Search Results

Search found 8593 results on 344 pages for 'regular expression'.

Page 230/344 | < Previous Page | 226 227 228 229 230 231 232 233 234 235 236 237  | Next Page >

• Using C# and gppg, how would I construct an abstract syntax tree?

  - by Rupert

  Is there a way to do this almost out-of-the-box? I could go and write a big method that would use the collected tokens to figure out which leaves should be put in which branches and in the end populate a TreeNode object, but since gppg already handled everything by using supplied regular expressions, I was wondering if there's an easier way? Even if not, any pointers as to how best to approach the problem of creating an AST would be appreciated. Apologies if I said anything silly, I'm only just beginning to play the compiler game. :)

  Read the article

• Parse a text file into multiple text file

  - by Vijay Kumar Singh

  I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

  Read the article

• Catch $.getJSON error

  - by Switz

  I've been trying to figure this out for hours. I have a DYNAMIC youtube search, which I use Youtube's JSON api for. It works usually, but there are times that it won't find anything. Is there a way to figure out if it finds nothing, and then end the function because otherwise it stops the entire code. I tried jsonp, but that didn't seem to be correct. Somewhere I read that error catching is built into the newest jQuery getJSON, but I couldn't find it. The code is really tedious so I'd rather not post it unless it comes to that. I'd appreciate any help! Thanks guys. error showing that json didn't return anything jquery-1.4.4.min.js:32 TypeError: Result of expression 'j' [undefined] is not an object.

  Read the article

• Is it possible to use DLR in a .NET 3.5 website project?

  - by Aplato

  I'm trying to evaluate an expression stored in a database i.e. "if (Q1 ==2) {result = 3.1;} elseif (Q1 ==3){result=4.1;} else result = 5.9;" Rather than parsing it myself I'm trying to use the DLR. I'm using version .92 from the Codeplex repository and my solution is a .NET 3.5 website; and I'm having conflicts between the System.Core and Microsoft.Scripting.ExtenstionAttribute .dll's. Error = { Description: "'ExtensionAttribute' is ambiguous in the namespace 'System.Runtime.CompilerServices'.", File: "InternalXmlHelper.vb" } At this time I cannot upgrade to .NET 4.0 and make significant use of the .net 3.5 features (so downgrading is not an option). Any help greatly appreciated.

  Read the article

• How can I remove sensitive data from the debug_backtrace function?

  - by RenderIn

  I am using print_r(debug_backtrace(), true) to retrieve a string representation of the debug backtrace. This works fine, as print_r handles recursion. When I tried to recursively iterate through the debug_backtrace() return array before turning it into a string it ran into recursion and never ended. Is there some simple way I can remove certain sensitive key/value pairs from the backtrace array? Perhaps some way to turn the array to a string using print_r, then back to an array with the recursive locations changed to the string RECURSION, which I could the iterate through. I don't want to execute regular expressions on the string representation if possible.

  Read the article

• Android: Deciding between SurfaceView and OpenGL (GLSurfaceView)

  - by Rich

  Is there a way to decide up front based on the expected complexity of a game/app in the planning phase whether to use regular Canvas drawing in a SurfaceView or to go with OpenGL? I've been playing around with a Canvas and only need 2D movement, and on a fairly new phone I'm getting pretty decent performance with a bunch of primitive objects and a few bitmaps running around the screen on a solid background. Is it fair to say that if I'm going to be drawing background images and increasing the number of objects being moved and drawn on top of them that I should go straight to OpenGL?

  Read the article

• What is a Web Framework ? How does it compare with LAMP

  - by Nishant

  I started web development in LAMP/WAMP and it was logical to me . There is a Web Server program called Apache which does the networking part of setting up a service on port 80 ( common port ) . If the request is regular HTML it uses the HTTP headers to transport files .And if the request for the file is a PHP one , it has a mod_php with which Apache invokes the PHP interpreter to process the file and it gives back HTML which is again transferred as usual HTML . Now the question is what is a Web Framework ? I came across Python based website creation and there is Flask . What is a flask , how does it compare with LAMP . Further are DJango / Ruby on Rails different from flask ? Can someone answer me and also give some good places to read on these .Thanks for your answers in advance . Further is things like LAMP slower than the common FRAMEWORKS because they claimn easy deplyment fo web apps .

  Read the article

• Integrating iCalendar in Moodle

  - by user61255

  Hi all, I am working on a Moodle project and I have downloaded and installed the latest build(1.9) on my system. I'm using this framework for the very first time so presently trying to get familiar with the environment and the documentation. My need is to embed an iCal kinda calendar on Moodle's front page using the PHP iCalendar API. I downloaded the latest version of PHP iCalendar but kinda needed some help figuring things out further. I am trying to build a plug-in sorta thing which allows you to put a custom-built calendar (in place of the regular Moodle calendar) on your Moodle site. Has anyone ever worked with something similar before? Any suggestions?!! Thanks in advance! --eureka

  Read the article

• Criteria hibernate

  - by apb

  my code session.createCriteria(Input.class); DateFormat format = new SimpleDateFormat("yyyy-MM-dd hh:mm:ss"); Date startDate = (Date)format.parse("2005-01-01 00:00:00"); Date endDate = (Date)format.parse("2005-03-03 00:00:00"); crit.add(Expression.between ("inputDate", new Date(startDate.getTime()), new Date(endDate.getTime()))); This code return a list, but there is no element present in it. i think it doesn't match the condition. Anybody help.

  Read the article

• Capturing the contents of <select>

  - by joey mueller

  I'm trying to use a regular expression to capture the contents of all option values inside an HTML select element For example, in: <select name="test"> <option value="blah">one</option> <option value="mehh">two</option> <option value="rawr">three</option> </select> I'd like to capture one two and three into an array. My current code is var pages = responseDetails.responseText.match(/<select name="page" .+?>(?:\s*<option .+?>([^<]+)<\/option>)+\s*<\/select>/); for (var c = 0; c<pages.length; c++) { alert(pages[c]); } But it only captures the last value, in this case, "three". How can I modify this to capture all of them? Thanks!

  Read the article

• Assigning an @Annotation enum a value

  - by h2g2java

  I created enum Restrictions{ none, enumeration, fractionDigits, length, maxExclusive, maxInclusive, maxLength, minExclusive, minInclusive, minLength, pattern, totalDigits, whiteSpace; public Restrictions setValue(int value){ this.value = value; return this; } public int value; } So that I could happily do something like this, which is perfectly legal syntax. Restrictions r1 = Restrictions.maxLength.setValue(64); The reason being is, I am using enum to restrict the type of restriction that could be used, and be able to assign a value to that restriction. However, my actual motivation is to use that restriction in an @annotation. @Retention(RetentionPolicy.RUNTIME) @Target({ElementType.TYPE, ElementType.FIELD, ElementType.METHOD}) public @interface Presentable { Restrictions[] restrictions() default Restrictions.none; } So that, I intended to do this: @Presentable(restrictions=Restrictions.maxLength.setValue(64)) public String userName; to which, the compiler croaks The value for annotation enum attribute must be an enum constant expression. Is there a way to accomplish what I wish to accomplish

  Read the article

• Cache Wrapper with expressions

  - by Fujiy

  I dont know if is possible. I want a class to encapsulate all Cache of my site. I thinking about the best way to do this to avoid conflict with keys. My first idea is something like this: public static TResult Cachear<TResult>(this Cache cache, Expression<Func<TResult>> funcao) { string chave = funcao.ToString(); if (!(cache[chave] is TResult)) { cache[chave] = funcao.Compile()(); } return (TResult)cache[chave]; } Is the best way? Ty

  Read the article

• Suppressing the language select button iPhone

  - by AWinter

  I'm working on an application now that contains an account register section. One field with secureTextEntry = NO (for registering only). The idea is this make registration faster and hopefully increases the number of signups. It's simple enough for me to just place a regular UITextField but if the user has any additional language keyboards then it's possible for the user to enter non-password friendly characters. Unlike in when secureTextEntry = YES. I know I can do textField.keyboardType = UIKeyboardTypeASCIICapable to get the text field to display the ASCII keyboard first, but the user will still have the keyboard switch button which will allow them to get to undesirable characters. Is there a simple method for suppressing the international button or forcing ASCII only keyboard with no international button? [EDIT] Another perhaps better option might be to suppress multi byte keyboards or even to display the text in the case that secureTextEntry = YES any ideas here? [EDIT AGAIN] I've decided it's a really bad idea to suppress the international button as non-multibyte characters should all be allowed.

  Read the article

• Why won't this SQL CAST work?

  - by Kev

  I have a nvarchar(50) column in a SQL Server 2000 table defined as follows: TaskID nvarchar(50) NULL I need to fill this column with some random SQL Unique Identifiers (I am unable to change the column type to uniqueidentifier). I tried this: UPDATE TaskData SET TaskID = CAST(NEWID() AS nvarchar) but I got the following error: Msg 8115, Level 16, State 2, Line 1 Arithmetic overflow error converting expression to data type nvarchar. I also tried: UPDATE TaskData SET TaskID = CAST(NEWID() AS nvarchar(50)) but then got this error: Msg 8152, Level 16, State 6, Line 1 String or binary data would be truncated. I don't understand why this doesn't work but this does: DECLARE @TaskID nvarchar(50) SET @TaskID = CAST(NEW() AS nvarchar(50)) I also tried CONVERT(nvarchar, NEWID()) and CONVERT(nvarchar(50), NEWID()) but got the same errors.

  Read the article

• Open C: Directly with `FileStream` without `CreateFile` API

  - by DxCK

  I trying to open C: directly with FileStream without success: new FileStream("C:", FileMode.Open, FileAccess.Read, FileShare.ReadWrite); System.UnauthorizedAccessException was unhandled Message="Access to the path 'C:\' is denied." Source="mscorlib" StackTrace: in System.IO.__Error.WinIOError(Int32 errorCode, String maybeFullPath) in System.IO.FileStream.Init(String path, FileMode mode, FileAccess access, Int32 rights, Boolean useRights, FileShare share, Int32 bufferSize, FileOptions options, SECURITY_ATTRIBUTES secAttrs, String msgPath, Boolean bFromProxy) in System.IO.FileStream..ctor(String path, FileMode mode, FileAccess access, FileShare share, Int32 bufferSize, FileOptions options, String msgPath, Boolean bFromProxy) in System.IO.FileStream..ctor(String path, FileMode mode, FileAccess access, FileShare share) in ReadingMftNewTest.Program.Main(String[] args) in D:\CS\2008\ReadingMftNewTest\ReadingMftNewTest\Program.cs:line 76 Note that i openning "C:" but the error says "C:\", where did this slash came from? :\ Is there any chance to open C: without using the CreateFile API? I really don't want be depending on WIN32 API because this code should also run on Mono that dont support WIN32 API, but successfully openning devices with regular FileStream (Mono 1 Microsoft 0).

  Read the article

• JavaScript lazy regex for matching HTML tags

  - by Grnbeagle

  Hi, I'm having a problem writing a regular expression for matching HTML tags. I found a similar entry here, but this didn't quite work in my case. Here's my test string: <div id="div0" class="myclass">here's some text that may include whitespace</div><div id="div1" class="myclass"> and some more here </div> And here's my regex based on the aforementioned entry: <div[^>]*class="myclass">[^~]*?<\/div> Note that I need to match the first instance of <div /> with class of "myclass." The content may have carriage returns. These <div> tags won't be nested. Here's a rubular page for testing: http://rubular.com/r/vlfcikKMXk

  Read the article

• HttpContext User value changing on its own?

  - by larryq

  Hi everyone, I'm working on an ASP.Net 2.0 application and am having a strange issue involving the HttpContext User. It appears to be changing on its own when I go to a particular page/directory. All of our pages inherit from a base page. In that base page's Page_Load() method we run an authorization check to see if the user can see the page they're going to. We retrieve the user to check against with this code: GenericPrincipal objPrincipal = (GenericPrincipal)Context.User; When I go to this unusual directory the User value isn't me, it's some other username I've never heard of. This username isn't authorized to see these pages, so authorization fails. This mysterious directory isn't a virtual web, just a regular directory in our website, however I've noticed it has its own Web.Config file. I'm guessing that's a cause of the trouble here. My question is, how can I investigate this further, in determining what's changing the User value when I go to this directory?

  Read the article

• LINQ query needs either ascending or descending in the same query

  - by Sir Psycho

  Is there anyway this code can be refactored? The only difference is the order by part. Idealy I'd like to use a delegate/lamda expression so the code is reusable but I don't know how to conditionally add and remove the query operators OrderBy and OrderByDescending var linq = new NorthwindDataContext(); var query1 = linq.Customers .Where(c => c.ContactName.StartsWith("a")) .SelectMany(cus=>cus.Orders) .OrderBy(ord => ord.OrderDate) .Select(ord => ord.CustomerID); var query2 = linq.Customers .Where(c => c.ContactName.StartsWith("a")) .SelectMany(cus => cus.Orders) .OrderByDescending(ord => ord.OrderDate) .Select(ord => ord.CustomerID);

  Read the article

• How to Redirect Subdomains to Other Domain

  - by Codex73

  What I'm trying to accomplish with htaccess mod-rewrite: Redirect all sub-domains to new domain name w rewrite rule. e.g. test1.olddomain.com === test1.newdomain.com test2.olddomain.com === test2.newdomain.com test3.olddomain.com === test3.newdomain.com This is what I have so far which of course is wrong: Options +FollowSymLinks RewriteEngine on RewriteCond %{HTTP_HOST} ^olddomain\.com$ [NC] RewriteRule ^(.*)$ http://www.newdomain.com/$1 [R=301,L] RewriteCond %{HTTP_HOST} ^www\.olddomain\.com$ [NC] RewriteRule ^(.*) http://www.newdomain.com/$1 [R=301,L] RewriteRule [a-zA-Z]+\.olddomain.com$ http://$1.newdomain.com/ [R=301,L] Since I'm not a Regular Expression junkie just yet, I need your help... Thanks for any help you can give here. I know also we can compile these first two conditions into one. Note: The reason I don't redirect all domain using DNS is that a lot of directories need special rewrite rules in order to maintain positions on SEO.

  Read the article

• Should i use HttpResponse.End() for a fast webapp?

  - by acidzombie24

  HttpResponse.End() seems to throw an exception according to msdn. Right now i have the choice of returning a value to say end thread (it only goes 2 functions deep) or i can call end(). I know that throwing exceptions is significantly slower (read the comment for a C#/.NET test) so if i want a fast webapp should i consider not calling it when it is trivially easy to not call it? -edit- I do have a function call in certain functions and in the constructor in classes to ensure the user is logged in. So i call HttpResponse.End() in enough places although hopefully in regular site usage it doesn't occur too often.

  Read the article

• Making the shadow from a ScatterViewItem a different shape

  - by Vargen

  I am developing a program for Surface using Expression Blend and Visual Studio. I have a custom user control with an ellipse and a label in a grid. This will need to be placed in a scatterViewItem. My problem is that the scatterviewitem will cast a rectangle shaped shadow under the ellipse shaped content. I can disable the shadow completely, but is there any way to make the shadow inherit the shape from its parent? Or can i set the shape of the scatterviewItem itself in any way?

  Read the article

• Why do Pascal control structures appear to be inconsistent?

  - by 70Mike

  Most Pascal control structures make sense to me, like: for ... do {statement}; if (condition) then {statement}; while (condition) do {statement}; where the {statement} is either a single statement, or a begin ... end block. I have a problem with: repeat {statement-list} until (expression); try {statement-list} except {statement-list} end; Wouldn't it be better that repeat and try have the same general structure, accepting only a single statement or a begin ... end block, instead of having a statement-list that's not formally blocked with a begin and an end?

  Read the article

• Are there any other Java schedulers besides Quartz(FOSS) and Flux(Commercial)

  - by mP

  I am interested in finding out about other job scheduling packages besides Quartz and Flux. Given the plethora of web frameworks i find it perculiar that there is really only one scheduler. Are there others that perhaps are very much unknown/unpopular ? Spring Batch Not really a scheduling solution but rather a batch job coordinator etc. http://static.springsource.org/spring-batch/faq.html#schedulers How does Spring Batch differ from Quartz? Is there a place for them both in a solution? Spring Batch and Quartz have different goals. Spring Batch provides functionality for processing large volumes of data and Quartz provides functionality for scheduling tasks. So Quartz could complement Spring Batch, but are not excluding technologies. A common combination would be to use Quartz as a trigger for a Spring Batch job using a Cron expression and the Spring Core convenience SchedulerFactoryBean .

  Read the article

• Mapping a drop-down menu over an image

  - by Pieter

  I have a menu bar that is rotated slightly. Here are two buttons as an example: As a result, I can't use regular HTML to handle this. I need to use a <map> to put hyperlinks over the menu parts. (Or am I missing a killer CSS feature I don't know about?) I want to map drop-down menus to these buttons. This looks like a nice way to implement drop-down menus: http://javascript-array.com/scripts/simple_drop_down_menu/ However, this does not work on <map>s, I believe. Or am I wrong? Is there a different approach I can take to constructing drop-down menus for a menu bar that is not aligned horizontally?

  Read the article

• Spotlight search with PHP

  - by htf

  Hi. I want to add a spotlight search functionality - search results being displayed with rich contents like thumbnail etc in a drop down menu changing on each keyup event - just like the apple.com search - to a site, having data in MySQL InnoDB tables. The data is spread into separate tables for categories, help pages, blog pages and so on. The search script must take into account just a subset of columns. Since it seems to be a popular demand, I guess there are some PHP search engine projects (preferably open-source and with memcached support), which could be integrated into the existing system on the basis of regular exports of relevant data from the working db/tables. Are there any solutions out there? Which one would you recommend? Or maybe it would be better to implement it the other way around? Thanks

  Read the article

< Previous Page | 226 227 228 229 230 231 232 233 234 235 236 237  | Next Page >