Search Results

Search found 35102 results on 1405 pages for 'text mining'.

Page 23/1405 | < Previous Page | 19 20 21 22 23 24 25 26 27 28 29 30  | Next Page >

  • Issue with parsed text with HTMLCleaner - spaces at the begining of text

    - by ansol90
    Im able to get text using HTMLCleaner from website. The problem is that when I set the text to a TextView it shows the beginning of the text with a big space on it. Here is the screenshot of what im talking about. I have tried android:gravity but nothing happened. Please help. Here is my Code: private class SiteParser extends AsyncTask<String, Void, String> { protected String doInBackground(String... arg) { String output = null; try { HtmlHelper hh = new HtmlHelper(new URL(arg[0])); List<TagNode> news = hh.getnewsByClass("TextoPrint"); for (Iterator<TagNode> iterator = newss.iterator(); iterator .hasNext();) { TagNode divElement = (TagNode) iterator.next(); output = divElement.getText().toString(); } } catch (Exception e) { e.printStackTrace(); } return output; } protected void onPostExecute(String output) { Bundle bundle=new Bundle(); bundle.putString("body",output); Intent mainIntent = new Intent(act, MyView.class); mainIntent.putExtras(bundle); startActivity(mainIntent); act.finish(); } } public class HtmlHelper { TagNode rootNode; public HtmlHelper(URL htmlPage) throws IOException, XPatherException { HtmlCleaner cleaner = new HtmlCleaner(); rootNode = cleaner.clean(htmlPage); } List<TagNode> getnewsByClass(String Classname){ List<TagNode> newsList = new ArrayList<TagNode>(); TagNode divElements[] = rootNode.getElementsByName("div", true); for (int i = 0; divElements != null && i < divElements.length; i++) { String classType = divElements[i].getAttributeByName("id"); if (classType != null && classType.equals(Classname)) { newsList.add(divElements[i]); } } return newsList; } }

    Read the article

  • ASP.NET Conditionally Change ButtonField text at runTime

    - by Rodney Vinyard
    ASP.NET Conditionally Change ButtonField text at runTime   <asp:ButtonField CommandName="Edit" HeaderText="" Text="Edit" ButtonType="Link" />       protected void gvRequests_RowDataBound(object sender, GridViewRowEventArgs e)     {         if (e.Row.RowType == DataControlRowType.DataRow)         {             //----------------------------------------------------             // If status = "Saved", change buttonField.LinkButton.Text to "Copy"             //----------------------------------------------------             if (e.Row.Cells[(int)gCol.Status].Text == "Saved")             {                 //----------------------------------------------------                 // no !                 //----------------------------------------------------                 //string x = e.Row.Cells[(int)gCol.EditLink].Text;                 //e.Row.Cells[(int)gCol.EditLink].Text = "Copy";                   //----------------------------------------------------                 // yes !                 //----------------------------------------------------                 LinkButton linkButton = (LinkButton)e.Row.Cells[(int)gCol.EditLink].Controls[0];                 linkButton.Text = "Copy";             }         }     }

    Read the article

  • Send SMS text messages for FREE using Java ME

    - by hinkmond
    Here's a way to get around those nasty SMS text messages charges (and maybe a way to get around the Pakistan SMS text censors too!). Use this Java ME SMS text app for your Java ME mobile phone, called JaxtrSMS: See: JaxtrSMS free Java ME SMS Here's a quote: JaxtrSMS lets you send FREE SMS and txt messages to any mobile phone in the world. Best of all, the receiver does not have to have the JaxtrSMS app. International and local SMS/texting can be expensive but with JaxtrSMS you can text anyone in the world for FREE! Great! Now, you can send 2,000 text messages from your phone every month and not worry about a huge bill. You don't send 2,000 text message in a month? Well, get it for your teenage kids then. They certainly send 2,000 text messages in a month... Hinkmond

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • Changing Text colour in text field by dropdown menu - Visual Studio 2008

    - by Wayne
    Hey, i'm just doing some testing on Visual Studio 2008, what i'm trying to do is to change the text colour inside the multi-textfield which isn't working and I don't know why... Public Class Form1 Dim ColourValue As Color Private Sub Form1_Load(ByVal sender As System.Object, ByVal e As System.EventArgs) Handles MyBase.Load rbBlue.Checked = False rbRed.Checked = False rbGreen.Checked = False End Sub Private Sub rbRed_CheckedChanged(ByVal sender As System.Object, ByVal e As System.EventArgs) Handles rbRed.CheckedChanged txtSpace.BackColor = Color.Red End Sub Private Sub rbBlue_CheckedChanged(ByVal sender As System.Object, ByVal e As System.EventArgs) Handles rbBlue.CheckedChanged txtSpace.BackColor = Color.Blue End Sub Private Sub rbGreen_CheckedChanged(ByVal sender As System.Object, ByVal e As System.EventArgs) Handles rbGreen.CheckedChanged txtSpace.BackColor = Color.Green End Sub Private Sub cbColours_SelectedValueChanged(ByVal sender As Object, ByVal e As System.EventArgs) Handles cbColours.SelectedValueChanged ColourValue = cbColours.SelectedValue txtSpace.BackColor = ColourValue End Sub End Class Basically i have the radio buttons that would change the background colour of the textfield, but i just need the dropdown menu to change the text colour. Many thanks :)

    Read the article

  • knockout bind text label to dropdown value selected option text

    - by Adam Levitt
    Is there a simple way to bind the textbox of a div to change based on the text value of the selected option in a dropdown on the same page? <div data-bind="text: dropdownValue"></div> <select> <option value="1">Value1</option> <option value="2">Value2</option> </select> Please note, I don't want to put the values into the select element using javascript. I'd like to bind to the value straight from the HTML. I can also include jQuery to make it work.

    Read the article

  • When page loads display 1st image text - hide all other text

    - by Jonah1289
    Hi I have created http://techavid.com/design/test3.html and when you load the page you see there are 3 images. The sun image is focused(in color), while the others are greyed out until clicked. That is how it should be for the images. Also when you load the page you see under each image it's own text(i.e. 1st: Sun, 2nd: Airplane, 3rd: Nano), but on page load I only want 1st:Sun to display and hide all other text until their respective image is clicked. Any idea how to do this? thanks :) J

    Read the article

  • Rendering only a part of text FTGL, OpenGL

    - by Mosquito
    I'm using FTGL library to render text in my C++ project. I can easily render text by using: CFontManager::Instance().renderWrappedText(font, lineLength, position, text); Unfortunately there is a situation in which this Button which displays text, is partly hidden because of resizing container in which it is situated. I'm able without any problem to draw Button's background to fit the container, but I've got a problem with doing the same with a text. Is it possible to somehow draw only text for given width and the rest just ignore? This is a screen which presents my problem: As you can see, the Button "Click here" is being drawn properly, but I can't do the same with "Click here" text.

    Read the article

  • Rich Text Editor in javascript

    - by chanthou
    iframe .text-bold{ border:1px solid orange; background-color:#ccc; width:16px; height:16px; font-weight:bold; cursor:pointer; } .active{ border-color:#9DAECD #E8F1FF #E8F1FF #9DAECD; background-color:yellow; } function init( ) { iframe = document.createElement("iframe"); document.body.appendChild(iframe); iframe.onload = setIframeEditable; isBold=false; div=document.getElementById("bold"); } var setIframeEditable = function(){ iframe.contentDocument.designMode='on'; iframe.focus(); } function makeBold(){ if(!isBold){ //console.log(iframe.contentDocument.execCommand("bold", false, null)); iframe.contentDocument.execCommand("bold", false, null); div.className += " active"; isBold=true; iframe.focus(); }else{ //console.log(iframe.contentDocument.execCommand("bold", true, null)); iframe.contentDocument.execCommand("bold", false, null); div.className ="text-bold"; isBold=false iframe.focus(); } } </script> </head> <body onload="init()"> <div id="bold" class="text-bold" onclick="makeBold()">B</div> </body>

    Read the article

  • Improve Efficiency for This Text Processing Code

    - by johnv
    I am writing a program that counts the number of words in a text file which is already in lowercase and separated by spaces. I want to use a dictionary and only count the word IF it's within the dictionary. The problem is the dictionary is quite large (~100,000 words) and each text document has also ~50,000 words. As such, the codes that I wrote below gets very slow (takes about 15 sec to process one document on a quad i7 machine). I'm wondering if there's something wrong with my coding and if the efficiency of the program can be improved. Thanks so much for your help. Code below: public static string WordCount(string countInput) { string[] keywords = ReadDic(); /* read dictionary txt file*/ /*then reads the main text file*/ Dictionary<string, int> dict = ReadFile(countInput).Split(' ') .Select(c => c) .Where(c => keywords.Contains(c)) .GroupBy(c => c) .Select(g => new { word = g.Key, count = g.Count() }) .OrderBy(g => g.word) .ToDictionary(d => d.word, d => d.count); int s = dict.Sum(e => e.Value); string k = s.ToString(); return k; }

    Read the article

  • Normalize whitespace and other plain-text formatting routines

    - by dreftymac
    Background: The language is JavaScript. The goal is to find a library or pre-existing code to do low-level plain-text formatting. I can write it myself, but why re-invent the wheel. The issue is: it is tough to determine if a "wheel" is out there, since any search for JavaScript libraries pulls up an ocean of HTML-centric stuff. I am not interested in HTML necessarily, just text. Example: I need a JavaScript function that changes this: BEFORE: nisi ut aliquip | ex ea commodo consequat duis |aute irure dolor in esse cillum dolore | eu fugiat nulla pariatur |excepteur sint occa in culpa qui | officia deserunt mollit anim id |est laborum ... into this ... AFTER: nisi ut aliquip | ex ea commodo consequat duis | aute irure dolor in esse cillum dolore | eu fugiat nulla pariatur | excepteur sint occa in culpa qui | officia deserunt mollit anim id | est laborum Question: Does it exist, a JavaScript library that is non-html-web-development-centric that has functions for normalizing spaces in delimited plain text, justifying and spacing plain text? Rationale: Investigating JavaScript for use in a programmer's text editor.

    Read the article

  • Search implementation dilemma: full text vs. plain SQL

    - by Ethan
    I have a MySQL/Rails app that needs search. Here's some info about the data: Users search within their own data only, so searches are narrowed down by user_id to begin with. Each user will have up to about five thousand records (they accumulate over time). I wrote out a typical user's records to a text file. The file size is 2.9 MB. Search has to cover two columns: title and body. title is a varchar(255) column. body is column type text. This will be lightly used. If I average a few searches per second that would be surprising. It's running an a 500 MB CentOS 5 VPS machine. I don't want relevance ranking or any kind of fuzziness. Searches should be for exact strings and reliably return all records containing the string. Simple date order -- newest to oldest. I'm using the InnoDB table type. I'm looking at plain SQL search (through the searchlogic gem) or full text search using Sphinx and the Thinking Sphinx gem. Sphinx is very fast and Thinking Sphinx is cool, but it adds complexity, a daemon to maintain, cron jobs to maintain the index. Can I get away with plain SQL search for a small scale app?

    Read the article

  • How to get user input before saving a file in Sublime Text

    - by EddieJessup
    I'm making a plugin in Sublime Text that prompts the user for a password to encrypt a file before it's saved. There's a hook in the API that's executed before a save is executed, so my naïve implementation is: class TranscryptEventListener(sublime_plugin.EventListener): def on_pre_save(self, view): # If document is set to encode on save if view.settings().get('ON_SAVE'): self.view = view # Prompt user for password message = "Create a Password:" view.window().show_input_panel(message, "", self.on_done, None, None) def on_done(self, password): self.view.run_command("encode", {password": password}) The problem with this is, by the time the input panel appears for the user to enter their password, the document has already been saved (despite the trigger being 'on_pre_save'). Then once the user hits enter, the document is encrypted fine, but the situation is that there's a saved plaintext file, and a modified buffer filled with the encrypted text. So I need to make Sublime Text wait until the user's input the password before carrying out the save. Is there a way to do this? At the moment I'm just manually re-saving once the encryption has been done: def on_pre_save(self, view, encode=False): if view.settings().get('ON_SAVE') and not view.settings().get('ENCODED'): self.view = view message = "Create a Password:" view.window().show_input_panel(message, "", self.on_done, None, None) def on_done(self, password): self.view.run_command("encode", {password": password}) self.view.settings().set('ENCODED', True) self.view.run_command('save') self.view.settings().set('ENCODED', False) but this is messy and if the user cancels the encryption then the plaintext file gets saved, which isn't ideal. Any thoughts? Edit: I think I could do it cleanly by overriding the default save command. I hoped to do this by using the on_text_command or on_window_command triggers, but it seems that the save command doesn't trigger either of these (maybe it's an application command? But there's no on_application_command). Is there just no way to override the save function?

    Read the article

  • Creating a smart text generator

    - by royrules22
    I'm doing this for fun (or as 4chan says "for teh lolz") and if I learn something on the way all the better. I took an AI course almost 2 years ago now and I really enjoyed it but I managed to forget everything so this is a way to refresh that. Anyway I want to be able to generate text given a set of inputs. Basically this will read forum inputs (or maybe Twitter tweets) and then generate a comment based on the learning. Now the simplest way would be to use a Markov Chain Text Generator but I want something a little bit more complex than that as the MKC basically only learns by word order (which word is more likely to appear after word x given the input text). I'm trying to see if there's something I can do to make it a little bit more smarter. For example I want it to do something like this: Learn from a large selection of posts in a message board but don't weight it too much For each post: Learn from the other comments in that post and weigh these inputs higher Generate comment and post See what other users' reaction to your post was. If good weigh it positively so you make more posts that are similar to the one made, and vice versa if negative. It's the weighing and learning from mistakes part that I'm not sure how to implement. I thought about Artificial Neural Networks (mainly because I remember enjoying that chapter) but as far as I can tell that's mainly used to classify things (i.e. given a finite set of choices [x1...xn] which x is this given input) not really generate anything. I'm not even sure if this is possible or if it is what should I go about learning/figuring out. What algorithm is best suited for this? To those worried that I will use this as a bot to spam or provide bad answers to SO, I promise that I will not use this to provide (bad) advice or to spam for profit. I definitely will not post it's nonsensical thoughts on SO. I plan to use it for my own amusement. Thanks!

    Read the article

  • Concatenate 2 text elements on a line with full-width border using CSS only

    - by Michael Horne
    Okay, I'm a newbie to CSS3, so please be gentle. ;-) I'm working with some Wordpress code (Woocommerce plugin, to be exact), and I'm trying to format a line of code in a sidebar so that 2 separate text items (one in an <a, the other in a <span are all on the same line, the full width of the column, and with a bottom border. It looks something like this (except the bottom border on each text do not go all the way across the enclosing sidebar box): http://www.dalluva.com/temp/browse-catalog.JPG (sorry, I'm new and can't post inline images yet) Here's the code fragment I'm trying to live with (i.e. I don't want to change it): <div class="widget"> ... <ul class="product-categories"> <li class="cat-item"> <a href="http://localhost/dalluva/shop/product-category/books/">Books</a> <span class="count">(5)</span> </li> ... And here's the CSS I have now: .widget ul li a { border-bottom: 1px solid #e9e9e9; line-height:1.0; padding: 5px 0 5px 22px; display: inline-block; } .widget ul li span { border-bottom: 1px solid #e9e9e9; line-height: 1.0; padding: 5px 0 5px 0; display: inline-block; } The output in the image above looks right for this CSS code, but when I change the 'span' CSS to include a width:100%, it causes the span element to wrap to the next line, looking like this: http://www.dalluva.com/temp/browse-catalog-2.JPG I've played with white-space:nowrap, overflow:hidden, etc, but I can't seem to find a way to have both the <a and the <span text on the same line with the border extending the full width of the column. Any suggestions on getting the desired effect through CSS only? Thanks. Michael

    Read the article

  • Full Text Search like Google

    - by Eduardo
    I would like to implement full-text-search in my off-line (android) application to search the user generated list of notes. I would like it to behave just like Google (since most people are already used to querying to Google) My initial requirements are: Fast: like Google or as fast as possible, having 100000 documents with 200 hundred words each. Searching for two words should only return documents that contain both words (not just one word) (unless the OR operator is used) Case insensitive (aka: normalization): If I have the word 'Hello' and I search for 'hello' it should match. Diacritical mark insensitive: If I have the word 'así' a search for 'asi' should match. In Spanish, many people, incorrectly, either do not put diacritical marks or fail in correctly putting them. Stop word elimination: To not have a huge index meaningless words like 'and', 'the' or 'for' should not be indexed at all. Dictionary substitution (aka: stem words): Similar words should be indexed as one. For example, instances of 'hungrily' and 'hungry' should be replaced with 'hunger'. Phrase search: If I have the text 'Hello world!' a search of '"world hello"' should not match it but a search of '"hello world"' should match. Search all fields (in multifield documents) if no field specified (not just a default field) Auto-completion in search results while typing to give popular searches. (just like Google Suggest) How may I configure a full-text-search engine to behave as much as possible as Google? (I am mostly interested in Open Source, Java and in particular Lucene)

    Read the article

  • C# ...extract email address from inside 100's of text files

    - by Developer
    My SMTP server got 100's of errors when sending lots of emails. Now have lots of .BAD files each one containing an error message and somewhere in the middle, the actual email address it was supposed to be sent to. What is the easiest way to extract from each file "just" the "email address", so that I can have a list of the actual failed emails? I can code in C# and any suggestion will be truly welcomed. BAD SAMPLE TEXT: From: [email protected] To: [email protected] Date: Tue, 25 Sep 2012 12:12:09 -0700 MIME-Version: 1.0 Content-Type: multipart/report; report-type=delivery-status; boundary="9B095B5ADSN=_01CD9B35032DF58000000066my.server.co" X-DSNContext: 7ce717b1 - 1386 - 00000002 - C00402D1 Message-ID: Subject: Delivery Status Notification (Failure) This is a MIME-formatted message. Portions of this message may be unreadable without a MIME-capable mail program. --9B095B5ADSN=_01CD9B35032DF58000000066my.server.co Content-Type: text/plain; charset=unicode-1-1-utf-7 This is an automatically generated Delivery Status Notification. Unable to deliver message to the following recipients, due to being unable to connect successfully to the destination mail server. [email protected] --9B095B5ADSN=_01CD9B35032DF58000000066my.server.com Content-Type: message/delivery-status Reporting-MTA: dns;my.server.com Received-From-MTA: dns;Social Arrival-Date: Tue, 25 Sep 2012 11:45:15 -0700 Final-Recipient: rfc822;[email protected] Action: failed Status: 4.4.7 --9B095B5ADSN=_01CD9B35032DF58000000066my.server.com Content-Type: message/rfc822 Received: from Social ([127.0.0.1]) by my.server.com with Microsoft SMTPSVC(7.5.7601.17514); Tue, 25 Sep 2012 11:45:15 -0700 ====================================== ...and lots more text after ===================== Mainly I want to find the "[email protected]" email right in the middle...

    Read the article

  • How To Read A Remote Text File

    - by XcodeDev
    Hi, I would like to read a remote text file called posts.txt on my website. An example of the insides of the posts.txt file would be this: <div style="width : 300px; position : relative"><font face="helvetica, geneva, sans serif" size="6"><b>2</b></font><font face="helvetica, geneva, sans serif" size="4"><i> scored by iSDK</i></font><br><img src="Bar.png" /></div><div style="width : 300px; position : relative"><font face="helvetica, geneva, sans serif" size="6"><b>2</b></font><font face="helvetica, geneva, sans serif" size="4"><i> scored by martin</i></font><br><img src="Bar.png" /></div> What I wanted to know is how can I get the score, and scored by text from the .txt file? The score is (in this case) the: <b>2</b>, and the scored by text in this case would be: "scored by iSDK". Any code telling me how to do this is twice as helpful! Thanks in advanced XcodeDev

    Read the article

  • Custom Text and Binary Payloads using WebSocket (TOTD #186)

    - by arungupta
    TOTD #185 explained how to process text and binary payloads in a WebSocket endpoint. In summary, a text payload may be received as public void receiveTextMessage(String message) {    . . . } And binary payload may be received as: public void recieveBinaryMessage(ByteBuffer message) {    . . .} As you realize, both of these methods receive the text and binary data in raw format. However you may like to receive and send the data using a POJO. This marshaling and unmarshaling can be done in the method implementation but JSR 356 API provides a cleaner way. For encoding and decoding text payload into POJO, Decoder.Text (for inbound payload) and Encoder.Text (for outbound payload) interfaces need to be implemented. A sample implementation below shows how text payload consisting of JSON structures can be encoded and decoded. public class MyMessage implements Decoder.Text<MyMessage>, Encoder.Text<MyMessage> {     private JsonObject jsonObject;    @Override    public MyMessage decode(String string) throws DecodeException {        this.jsonObject = new JsonReader(new StringReader(string)).readObject();               return this;    }     @Override    public boolean willDecode(String string) {        return true;    }     @Override    public String encode(MyMessage myMessage) throws EncodeException {        return myMessage.jsonObject.toString();    } public JsonObject getObject() { return jsonObject; }} In this implementation, the decode method decodes incoming text payload to MyMessage, the encode method encodes MyMessage for the outgoing text payload, and the willDecode method returns true or false if the message can be decoded. The encoder and decoder implementation classes need to be specified in the WebSocket endpoint as: @WebSocketEndpoint(value="/endpoint", encoders={MyMessage.class}, decoders={MyMessage.class}) public class MyEndpoint { public MyMessage receiveMessage(MyMessage message) { . . . } } Notice the updated method signature where the application is working with MyMessage instead of the raw string. Note that the encoder and decoder implementations just illustrate the point and provide no validation or exception handling. Similarly Encooder.Binary and Decoder.Binary interfaces need to be implemented for encoding and decoding binary payload. Here are some references for you: JSR 356: Java API for WebSocket - Specification (Early Draft) and Implementation (already integrated in GlassFish 4 promoted builds) TOTD #183 - Getting Started with WebSocket in GlassFish TOTD #184 - Logging WebSocket Frames using Chrome Developer Tools, Net-internals and Wireshark TOTD #185: Processing Text and Binary (Blob, ArrayBuffer, ArrayBufferView) Payload in WebSocket Subsequent blogs will discuss the following topics (not necessary in that order) ... Error handling Interface-driven WebSocket endpoint Java client API Client and Server configuration Security Subprotocols Extensions Other topics from the API

    Read the article

  • JQUERY, Compare two Text Blocks, and then animate only the new text

    - by nobosh
    I have two blocks of text Text Block 1 - Currently displayed on the page: "Ahd Hd ahaSdjdajs dadjs jasd adskadskl1lksad klasd klasd dsa Ahd Hd ahaSdjdajs dadjs jasd adskadskl1lksad klasd klasd dsa Ahd Hd ahaSdjdajs dadjs jasd adskadskl1lksad klasd klasd dsa Ahd Hd ahaSdjdajs dadjs jasd adskadskl1lksad klasd klasd dsa" But now Block 1 on the backend is: "Ahd Hd ahaSdjdajs dadjs jasd adskadskl1lksad klasd klasd dsa Ahd Hd ahaSdjdajs dadjs jasd adskadskl1lksad klasd klasd dsa Ahd Hd ahaSdjdajs dadjs jasd adskadskl1lksad klasd klasd dsa Ahd Hd ahaSdjdajs dadjs jasd adskadskl1lksad klasd klasd dsaadskadskl1lksad klasd klasd dsa Ahd Hd ahaSdjdajs dadjs jasdadskadskl1lksad klasd klasd dsa Ahd Hd ahaSdjdajs dadjs jasd adskadskl1lksad klasd klasd dsa Ahd Hd ahaSdjdajs dadjs jasd adskadskl1lksad klasd klasd dsaadskadskl1lksad klasd klasd dsa Ahd Hd ahaSdjdajs dadjs jasdadskadskl1lksad klasd klasd dsa Ahd Hd ahaSdjdajs dadjs jasd adskadskl1lksad klasd klasd dsa Ahd Hd ahaSdjdajs dadjs jasd adskadskl1lksad klasd klasd dsaadskadskl1lksad klasd klasd dsa Ahd Hd ahaSdjdajs dadjs jasd adskadskl1lksad klasd klasd dsaadskadskl1lksad klasd klasd dsa Ahd Hd ahaSdjdajs dadjs jasd adskadskl1lksad klasd klasd dsaadskadskl1lksad klasd klasd dsa Ahd Hd ahaSdjdajs dadjs jasd adskadskl1lksad klasd klasd dsa" I'd like to update the original Block 1 that's on the page, with the Block 2 that's on the server to the page. And I'd like to append, and not flash the entire block. So only the new stuff is flashed. Any ideas on how to do this in JQUERY?

    Read the article

  • Auto populate a text field based on another text field

    - by Syed Aslam
    I am trying to auto-populate a text field based on the value of another input field. Currently trying to do this using observe_field helper like this: <%= observe_field( :account_name, :function => "alert('Name changed!')", :on => 'keyup' ) %> <% form_for(@account, :html => { :id => 'theform' }) do |f| %> <label for="accountname"> Account name </label> <%= form.text_field :name, :tabindex => '1' %> <label for="subdomain"> Subdomain </label> <%= form.text_field :subdomain, :tabindex => '2' %> <% end %> When the user enters text in the account_name text_field, I want to copy that convert into a subdomain (downcase and join by '-') and populate to subdomain text_field. But, in the process getting this error: element is null var method = element.tagName.toLowerCase(); protot...9227640 (line 3588) Where exactly am I going wrong here? Or is there a better way to do this?

    Read the article

  • Big Data&rsquo;s Killer App&hellip;

    - by jean-pierre.dijcks
    Recently Keith spent  some time talking about the cloud on this blog and I will spare you my thoughts on the whole thing. What I do want to write down is something about the Big Data movement and what I think is the killer app for Big Data... Where is this coming from, ok, I confess... I spent 3 days in cloud land at the Cloud Connect conference in Santa Clara and it was quite a lot of fun. One of the nice things at Cloud Connect was that there was a track dedicated to Big Data, which prompted me to some extend to write this post. What is Big Data anyways? The most valuable point made in the Big Data track was that Big Data in itself is not very cool. Doing something with Big Data is what makes all of this cool and interesting to a business user! The other good insight I got was that a lot of people think Big Data means a single gigantic monolithic system holding gazillions of bytes or documents or log files. Well turns out that most people in the Big Data track are talking about a lot of collections of smaller data sets. So rather than thinking "big = monolithic" you should be thinking "big = many data sets". This is more than just theoretical, it is actually relevant when thinking about big data and how to process it. It is important because it means that the platform that stores data will most likely consist out of multiple solutions. You may be storing logs on something like HDFS, you may store your customer information in Oracle and you may store distilled clickstream information in some distilled form in MySQL. The big question you will need to solve is not what lives where, but how to get it all together and get some value out of all that data. NoSQL and MapReduce Nope, sorry, this is not the killer app... and no I'm not saying this because my business card says Oracle and I'm therefore biased. I think language is important, but as with storage I think pragmatic is better. In other words, some questions can be answered with SQL very efficiently, others can be answered with PERL or TCL others with MR. History should teach us that anyone trying to solve a problem will use any and all tools around. For example, most data warehouses (Big Data 1.0?) get a lot of data in flat files. Everyone then runs a bunch of shell scripts to massage or verify those files and then shoves those files into the database. We've even built shell script support into external tables to allow for this. I think the Big Data projects will do the same. Some people will use MapReduce, although I would argue that things like Cascading are more interesting, some people will use Java. Some data is stored on HDFS making Cascading the way to go, some data is stored in Oracle and SQL does do a good job there. As with storage and with history, be pragmatic and use what fits and neither NoSQL nor MR will be the one and only. Also, a language, while important, does in itself not deliver business value. So while cool it is not a killer app... Vertical Behavioral Analytics This is the killer app! And you are now thinking: "what does that mean?" Let's decompose that heading. First of all, analytics. I would think you had guessed by now that this is really what I'm after, and of course you are right. But not just analytics, which has a very large scope and means many things to many people. I'm not just after Business Intelligence (analytics 1.0?) or data mining (analytics 2.0?) but I'm after something more interesting that you can only do after collecting large volumes of specific data. That all important data is about behavior. What do my customers do? More importantly why do they behave like that? If you can figure that out, you can tailor web sites, stores, products etc. to that behavior and figure out how to be successful. Today's behavior that is somewhat easily tracked is web site clicks, search patterns and all of those things that a web site or web server tracks. that is where the Big Data lives and where these patters are now emerging. Other examples however are emerging, and one of the examples used at the conference was about prediction churn for a telco based on the social network its members are a part of. That social network is not about LinkedIn or Facebook, but about who calls whom. I call you a lot, you switch provider, and I might/will switch too. And that just naturally brings me to the next word, vertical. Vertical in this context means per industry, e.g. communications or retail or government or any other vertical. The reason for being more specific than just behavioral analytics is that each industry has its own data sources, has its own quirky logic and has its own demands and priorities. Of course, the methods and some of the software will be common and some will have both retail and service industry analytics in place (your corner coffee store for example). But the gist of it all is that analytics that can predict customer behavior for a specific focused group of people in a specific industry is what makes Big Data interesting. Building a Vertical Behavioral Analysis System Well, that is going to be interesting. I have not seen much going on in that space and if I had to have some criticism on the cloud connect conference it would be the lack of concrete user cases on big data. The telco example, while a step into the vertical behavioral part is not really on big data. It used a sample of data from the customers' data warehouse. One thing I do think, and this is where I think parts of the NoSQL stuff come from, is that we will be doing this analysis where the data is. Over the past 10 years we at Oracle have called this in-database analytics. I guess we were (too) early? Now the entire market is going there including companies like SAS. In-place btw does not mean "no data movement at all", what it means that you will do this on data's permanent home. For SAS that is kind of the current problem. Most of the inputs live in a data warehouse. So why move it into SAS and back? That all worked with 1 TB data warehouses, but when we are looking at 100TB to 500 TB of distilled data... Comments? As it is still early days with these systems, I'm very interested in seeing reactions and thoughts to some of these thoughts...

    Read the article

  • Text Wrapping in SSRS

    - by anna
    Hi, How do I accomplish text wrapping of table fields in SSRS Report, and proper landscaping when rendering the report to PDF format Thanks in advance Anna

    Read the article

  • Why can't I wrap text around grouped images in Word?

    - by Ivo Flipse
    When I paste two images into Microsoft Word and I set Wrap Text to Square and then group them so they stick nicely together, I can no longer Wrap Text around this newly grouped image. Any explanation to why text wrapping is disabled for grouped images? Note: if I don't change the Wrap Text option, I can't group them. This is for Word 2010 on Windows 7, but I've had this problem with every version of Word.

    Read the article

< Previous Page | 19 20 21 22 23 24 25 26 27 28 29 30  | Next Page >