowsperpage&order=id&sort=desc'>id-desc:</a></li> ";} ?> sorting codes for rows is <form action="is-test.php" method="get"> <select name="rpp" onchange="this.form.submit()"> <option value="10" <?php if ($rowsperpage == 10) echo 'selected="selected"' ?>>10</option> <option value="20" <?php if ($rowsperpage == 20) echo 'selected="selected"' ?>>20</option> <option value="30" <?php if ($rowsperpage == 30) echo 'selected="selected"' ?>>30</option> </select> </form> this method passes only rows per page(rpp) into url. i want it to pass order, sort& rpp. is there a way around to pass multiple values in form fields like this. <form action="is-test.php" method="get"> <select name="rpp, order, sort" onchange="this.form.submit()"> <option value="10, $orderby, $sortby" <?php if ($rowsperpage == 10) echo 'selected="selected"' ?>>10</option> <option value="20, $orderby, $sortby" <?php if ($rowsperpage == 20) echo 'selected="selected"' ?>>20</option> <option value="30, $orderby, $sortby" <?php if ($rowsperpage == 30) echo 'selected="selected"' ?>>30</option> </select> </form> this may seem silly but it just to give you an idea of what i am trying to implement,(i am very new to php) please suggest any way to make this work. thanks

    Read the article

  • NoMethodError Rails multiple file uploads

    - by Danny McClelland
    Hi Everyone, I am working on getting multiple file uploads working for an model in my application, I have included the code below: delivers_controller.rb # POST /delivers def create @deliver = Deliver.new(params[:deliver]) process_file_uploads(@deliver) if @deliver.save flash[:notice] = 'Task was successfully created.' redirect_to(@deliver) else render :action => "new" end end protected def process_file_uploads(deliver) i = 0 while params[:attachment]['file_'+i.to_s] != "" && !params[:attachment]['file_'+i.to_s].nil? deliver.assets.build(:data => params[:attachment]['file_'+i.to_s]) i += 1 end end deliver.rb has_many :assets, :as => :attachable, :dependent => :destroy validate :validate_attachments Max_Attachments = 5 Max_Attachment_Size = 5.megabyte def validate_attachments errors.add_to_base("Too many attachments - maximum is #{Max_Attachments}") if assets.length > Max_Attachments assets.each {|a| errors.add_to_base("#{a.name} is over #{Max_Attachment_Size/1.megabyte}MB") if a.file_size > Max_Attachment_Size} end assets_controller.rb class AssetsController < ApplicationController def show asset = Asset.find(params[:id]) # do security check here send_file asset.data.path, :type => asset.data_content_type end def destroy asset = Asset.find(params[:id]) @asset_id = asset.id.to_s @allowed = Deliver::Max_Attachments - asset.attachable.assets.count asset.destroy end end asset.rb class Asset < ActiveRecord::Base has_attached_file :data, belongs_to :attachable, :polymorphic => true def url(*args) data.url(*args) end def name data_file_name end def content_type data_content_type end def file_size data_file_size end end Whenever I create a new deliver item and try to attach any files I get the following error: NoMethodError in DeliversController#create You have a nil object when you didn't expect it! You might have expected an instance of ActiveRecord::Base. The error occurred while evaluating nil.[] /Users/danny/Dropbox/SVN/railsapps/macandco/surveymanager/trunk/app/controllers/delivers_controller.rb:60:in `process_file_uploads' /Users/danny/Dropbox/SVN/railsapps/macandco/surveymanager/trunk/app/controllers/delivers_controller.rb:46:in `create' new.html.erb (Deliver view) <% content_for :header do -%> Deliver Repositories <% end -%> <% form_for(@deliver, :html => { :multipart => true }) do |f| %> <%= f.error_messages %> <p> <%= f.label :caseref %><br /> <%= f.text_field :caseref %> </p> <p> <%= f.label :casesubject %><br /> <%= f.text_area :casesubject %> </p> <p> <%= f.label :description %><br /> <%= f.text_area :description %> </p> <p>Pending Attachments: (Max of <%= Deliver::Max_Attachments %> each under <%= Deliver::Max_Attachment_Size/1.megabyte%>MB) <% if @deliver.assets.count >= Deliver::Max_Attachments %> <input id="newfile_data" type="file" disabled /> <% else %> <input id="newfile_data" type="file" /> <% end %> <div id="attachment_list"><ul id="pending_files"></ul></div> </p> <p> <%= f.submit 'Create' %> </p> <% end %> <%= link_to 'Back', delivers_path %> Show.html.erb (Delivers view) <% content_for :header do -%> Deliver Repositories <% end -%> <p> <b>Title:</b> <%=h @deliver.caseref %> </p> <p> <b>Body:</b> <%=h @deliver.casesubject %> </p> <p><b>Attached Files:</b><div id="attachment_list"><%= render :partial => "attachment", :collection => @deliver.assets %></div></p> <%= link_to 'Edit', edit_deliver_path(@deliver) %> | <%= link_to 'Back', deliver_path %> <%- if logged_in? %> <%= link_to 'Edit', edit_deliver_path(@deliver) %> | <%= link_to 'Back', delivers_path %> <% end %> _attachment.html.erb (Delivers view) <% if !attachment.id.nil? %><li id='attachment_<%=attachment.id %>'><a href='<%=attachment.url %>'><%=attachment.name %></a> (<%=attachment.file_size/1.kilobyte %>KB) <%= link_to_remote "Remove", :url => asset_path(:id => attachment), :method => :delete, :html => { :title => "Remove this attachment", :id => "remove" } %></li> <% end %> I have been banging my head against the wall with the error all day, if anyone can shed some light on it, I would be eternally grateful! Thanks, Danny

    Read the article

  • How to publish multiple jar files to maven on a clean install

    - by Abhijit Hukkeri
    I have a used the maven assembly plugin to create multiple jar from one jar now the problem is that I have to publish these jar to the local repo, just like other maven jars publish by them self when they are built maven clean install how will I be able to do this here is my pom file <project> <parent> <groupId>parent.common.bundles</groupId> <version>1.0</version> <artifactId>child-bundle</artifactId> </parent> <modelVersion>4.0.0</modelVersion> <groupId>common.dataobject</groupId> <artifactId>common-dataobject</artifactId> <packaging>jar</packaging> <name>common-dataobject</name> <version>1.0</version> <dependencies> </dependencies> <build> <plugins> <plugin> <groupId>org.jibx</groupId> <artifactId>maven-jibx-plugin</artifactId> <version>1.2.1</version> <configuration> <directory>src/main/resources/jibx_mapping</directory> <includes> <includes>binding.xml</includes> </includes> <verbose>false</verbose> </configuration> <executions> <execution> <goals> <goal>bind</goal> </goals> </execution> </executions> </plugin> <plugin> <artifactId>maven-assembly-plugin</artifactId> <executions> <execution> <id>make-business-assembly</id> <phase>package</phase> <goals> <goal>single</goal> </goals> <configuration> <appendAssemblyId>false</appendAssemblyId> <finalName>flight-dto</finalName> <descriptors> <descriptor>src/main/assembly/car-assembly.xml</descriptor> </descriptors> <attach>true</attach> </configuration> </execution> <execution> <id>make-gui-assembly</id> <phase>package</phase> <goals> <goal>single</goal> </goals> <configuration> <appendAssemblyId>false</appendAssemblyId> <finalName>app_gui</finalName> <descriptors> <descriptor>src/main/assembly/bike-assembly.xml</descriptor> </descriptors> <attach>true</attach> </configuration> </execution> </executions> </plugin> </plugins> </build> </project> Here is my assembly file <assembly> <id>app_business</id> <formats> <format>jar</format> </formats> <baseDirectory>target</baseDirectory> <includeBaseDirectory>false</includeBaseDirectory> <fileSets> <fileSet> <directory>${project.build.outputDirectory}</directory> <outputDirectory></outputDirectory> <includes> <include>com/dataobjects/**</include> </includes> </fileSet> </fileSets> </assembly>

    Read the article

  • How to generate Function caller graphs for other languages?

    - by Jeremy Rudd
    I like the way Doxygen combines with Graphviz dot to generate function caller graphs. I'd like this functionality for other languages as well, apart from the basics that Doxygen supports (C++, C, Java, Objective-C, Python, VHDL, PHP, C#). I'm currently interested in JavaScript, ActionScript 2 and ActionScript 3/Flex but am looking for ways or tools that have a wider language support than Doxygen. Is there any way to get function caller graphs for any other languages?

    Read the article

  • Searching a set of data with multiple terms using Linq

    - by Cj Anderson
    I'm in the process of moving from ADO.NET to Linq. The application is a directory search program to look people up. The users are allowed to type the search criteria into a single textbox. They can separate each term with a space, or wrap a phrase in quotes such as "park place" to indicate that it is one term. Behind the scenes the data comes from a XML file that has about 90,000 records in it and is about 65 megs. I load the data into a DataTable and then use the .Select method with a SQL query to perform the searches. The query I pass is built from the search terms the user passed. I split the string from the textbox into an array using a regular expression that will split everything into a separate element that has a space in it. However if there are quotes around a phrase, that becomes it's own element in the array. I then end up with a single dimension array with x number of elements, which I iterate over to build a long query. I then build the search expression below: query = query & _ "((userid LIKE '" & tempstr & "%') OR " & _ "(nickname LIKE '" & tempstr & "%') OR " & _ "(lastname LIKE '" & tempstr & "%') OR " & _ "(firstname LIKE '" & tempstr & "%') OR " & _ "(department LIKE '" & tempstr & "%') OR " & _ "(telephoneNumber LIKE '" & tempstr & "%') OR " & _ "(email LIKE '" & tempstr & "%') OR " & _ "(Office LIKE '" & tempstr & "%'))" Each term will have a set of the above query. If there is more than one term, I put an AND in between, and build another query like above with the next term. I'm not sure how to do this in Linq. So far, I've got the XML file loading correctly. I'm able to search it with specific criteria, but I'm not sure how to best implement the search over multiple terms. 'this works but far too simple to get the job done Dim results = From c In m_DataSet...<Users> _ Where c.<userid>.Value = "XXXX" _ Select c The above code also doesn't use the LIKE operator either. So partial matches don't work. It looks like what I'd want to use is the .Startswith but that appears to be only in Linq2SQL. Any guidance would be appreciated. I'm new to Linq, so I might be missing a simple way to do this. The XML file looks like so: <?xml version="1.0" standalone="yes"?> <theusers> <Users> <userid>person1</userid> <nickname></nickname> <lastname></lastname> <firstname></firstname> <department></department> <telephoneNumber></telephoneNumber> <email></email> </Users> <Users> <userid>person2</userid> <nickname></nickname> <lastname></lastname> <firstname></firstname> <department></department> <telephoneNumber></telephoneNumber> <email></email> </Users>

    Read the article

  • Multiple schema validation in Java

    - by user279554
    Hi, I am trying to do multiple schema validation in Java. I don't understand where I am doing wrong. Any help will be appreciated. abc.xsd <?xml version="1.0" encoding="UTF-8"?> <xsd:schema xmlns:xsd="http://www.w3.org/2001/XMLSchema" xmlns:xn="project-xml-r4j_another.xsd"> <xsd:import namespace="project-xml-r4j_another.xsd"/> <xsd:element name="abc" type="abc"> </xsd:element> <xsd:complexType name="abc"> <xsd:sequence> <xsd:element name="test" type="test" minOccurs="0" maxOccurs="1"> </xsd:element> <!--<xsd:element name="proj" type="xn:proj"/>--> </xsd:sequence> <xsd:attribute name="id" type="xsd:ID" use="required"/> </xsd:complexType> <xsd:complexType name="test"> <xsd:attribute name="id" type="xsd:ID" use="required"></xsd:attribute> <xsd:attribute name="value" use="required"> <xsd:simpleType> <xsd:restriction base="xsd:string"> <xsd:maxLength value="100" /> </xsd:restriction> </xsd:simpleType> </xsd:attribute> </xsd:complexType> </xsd:schema> project-xml-r4j_another.xsd <?xml version="1.0" encoding="UTF-8"?> <xsd:schema xmlns:xsd="http://www.w3.org/2001/XMLSchema" targetNamespace="project-xml-r4j_another.xsd" xmlns="project-xml-r4j_another.xsd" elementFormDefault="qualified" attributeFormDefault="unqualified"> <xsd:element name="proj" type="proj"> <xsd:annotation> <xsd:documentation> The project is the root tag of a project-xml. </xsd:documentation> </xsd:annotation> </xsd:element> <xsd:complexType name="proj"> <xsd:attribute name="id" type="xsd:ID" use="required"/> </xsd:complexType> </xsd:schema> Test case package test; import java.io.File; import java.io.IOException; import javax.xml.XMLConstants; import javax.xml.transform.Source; import javax.xml.transform.stream.StreamSource; import javax.xml.validation.Schema; import javax.xml.validation.SchemaFactory; import javax.xml.validation.Validator; import org.apache.log4j.Logger; import org.junit.Test; import org.xml.sax.SAXException; import org.xml.sax.SAXParseException; import org.xml.sax.helpers.DefaultHandler; import com.ericsson.ccrtool.core.project.projectxml.InvalidProjectXmlException; public class TestSchema { private static final Logger logger = Logger.getLogger(TestSchema.class); static final String W3C_XML_SCHEMA = XMLConstants.W3C_XML_SCHEMA_NS_URI; @Test public void test() { System.out.println("TestSchema.test()"); try { SchemaFactory schemaFactory = SchemaFactory.newInstance(W3C_XML_SCHEMA); // create a grammar object. Source [] source = { new StreamSource(new File("C:\\jaydeep\\Ericsson\\R5B\\abc.xsd")), new StreamSource(new File("C:\\jaydeep\\Ericsson\\R5B\\project-xml-r4j.xsd"))}; Schema schemaGrammar = schemaFactory.newSchema(source); Validator schemaValidator = schemaGrammar.newValidator(); schemaValidator.setErrorHandler(new MessageHandler()); // validate xml instance against the grammar. schemaValidator.validate(new StreamSource("C:\\jaydeep\\Ericsson\\R5B\\project_tmmk17cells_xnaveen_project-xml.xml")); } catch (SAXException e) { throw new InvalidProjectXmlException("Project-xml validation failed, Exception: " + e.getMessage(), e); } catch (IOException e) { throw new InvalidProjectXmlException("Project-xml validation failed, Exception: " + e.getMessage(), e); } } class MessageHandler extends DefaultHandler { private String errMessage = ""; @Override public void warning(SAXParseException e) { logger.info("Warning Line " + e.getLineNumber() + ": " + e.getMessage()); } @Override public void error(SAXParseException e) { errMessage = new String("Error Line " + e.getLineNumber() + ": " + e.getMessage()); logger.info(errMessage); throw new InvalidProjectXmlException("Project-xml validation failed, Exception: " + errMessage); } @Override public void fatalError(SAXParseException e) { errMessage = new String("Error Line " + e.getLineNumber() + ": " + e.getMessage()); logger.info(errMessage); throw new InvalidProjectXmlException("Project-xml validation failed, Exception: " + errMessage); } } } Thanks, Jaydeep

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • What is a good platform for building a game framework targetting both web and native languages?

    - by fuzzyTew
    I would like to develop (or find, if one is already in development) a framework with support for accelerated graphics and sound built on a system flexible enough to compile to the following: native ppc/x86/x86_64/arm binaries or a language which compiles to them javascript actionscript bytecode or a language which compiles to it (actionscript 3, haxe) optionally java I imagine, for example, creating an API where I can open windows and make OpenGL-like calls and the framework maps this in a relatively efficient manner to either WebGL with a canvas object, 3d graphics in Flash, OpenGL ES 2 with EGL, or desktop OpenGL in an X11, Windows, or Cocoa window. I have so far looked into these avenues: Building the game library in haXe Pros: Targets exist for php, javascript, actionscript bytecode, c++ High level, object oriented language Cons: No support for finally{} blocks or destructors, making resource cleanup difficult C++ target does not allow room for producing highly optimized libraries -- the foreign function interface requires all primitive types be boxed in a wrapper object, as if writing bindings for a scripting language; these feel unideal for real-time graphics and audio, especially exporting low-level functions. Doesn't seem quite yet mature Using the C preprocessor to create a translator, writing programs entirely with macros Pros: CPP is widespread and simple to use Cons: This is an arduous task and probably the wrong tool for the job CPP implementations differ widely in support for features (e.g. xcode cpp has no variadic macros despite claiming C99 compliance) There is little-to-no room for optimization in this route Using llvm's support for multiple backends to target c/c++ to web languages Pros: Can code in c/c++ LLVM is a very mature highly optimizing compiler performing e.g. global inlining Targets exist for actionscript (alchemy) and javascript (emscripten) Cons: Actionscript target is closed source, unmaintained, and buggy. Javascript targets do not use features of HTML5 for appropriate optimization (e.g. linear memory with typed arrays) and are immature An LLVM target must convert from low-level bytecode, so high-level constructs are lost and bloated unreadable code is created from translating individual instructions, which may be more difficult for an unprepared JIT to optimize. "jump" instructions cause problems for languages with no "goto" statements. Using libclang to write a translator from C/C++ to web languages Pros: A beautiful parsing library providing easy access to the code structure Can code in C/C++ Has sponsored developer effort from Apple Cons: Incomplete; current feature set targets IDEs. Basic operators are unexposed and must be manually parsed from the returned AST element to be identified. Translating code prior to compilation may forgo optimizations assumed in c/c++ such as inlining. Creating new code generators for clang to translate into web languages Pros: Can code in C/C++ as libclang Cons: There is no API; code structure is unstable A much larger job than using libclang; the innards of clang are complex Building the game library in Common Lisp Pros: Flexible, ancient, well-developed language Extensive introspection should ease writing translators Translators exist for at least javascript Cons: Unfamiliar language No standardized library functions, widely varying implementations Which of these avenues should I pursue? Do you know of any others, or any systems that might be useful? Does a general project like this exist somewhere already? Thank you for any input.

    Read the article

  • Android Multiple objects in SimpleAdapter

    - by Adam Sherratt
    I have a need (unless you can think of a better way) of passing multiple objects to a custom list adapter. I know that I'm barking up the wrong tree here, and would appreciate someone setting me on the right course! Thanks playlistadapter = new MyPlaylistAdapter(MyApplication.getAppContext(), songsList, retained_songsList, folderMode, R.layout.file_view, new String[] { "songTitle","songAlbum", "songPath" }, new int[] { R.id.checkTextView, R.id.text2, R.id.text3 }); And my adapter class: public class MyPlaylistAdapter extends SimpleAdapter{ private ArrayList <Song> songsList = new ArrayList<Song>(); private ArrayList <Song> retained_songsList = new ArrayList<Song>(); private ArrayList<Song> playlistcheck = new ArrayList<Song>(); private String folderMode; private String TAG = "AndroidMediaCenter"; public MyPlaylistAdapter(Context context,List<Song> SongsList, List<Song> Retained_songsList, String FolderMode,int resource, String[] from, int[] to) { super(context, null, resource, from, to); songsList.clear(); songsList.addAll(SongsList); Log.i(TAG, "MyPlayListAdapter Songslist = " + songsList.size()); retained_songsList.clear(); retained_songsList.addAll(Retained_songsList); folderMode = FolderMode; } public View getView(int position, View convertView, ViewGroup parent) { //PlayListViewHolder holder; CheckedTextView checkTextView; TextView text2; TextView text3; if (convertView == null) { LayoutInflater inflater = (LayoutInflater) MyApplication.getAppContext().getSystemService(Context.LAYOUT_INFLATER_SERVICE); //LayoutInflater inflater=getLayoutInflater(); convertView=inflater.inflate(R.layout.file_view, parent, false); //convertView.setBackgroundColor(0xFF00FF00 ); //holder = new PlayListViewHolder(); checkTextView = (CheckedTextView) convertView.findViewById(R.id.checkTextView); text2 = (TextView) convertView.findViewById(R.id.text2); text3 = (TextView) convertView.findViewById(R.id.text3); //convertView.setTag(holder); } else { //holder = (PlayListViewHolder) convertView.getTag(); } //put something into textviews String tracks = null; String tracks_Details = null; String trackspath = null; tracks = songsList.get(position).getSongTitle(); tracks_Details = songsList.get(position).getAlbum() + " (" + songsList.get(position).getArtist() + ")"; trackspath = songsList.get(position).getSongPath(); checkTextView = (CheckedTextView) convertView.findViewById(R.id.checkTextView); text2 = (TextView) convertView.findViewById(R.id.text2); text3 = (TextView) convertView.findViewById(R.id.text3); checkTextView.setText(tracks); if(folderMode.equals("Playlists")){ checkTextView.setBackgroundColor(Color.GREEN); checkTextView.setChecked(false); try { int listsize_rs = retained_songsList.size(); for (int j = 0; j<listsize_rs;j++){ if((retained_songsList.get(j).getSongPath()).equals(songsList.get(position).getSongPath())){ checkTextView.setBackgroundColor(Color.TRANSPARENT); //Need to check here whether the checkedtextview is ticked or not checkTextView.setChecked(true); playlistcheck.add(songsList.get(position)); break; } } } catch (Exception e) { e.printStackTrace(); } }else { //Need to check here whether the checkedtextview is ticked or not try { if (songsList.get(position).getSongCheckedStatus()==true){ checkTextView.setChecked(true); }else{ checkTextView.setChecked(false); } } catch (Exception e) { e.printStackTrace(); } } text2.setText(tracks_Details); text3.setText(trackspath); Log.i(TAG, "MyPlayListAdapter Songslist = " + songsList.size()); return convertView; } } However, this doesn't inflate, throwing the following errors: 10-26 23:11:09.464: E/AndroidRuntime(2826): FATAL EXCEPTION: main 10-26 23:11:09.464: E/AndroidRuntime(2826): java.lang.RuntimeException: Error receiving broadcast Intent { act=android.intent.action.GetMusicComplete flg=0x10 } in com.Nmidia.AMC.MusicActivity$18@414c5770 10-26 23:11:09.464: E/AndroidRuntime(2826): at android.app.LoadedApk$ReceiverDispatcher$Args.run(LoadedApk.java:765) 10-26 23:11:09.464: E/AndroidRuntime(2826): at android.os.Handler.handleCallback(Handler.java:615) 10-26 23:11:09.464: E/AndroidRuntime(2826): at android.os.Handler.dispatchMessage(Handler.java:92) 10-26 23:11:09.464: E/AndroidRuntime(2826): at android.os.Looper.loop(Looper.java:137) 10-26 23:11:09.464: E/AndroidRuntime(2826): at android.app.ActivityThread.main(ActivityThread.java:4745) 10-26 23:11:09.464: E/AndroidRuntime(2826): at java.lang.reflect.Method.invokeNative(Native Method) 10-26 23:11:09.464: E/AndroidRuntime(2826): at java.lang.reflect.Method.invoke(Method.java:511) 10-26 23:11:09.464: E/AndroidRuntime(2826): at com.android.internal.os.ZygoteInit$MethodAndArgsCaller.run(ZygoteInit.java:786) 10-26 23:11:09.464: E/AndroidRuntime(2826): at com.android.internal.os.ZygoteInit.main(ZygoteInit.java:553) 10-26 23:11:09.464: E/AndroidRuntime(2826): at dalvik.system.NativeStart.main(Native Method) 10-26 23:11:09.464: E/AndroidRuntime(2826): Caused by: java.lang.NullPointerException 10-26 23:11:09.464: E/AndroidRuntime(2826): at android.widget.SimpleAdapter.getCount(SimpleAdapter.java:93) 10-26 23:11:09.464: E/AndroidRuntime(2826): at android.widget.ListView.setAdapter(ListView.java:460) 10-26 23:11:09.464: E/AndroidRuntime(2826): at com.Nmidia.AMC.MusicActivity.setFilterMusic(MusicActivity.java:1230) 10-26 23:11:09.464: E/AndroidRuntime(2826): at com.Nmidia.AMC.MusicActivity$18.onReceive(MusicActivity.java:996) 10-26 23:11:09.464: E/AndroidRuntime(2826): at android.app.LoadedApk$ReceiverDispatcher$Args.run(LoadedApk.java:755) 10-26 23:11:09.464: E/AndroidRuntime(2826): ... 9 more

    Read the article

  • How can I use curl to login multiple users from one php script

    - by kamal
    Here is the scenario: I have configured multiple users with login names aa1, aa2 .. zz99 , all with the same password, now i want to login to a php based server with these login ID's. I have a working script that logs in one user with a username and password, and using curl, browses to a target page: // Assume php , since somehow the php encapsulation quotes were giving me trouble $sHost = $argv[2]; $sStart = $argv[3]; $sReqId = $argv[4]; $sPage = $argv[5]; $sReqLogFile = $argv[6]; $sRespLogFile = $argv[7]; $sUserName = $argv[8]; $sPassword = $argv[9]; $sExecDelay = $argv[10]; //optional args: if($argc 11) { $sCommonSID = $argv[11]; } //$sXhprofLogFile = ""; $sSysStatsLogFile= ""; $sBaseUrl = 'https://'.$sHost.'/'; $nExecTime = 0; $sCookieFileName = 'cookiejar/'.genRandomString().'.txt'; touch($sCookieFileName); // Set the execution delay: $sStart += $sExecDelay; // Get the PHP Session Id: if(isset($sCommonSID)) { $sSID = $sCommonSID; }else{ $sSID = getSID($sHost,$sBaseUrl, $sUserName, $sPassword); } // Sleep for 100us intervals until we reach the stated execution time: do { usleep(100); }while(getFullMicrotime()$sPage, "pageUrl"=$sBaseUrl, "execStart" =$nExecStart, "execEnd"=$nExecEnd, "respTime"=$nExecTime, "xhprofToken"=$sXhpToken, "xhprofLink"=$sXhpLink, "fiveMinLoad"=$nFiveMinLoad); }else{ $nExecStart = 0; $sUrl = "***ERROR***"; $aReturn = null; } writeReqLog($sReqId, $nExecStart, $sSID, $sUrl, $sReqLogFile); return $aReturn; } function getFullMicrotime() { $fMtime = microtime(true); if(strpos($fMtime, ' ') !== false) { list($nUsec, $nSec) = explode(' ', $fMtime); return $nSec + $nUsec; } return $fMtime; } function writeRespLog($nReqId, $sHost, $sPage, $sSID = "***ERROR***", $nExecStart = 0, $nExecEnd = 0, $nRespTime = 0, $sXhpToken = "", $sXhpLink = "", $nFiveMinLoad = 0, $sRespLogFile) { $sMsg = $nReqId; $sMsg .= "\t".$sHost; $sMsg .= "/".$sPage; $sMsg .= "\t".$sSID; $sMsg .= "\t".$nExecStart; $sMsg .= "\t".$nExecEnd; $sMsg .= "\t".$nRespTime; $sMsg .= "\t".$sXhpToken; $sMsg .= "\t".$nFiveMinLoad; error_log($sMsg."\n",3,$sRespLogFile); } function writeReqLog($nReqId, $nExecStart, $sSID, $sUrl, $sReqLogFile) { $sMsg = $nReqId; $sMsg .= "\t".$sUrl; $sMsg .= "\t".$sSID; $sMsg .= "\t".$nExecStart; error_log($sMsg."\n",3,$sReqLogFile); } function parseSIDValue($sText) { $sSID = ""; preg_match('/SID:(.*)/',$sText, $aSID); if (count($aSID)) { $sSID = $aSID[1]; } return $sSID; } function parseFiveMinLoad($sText) { $nLoad = 0; $aMatch = array(); preg_match('/--5-MIN-LOAD:(.*)--/',$sText, $aMatch); if (count($aMatch)) { $nLoad = $aMatch[1]; } return $nLoad; } function curlRequest($sUrl, $sSID="") { global $sCookieFileName; $ch = curl_init(); curl_setopt($ch, CURLOPT_URL, $sUrl); curl_setopt($ch, CURLOPT_SSL_VERIFYPEER, FALSE); curl_setopt($ch, CURLOPT_SSL_VERIFYHOST, 2); curl_setopt($ch, CURLOPT_HEADER, 1); curl_setopt($ch, CURLOPT_USERAGENT, "Mozilla/4.0 (compatible; MSIE 6.0; Windows NT 5.0)"); curl_setopt($ch, CURLOPT_RETURNTRANSFER,1); if($sSID == "") { curl_setopt($ch, CURLOPT_COOKIEJAR, $sCookieFileName); } else { curl_setopt($ch, CURLOPT_COOKIEFILE, $sCookieFileName); } $result =curl_exec ($ch); curl_close ($ch); return $result; } function parseXHProfToken($sPageContent) { //https://ktest.server.net/xhprof/xhprof_html/index.php?run=4d004b280a990&source=mybox $sToken = ""; $sRelLink = ""; $aMatch = array(); $aResp = array(); preg_match('/$sToken, "relLink"=$sRelLink); return $aResp; } function genRandomString() { $length = 10; $characters = '0123456789abcdefghijklmnopqrstuvwxyz'; $string = ''; for ($p = 0; $p

    Read the article

  • What are good or interesting Assembler-like languages, but at a higher level?

    - by CodexArcanum
    I've been looking at L.in.oleum and am intrigued by it's mix of higher-level constructs (loops, dynamic variables) with low-level assembler power (registers). Are there other languages like Lino out there, which blend the speed of assembler with productivity enhancing features? EDIT: I realized this kind of sounds like an ad. I'm genuinely interested in other assembler-like languages, Lino is just the only one I happen to know of.

    Read the article

  • Why are so many new languages written for the Java VM?

    - by sdudo
    There are more and more programming languages (Scala, Clojure,...) coming out that are made for the Java VM and are therefore compatible with the Java Byte-Code. I'm beginning to ask myself: Why the Java VM? What makes it so powerful or popular that there are new programming languages, which seem gaining popularity too, created for it? Why don't they write a new VM for a new language?

    Read the article

  • Is it possible to use multiple languages in .NET resource files?

    - by Gabe Brown
    We’ve got an interesting requirement that we’ll want to support multiple languages at runtime since we’re a service. If a user talks to us using Japanese or English, we’ll want to respond in the appropriate language. FxCop likes us to store our strings in resource files, but I was curious to know if there was an integrated way to select resource string at runtime without having to do it manually. Bottom Line: We need to be able to support multiple languages in a single binary. :)

    Read the article

  • Send mail to multiple recipient

    - by Ahmad Maslan
    Hi, i have already research on using the mail() to send to multiple recipient's but i just cant get it to work. What im trying to do is, for every order that i have, order 1,2,3, each having their own email addresses, when i change their order status from pending to confirm, the mail() will use that id to refer to the db table and send the email of those 3 orders. But for my case, it mailed just the latest order which is order 3. This is the form that i use to change the order status. <form action="results-action" method="post" enctype="multipart/form-data"> <fieldset> <table id ="table_id" class="display"> <thead> <tr><td><h2>Pending Order</h2></td></tr> <tr> <th scope="col">Order ID</th> <th scope="col"> </th> <th scope="col">Name</th> <th scope="col">Address</th> <th scope="col">Product Name</th> <th scope="col">Produt Quantity</th> <th scope="col">Price</th> <th scope="col">Order status</th> </tr> </thead> <tbody> <?php while ($row = mysqli_fetch_array($result)) { ?> <tr> <td><input type="text" value='<?=$row['virtuemart_order_id']?>' name="orderid" id="virtuemart_order_id"></td> <td><input type="hidden" value='<?=$row['virtuemart_product_id']?>' name="productid" id="virtuemart_product_id"></td> <td><?=$row['first_name']?></td> <td><?=$row['address_1']?></td> <td><?=$row['order_item_name']?></td> <td><?=$row['product_quantity']?></td> <td><?=$row['product_final_price'] ?></td> <td><select name='change[<?=$row['virtuemart_order_id']?>]'> <option value='C'> Confirmed</option> <option value='X'> Cancelled</option></select></td> </tr> <?php } ?> </tbody> </table> </fieldset> <fieldset> <table> <tr> <td><input type="submit" value="Update status" name="update status"> </td> </tr> </table> </fieldset> </form> This is the php, using the order id from the form to select the email addresses. <?php $orderid = $_POST['orderid']; // build SQL statement to select email addresses $query3 = "SELECT email from ruj3d_virtuemart_order_userinfos where virtuemart_order_id = '$orderid'"; // execute SQL statement $result3 = mysqli_query($link, $query3) or die(mysqli_error($link)); $subject = "Order confirmed by Home and decor"; $message = "Hello! This is a message to inform that your order has been confirmed"; $from = "[email protected]"; $headers = "From: $from"; while($row3 = mysqli_fetch_array($result3)){ $addresses[] = $row3['email']; } $to = implode(",", $addresses); mail($to, $subject, $message, $headers); ?>

    Read the article

  • Changing multiple objects with a new class name using Jquery

    - by liquilife
    I'd like to click on a trigger and show a specific image. There are multiple triggers which would show a specific image related to it within a set. There are 4 sets The challenge for me is toggling the other images to hide only in this 'set' when one of these triggers are clicked, as there can only be one image showing at a time in each set. Here is the HTML I've put together thus far: <!-- Thumbnails which can be clicked on to toggle the larger preview image --> <div class="materials"> <a href="javascript:;" id="shirtgrey"><img src="/grey_shirt.png" height="122" width="122" /></a> <a href="javascript:;" id="shirtred"><img src="red_shirt.png" height="122" width="122" /></a> <a href="javascript:;" id="shirtblue"><img src="hblue_shirt.png" height="122" width="122" /></a> <a href="javascript:;" id="shirtgreen"><img src="green_shirt.png" height="122" width="122" /></a> </div> <div class="collars"> <a href="javascript:;" id="collargrey"><img src="grey_collar.png" height="122" width="122" /></a> <a href="javascript:;" id="collarred"><img src="red_collar.png" height="122" width="122" /></a> <a href="javascript:;" id="collarblue"><img src="blue_collar.png" height="122" width="122" /></a> <a href="javascript:;" id="collargreen"><img src="green_collar.png" height="122" width="122" /></a> </div> <div class="cuffs"> <a href="javascript:;" id="cuffgrey"><img src="grey_cuff.png" height="122" width="122" /></a> <a href="javascript:;" id="cuffred"><img src="red_cuff.png" height="122" width="122" /></a> <a href="javascript:;" id="cuffblue"><img src="blue_cuff.png" height="122" width="122" /></a> <a href="javascript:;" id="cuffgreen"><img src="/green_cuff.png" height="122" width="122" /></a> </div> <div class="pockets"> <a href="javascript:;" id="pocketgrey"><img src="grey_pocket.png" height="122" width="122" /></a> <a href="javascript:;" id="pocketred"><img src=".png" height="122" width="122" /></a> <a href="javascript:;" id="pocketblue"><img src="blue_pocket.png" height="122" width="122" /></a> <a href="javascript:;" id="pocketgreen"><img src="green_pocket.png" height="122" width="122" /></a> </div> <!-- The larger images where one from each set should be viewable at one time, triggered by the thumb clicked above --> <div class="selectionimg"> <div class="selectShirt"> <img src="grey_shirt.png" height="250" width="250" class="selectShirtGrey show" /> <img src="red_shirt.png" height="250" width="250" class="selectShirtRed hide" /> <img src="blue_shirt.png" height="250" width="250" class="selectShirtBlue hide" /> <img src="green_shirt.png" height="250" width="250" class="selectShirtGreen hide" /> </div> <div class="selectCollar"> <img src="grey_collar.png" height="250" width="250" class="selectCollarGrey show" /> <img src="red_collar.png" height="250" width="250" class="selectCollarRed hide" /> <img src="blue_collar.png" height="250" width="250" class="selectCollarBlue hide" /> <img src="green_collar.png" height="250" width="250" class="selectCollarGreen hide" /> </div> <div class="selectCuff"> <img src="grey_cuff.png" height="250" width="250" class="selectCuffGrey show" /> <img src="red_cuff.png" height="250" width="250" class="selectCuffRed hide" /> <img src="blue_cuff.png" height="250" width="250" class="selectCuffBlue hide" /> <img src="green_cuff.png" height="250" width="250" class="selectCuffGreen hide" /> </div> <div class="selectPocket"> <img src="grey_pocket.png" height="250" width="250" class="selectPocketGrey show" /> <img src="hred_pocket.png" height="250" width="250" class="selectPocketRed hide" /> <img src="blue_pocket.png" height="250" width="250" class="selectPocketBlue hide" /> <img src="green_pocket.png" height="250" width="250" class="selectPocketGreen hide" /> </div> </div> How can jQuery be used to change a class of an image to "show" and ensure that all other images in that same div are set to a class of "hide"? First time posting here. I'm very efficient with HTML and CSS and have a basic understanding of jQuery. I'm learning and this just seems a little bit beyond my abilities at the moment. I hope this all makes sense. Thanks for any help.

    Read the article

< Previous Page | 222 223 224 225 226 227 228 229 230 231 232 233  | Next Page >