Search Results

Search found 6651 results on 267 pages for 'description'.

Page 257/267 | < Previous Page | 253 254 255 256 257 258 259 260 261 262 263 264  | Next Page >

  • $_GET loading content before head tag instead of in specified div.

    - by s32ialx
    NOT EDITING BELOW BUT THANKS TO SOME REALLY NICE PEOPLE I CAN'T POST AN IMAGE ANYMORE BECAUSE I HAD a 15 Rep but NOW ONLY A 5 becuase my question wasn't what they wanted help with they gave me a neg rep. The problem is that the content loads it displays UNDER the div i placed #CONTENT# inside so the styles are being ignored and it's posting #CONTENT# outside the divs at positions 0,0 any suggestions? Found out whats happening by using "View Source" seems that it's putting all of the #CONTENT#, content that's being loaded in front of the <head> tag. Like this <doctype...> <div class="home"> \ blah blah #CONTENT# bot being loaded in correct specified area </div> / <head> <script src=""></script> </head> <body> <div class="header"></div> <div class="contents"> #CONTENT# < where content SHOULD load </div> <div class="footer"></div> </body> so anyone got a fix? OK so a better description I'll add relevant screen-shots Whats happening is /* file.class.php */ <?php $file = new file(); class file{ var $path = "templates/clean"; var $ext = "tpl"; function loadfile($filename){ return file_get_contents($this->path . "/" . $filename . "." . $this->ext); } function setcontent($content,$newcontent,$vartoreplace='#CONTENT#'){ $val = str_replace($vartoreplace,$newcontent,$content); return $val; } function p($content) { $v = $content; $v = str_replace('#CONTENT#','',$v); print $v; } } if(!isset($_GET['page'])){ // if not, lets load our index page(you can change home.php to whatever you want: include("main.txt"); // else $_GET['page'] was set so lets do stuff: } else { // lets first check if the file exists: if(file_exists($_GET['page'].'.txt')){ // and lets include that then: include($_GET['page'].'.txt'); // sorry mate, could not find it: } else { echo 'Sorry, could not find <strong>' . $_GET['page'] .'.txt</strong>'; } } ?> is calling for a file_get_contents at the bottom which I use in /* index.php */ <!DOCTYPE html PUBLIC "-//W3C//DTD XHTML 1.0 Transitional//EN" "http://www.w3.org/TR/xhtml1/DTD/xhtml1-transitional.dtd"> <html xmlns="http://www.w3.org/1999/xhtml" xml:lang="en" lang="en"> <?php include('classes/file.class.php'); // load the templates $header = $file->loadfile('header'); $body = $file->loadfile('body'); $footer = $file->loadfile('footer'); // fill body.tpl #CONTENT# slot with $content $body = $file->setcontent($body, $content); // cleanup and output the full page $file->p($header . $body . $footer); ?> and loads into /* body.tpl */ <div id="bodys"> <div id="bodt"></div> <div id="bodm"> <div id="contents"> #CONTENT# </div> </div> <div id="bodb"></div> </div> but the issue is as follows the $content loads properly img tags etc <h2> tags etc but CSS styling is TOTALY ignored for position width z-index etc. and as follows here's the screen-shot My Firefox Showing The Problem In Action REPOSTED DUE TO PEOPLE NOT HELPING AND JUST BEING ARROGANT AND GIVING NEGATIVE VOTES and not even saying a word. DO NOT COMMENT UNLESS YOU PLAN TO HELP god I'm a beginner and with you people giving me bad reviews this won't make me help you out when the chance comes.

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • WPF Some styles not applied on DataTemplate controls

    - by Martin
    Hi, I am trying to learn something about WPF and I am quite amazed by its flexibility. However, I have hit a problem with Styles and DataTemplates, which is little bit confusing. I have defined below test page to play around a bit with styles etc and found that the Styles defined in <Page.Resources> for Border and TextBlock are not applied in the DataTemplate, but Style for ProgressBar defined in exactly the same way is applied. Source code (I just use Kaxaml and XamlPadX to view the result) <Page xmlns="http://schemas.microsoft.com/winfx/2006/xaml/presentation" xmlns:x="http://schemas.microsoft.com/winfx/2006/xaml"> <Page.Resources> <Style TargetType="{x:Type Border}"> <Setter Property="Background" Value="SkyBlue"/> <Setter Property="BorderBrush" Value="Black"/> <Setter Property="BorderThickness" Value="2"/> <Setter Property="CornerRadius" Value="5"/> </Style> <Style TargetType="{x:Type TextBlock}"> <Setter Property="FontWeight" Value="Bold"/> </Style> <Style TargetType="{x:Type ProgressBar}"> <Setter Property="Height" Value="10"/> <Setter Property="Width" Value="100"/> <Setter Property="Foreground" Value="Red"/> </Style> <XmlDataProvider x:Key="TestData" XPath="/TestData"> <x:XData> <TestData xmlns=""> <TestElement> <Name>Item 1</Name> <Value>25</Value> </TestElement> <TestElement> <Name>Item 2</Name> <Value>50</Value> </TestElement> </TestData> </x:XData> </XmlDataProvider> <HierarchicalDataTemplate DataType="TestElement"> <Border Height="45" Width="120" Margin="5,5"> <StackPanel Orientation="Vertical" Margin="5,5" VerticalAlignment="Center" HorizontalAlignment="Center"> <TextBlock HorizontalAlignment="Center" Text="{Binding XPath=Name}"/> <ProgressBar Value="{Binding XPath=Value}"/> </StackPanel> </Border> </HierarchicalDataTemplate> </Page.Resources> <StackPanel Orientation="Horizontal" HorizontalAlignment="Center" VerticalAlignment="Center"> <StackPanel Orientation="Vertical" VerticalAlignment="Center"> <Border Height="45" Width="120" Margin="5,5"> <StackPanel Orientation="Vertical" VerticalAlignment="Center" HorizontalAlignment="Center"> <TextBlock HorizontalAlignment="Center" Text="Item 1"/> <ProgressBar Value="25"/> </StackPanel> </Border> <Border Height="45" Width="120" Margin="5,5"> <StackPanel Orientation="Vertical" VerticalAlignment="Center" HorizontalAlignment="Center"> <TextBlock HorizontalAlignment="Center" Text="Item 2"/> <ProgressBar Value="50"/> </StackPanel> </Border> </StackPanel> <ListBox Margin="10,10" Width="140" ItemsSource="{Binding Source={StaticResource TestData}, XPath=TestElement}"/> </StackPanel> </Page> I suspect it has something to do with default styles etc, but more puzzling is why some Styles are applied and some not. I cannot find an easy explanation for above anywhere and thus would like to ask if someone would be kind enough to explain this behaviour in lamens' terms with possible links to technical description, i.e. to MSDN or so. Thanks in advance for you support!

    Read the article

  • Help needed on an SQL configuration problem.

    - by user321048
    I have been banging my head with this one more the two weeks, and still don't know what the problem is ( I can't narrow it down). The problem is the following. I have a solution with 3 project in it all written in c# and I with LINQ. One project is the main web site, the other is the data layer (communication with the database) and the third one is a custom little CMS. The problem is the following: On a hosting provider when I publish the site it all works perfectly, but this site was needed to be hosted on the client server so I needed to do that. But the problem is that I also needed to configure the client server, because they don't have an Administrator employed (I know, I know ;) ). For the first time I some how managed, to set it up but a problem appear. My main web site is working just as it suppose to be - it reads (communicates with) the database, but My CMS is not. It shows the first log in page, but after that when I try to log in it throws the following error: A network-related or instance-specific error occurred while establishing a connection to SQL Server. The server was not found or was not accessible. Verify that the instance name is correct and that SQL Server is configured to allow remote connections. (provider: TCP Provider, error: 0 - A connection attempt failed because the connected party did not properly respond after a period of time, or established connection failed because connected host has failed to respond.) Description: An unhandled exception occurred during the execution of the current web request. Please review the stack trace for more information about the error and where it originated in the code. Exception Details: System.Data.SqlClient.SqlException: A network-related or instance-specific error occurred while establishing a connection to SQL Server. The server was not found or was not accessible. Verify that the instance name is correct and that SQL Server is configured to allow remote connections. (provider: TCP Provider, error: 0 - A connection attempt failed because the connected party did not properly respond after a period of time, or established connection failed because connected host has failed to respond.) Source Error: An unhandled exception was generated during the execution of the current web request. Information regarding the origin and location of the exception can be identified using the exception stack trace below. Stack Trace: [SqlException (0x80131904): A network-related or instance-specific error occurred while establishing a connection to SQL Server. The server was not found or was not accessible. Verify that the instance name is correct and that SQL Server is configured to allow remote connections. (provider: TCP Provider, error: 0 - A connection attempt failed because the connected party did not properly respond after a period of time, or established connection failed because connected host has failed to respond.)] System.Data.SqlClient.SqlInternalConnection.OnError(SqlException exception, Boolean breakConnection) +4846887 System.Data.SqlClient.TdsParser.ThrowExceptionAndWarning(TdsParserStateObject stateObj) +194 System.Data.SqlClient.TdsParser.Connect(ServerInfo serverInfo, SqlInternalConnectionTds connHandler, Boolean ignoreSniOpenTimeout, Int64 timerExpire, Boolean encrypt, Boolean trustServerCert, Boolean integratedSecurity, SqlConnection owningObject) +4860189 System.Data.SqlClient.SqlInternalConnectionTds.AttemptOneLogin(ServerInfo serverInfo, String newPassword, Boolean ignoreSniOpenTimeout, Int64 timerExpire, SqlConnection owningObject) +90 System.Data.SqlClient.SqlInternalConnectionTds.LoginNoFailover(String host, String newPassword, Boolean redirectedUserInstance, SqlConnection owningObject, SqlConnectionString connectionOptions, Int64 timerStart) +342 System.Data.SqlClient.SqlInternalConnectionTds.OpenLoginEnlist(SqlConnection owningObject, SqlConnectionString connectionOptions, String newPassword, Boolean redirectedUserInstance) +221 System.Data.SqlClient.SqlInternalConnectionTds..ctor(DbConnectionPoolIdentity identity, SqlConnectionString connectionOptions, Object providerInfo, String newPassword, SqlConnection owningObject, Boolean redirectedUserInstance) +189 System.Data.SqlClient.SqlConnectionFactory.CreateConnection(DbConnectionOptions options, Object poolGroupProviderInfo, DbConnectionPool pool, DbConnection owningConnection) +185 System.Data.ProviderBase.DbConnectionFactory.CreatePooledConnection(DbConnection owningConnection, DbConnectionPool pool, DbConnectionOptions options) +31 System.Data.ProviderBase.DbConnectionPool.CreateObject(DbConnection owningObject) +433 System.Data.ProviderBase.DbConnectionPool.UserCreateRequest(DbConnection owningObject) +66 System.Data.ProviderBase.DbConnectionPool.GetConnection(DbConnection owningObject) +499 System.Data.ProviderBase.DbConnectionFactory.GetConnection(DbConnection owningConnection) +65 System.Data.ProviderBase.DbConnectionClosed.OpenConnection(DbConnection outerConnection, DbConnectionFactory connectionFactory) +117 System.Data.SqlClient.SqlConnection.Open() +122 System.Data.Linq.SqlClient.SqlConnectionManager.UseConnection(IConnectionUser user) +44 System.Data.Linq.SqlClient.SqlProvider.get_IsSqlCe() +45 System.Data.Linq.SqlClient.SqlProvider.InitializeProviderMode() +20 System.Data.Linq.SqlClient.SqlProvider.System.Data.Linq.Provider.IProvider.Execute(Expression query) +57 System.Data.Linq.DataQuery`1.System.Linq.IQueryProvider.Execute(Expression expression) +23 System.Linq.Queryable.Count(IQueryable`1 source) +240 CMS.Security.UserProfile.LoginUser() in C:\Documents and Settings\Dimitar\Desktop\New Mepso Final 08_04\CMS\Classes\UserProfile.cs:132 CMS.Default.Login1_Authenticate(Object sender, AuthenticateEventArgs e) in C:\Documents and Settings\Dimitar\Desktop\New Mepso Final 08_04\CMS\Default.aspx.cs:37 System.Web.UI.WebControls.Login.OnAuthenticate(AuthenticateEventArgs e) +108 System.Web.UI.WebControls.Login.AttemptLogin() +115 System.Web.UI.WebControls.Login.OnBubbleEvent(Object source, EventArgs e) +101 System.Web.UI.Control.RaiseBubbleEvent(Object source, EventArgs args) +37 System.Web.UI.WebControls.Button.OnCommand(CommandEventArgs e) +118 System.Web.UI.WebControls.Button.RaisePostBackEvent(String eventArgument) +166 System.Web.UI.WebControls.Button.System.Web.UI.IPostBackEventHandler.RaisePostBackEvent(String eventArgument) +10 System.Web.UI.Page.RaisePostBackEvent(IPostBackEventHandler sourceControl, String eventArgument) +13 System.Web.UI.Page.RaisePostBackEvent(NameValueCollection postData) +36 System.Web.UI.Page.ProcessRequestMain(Boolean includeStagesBeforeAsyncPoint, Boolean includeStagesAfterAsyncPoint) +1565 Maybe this is a dumb question, but I cannot find the root of the problem, let alone the solution. So far I have tried the following: -setting time out on connection string to a higher value -configuration and after that turning off server firewall -checking the connection string over and over again (they are the same for all three projects and are saved in web.config) Important notes: I have tried executing the project from VS2008 with a connection string to the same database and the results are the same. That's why I think the problem is the SQL Server 2005 and not the IIS7. Any bit of information is more then welcomed.

    Read the article

  • (C++) Linking with namespaces causes duplicate symbol error

    - by user577072
    Hello. For the past few days, I have been trying to figure out how to link the files for a CLI gaming project I have been working on. There are two halves of the project, the Client and the Server code. The client needs two libraries I've made. The first is a general purpose game board. This is split between GameEngine.h and GameEngine.cpp. The header file looks something like this namespace gfdGaming { // struct sqr_size { // Index x; // Index y; // }; typedef struct { Index x, y; } sqr_size; const sqr_size sPos = {1, 1}; sqr_size sqr(Index x, Index y); sqr_size ePos; class board { // Prototypes / declarations for the class } } And the CPP file is just giving everything content #include "GameEngine.h" type gfdGaming::board::functions The client also has game-specific code (in this case, TicTacToe) split into declarations and definitions (TTT.h, Client.cpp). TTT.h is basically #include "GameEngine.h" #define TTTtar "localhost" #define TTTport 2886 using namespace gfdGaming; void* turnHandler(void*); namespace nsTicTacToe { GFDCON gfd; const char X = 'X'; const char O = 'O'; string MPhostname, mySID; board TTTboard; bool PlayerIsX = true, isMyTurn; char Player = X, Player2 = O; int recon(string* datHolder = NULL, bool force = false); void initMP(bool create = false, string hn = TTTtar); void init(); bool isTie(); int turnPlayer(Index loc, char lSym = Player); bool checkWin(char sym = Player); int mainloop(); int mainloopMP(); }; // NS I made the decision to put this in a namespace to group it instead of a class because there are some parts that would not work well in OOP, and it's much easier to implement later on. I have had trouble linking the client in the past, but this setup seems to work. My server is also split into two files, Server.h and Server.cpp. Server.h contains exactly: #include "../TicTacToe/TTT.h" // Server needs a full copy of TicTacToe code class TTTserv; struct TTTachievement_requirement { Index id; Index loc; bool inUse; }; struct TTTachievement_t { Index id; bool achieved; bool AND, inSameGame; bool inUse; bool (*lHandler)(TTTserv*); char mustBeSym; int mustBePlayer; string name, description; TTTachievement_requirement steps[safearray(8*8)]; }; class achievement_core_t : public GfdOogleTech { public: // May be shifted to private TTTachievement_t list[safearray(8*8)]; public: achievement_core_t(); int insert(string name, string d, bool samegame, bool lAnd, int lSteps[8*8], int mbP=0, char mbS=0); }; struct TTTplayer_t { Index id; bool inUse; string ip, sessionID; char sym; int desc; TTTachievement_t Ding[8*8]; }; struct TTTgame_t { TTTplayer_t Player[safearray(2)]; TTTplayer_t Spectator; achievement_core_t achievement_core; Index cTurn, players; port_t roomLoc; bool inGame, Xused, Oused, newEvent; }; class TTTserv : public gSserver { TTTgame_t Game; TTTplayer_t *cPlayer; port_t conPort; public: achievement_core_t *achiev; thread threads[8]; int parseit(string tDat, string tsIP); Index conCount; int parseit(string tDat, int tlUser, TTTplayer_t** retval); private: int parseProto(string dat, string sIP); int parseProto(string dat, int lUser); int cycleTurn(); void setup(port_t lPort = 0, bool complete = false); public: int newEvent; TTTserv(port_t tlPort = TTTport, bool tcomplete = true); TTTplayer_t* userDC(Index id, Index force = false); int sendToPlayers(string dat, bool asMSG = false); int mainLoop(volatile bool *play); }; // Other void* userHandler(void*); void* handleUser(void*); And in the CPP file I include Server.h and provide main() and the contents of all functions previously declared. Now to the problem at hand I am having issues when linking my server. More specifically, I get a duplicate symbol error for every variable in nsTicTacToe (and possibly in gfdGaming as well). Since I need the TicTacToe functions, I link Client.cpp ( without main() ) when building the server ld: duplicate symbol nsTicTacToe::PlayerIsX in Client.o and Server.o collect2: ld returned 1 exit status Command /Developer/usr/bin/g++-4.2 failed with exit code 1 It stops once a problem is encountered, but if PlayerIsX is removed / changed temporarily than another variable causes an error Essentially, I am looking for any advice on how to better organize my code to hopefully fix these errors. Disclaimers: -I apologize in advance if I provided too much or too little information, as it is my first time posting -I have tried using static and extern to fix these problems, but apparently those are not what I need Thank you to anyone who takes the time to read all of this and respond =)

    Read the article

  • CoreData: Same predicate (IN) returns different fetched results after a Save operation

    - by Jason Lee
    I have code below: NSArray *existedTasks = [[TaskBizDB sharedInstance] fetchTasksWatchedByMeOfProject:projectId]; [context save:&error]; existedTasks = [[TaskBizDB sharedInstance] fetchTasksWatchedByMeOfProject:projectId]; NSArray *allTasks = [[TaskBizDB sharedInstance] fetchTasksOfProject:projectId]; First line returns two objects; Second line save the context; Third line returns just one object, which is contained in the 'two objects' above; And the last line returns 6 objects, containing the 'two objects' returned at the first line. The fetch interface works like below: WXModel *model = [WXModel modelWithEntity:NSStringFromClass([WQPKTeamTask class])]; NSPredicate *predicate = [NSPredicate predicateWithFormat:@"(%@ IN personWatchers) AND (projectId == %d)", currentLoginUser, projectId]; [model setPredicate:predicate]; NSArray *fetchedTasks = [model fetch]; if (fetchedTasks.count == 0) return nil; return fetchedTasks; What confused me is that, with the same fetch request, why return different results just after a save? Here comes more detail: The 'two objects' returned at the first line are: <WQPKTeamTask: 0x1b92fcc0> (entity: WQPKTeamTask; id: 0x1b9300f0 <x-coredata://CFFD3F8B-E613-4DE8-85AA-4D6DD08E88C5/WQPKTeamTask/p9> ; data: { projectId = 372004; taskId = 338001; personWatchers = ( "0xf0bf440 <x-coredata://CFFD3F8B-E613-4DE8-85AA-4D6DD08E88C5/WWPerson/p1>" ); } <WQPKTeamTask: 0xf3f6130> (entity: WQPKTeamTask; id: 0xf3cb8d0 <x-coredata://CFFD3F8B-E613-4DE8-85AA-4D6DD08E88C5/WQPKTeamTask/p11> ; data: { projectId = 372004; taskId = 340006; personWatchers = ( "0xf0bf440 <x-coredata://CFFD3F8B-E613-4DE8-85AA-4D6DD08E88C5/WWPerson/p1>" ); } And the only one object returned at third line is: <WQPKTeamTask: 0x1b92fcc0> (entity: WQPKTeamTask; id: 0x1b9300f0 <x-coredata://CFFD3F8B-E613-4DE8-85AA-4D6DD08E88C5/WQPKTeamTask/p9> ; data: { projectId = 372004; taskId = 338001; personWatchers = ( "0xf0bf440 <x-coredata://CFFD3F8B-E613-4DE8-85AA-4D6DD08E88C5/WWPerson/p1>" ); } Printing description of allTasks: <_PFArray 0xf30b9a0>( <WQPKTeamTask: 0xf3ab9d0> (entity: WQPKTeamTask; id: 0xf3cda40 <x-coredata://CFFD3F8B-E613-4DE8-85AA-4D6DD08E88C5/WQPKTeamTask/p6> ; data: <fault>), <WQPKTeamTask: 0xf315720> (entity: WQPKTeamTask; id: 0xf3c23a0 <x-coredata://CFFD3F8B-E613-4DE8-85AA-4D6DD08E88C5/WQPKTeamTask/p7> ; data: <fault>), <WQPKTeamTask: 0xf3a1ed0> (entity: WQPKTeamTask; id: 0xf3cda30 <x-coredata://CFFD3F8B-E613-4DE8-85AA-4D6DD08E88C5/WQPKTeamTask/p8> ; data: <fault>), <WQPKTeamTask: 0x1b92fcc0> (entity: WQPKTeamTask; id: 0x1b9300f0 <x-coredata://CFFD3F8B-E613-4DE8-85AA-4D6DD08E88C5/WQPKTeamTask/p9> ; data: { projectId = 372004; taskId = 338001; personWatchers = ( "0xf0bf440 <x-coredata://CFFD3F8B-E613-4DE8-85AA-4D6DD08E88C5/WWPerson/p1>" ); }), <WQPKTeamTask: 0xf325e50> (entity: WQPKTeamTask; id: 0xf343820 <x-coredata://CFFD3F8B-E613-4DE8-85AA-4D6DD08E88C5/WQPKTeamTask/p10> ; data: <fault>), <WQPKTeamTask: 0xf3f6130> (entity: WQPKTeamTask; id: 0xf3cb8d0 <x-coredata://CFFD3F8B-E613-4DE8-85AA-4D6DD08E88C5/WQPKTeamTask/p11> ; data: { projectId = 372004; taskId = 340006; personWatchers = ( "0xf0bf440 <x-coredata://CFFD3F8B-E613-4DE8-85AA-4D6DD08E88C5/WWPerson/p1>" ); }) ) UPDATE 1 If I call the same interface fetchTasksWatchedByMeOfProject: in: #pragma mark - NSFetchedResultsController Delegate - (void)controllerDidChangeContent:(NSFetchedResultsController *)controller { I will get 'two objects' as well. UPDATE 2 I've tried: NSPredicate *predicate = [NSPredicate predicateWithFormat:@"(ANY personWatchers == %@) AND (projectId == %d)", currentLoginUser, projectId]; NSPredicate *predicate = [NSPredicate predicateWithFormat:@"(ANY personWatchers.personId == %@) AND (projectId == %d)", currentLoginUserId, projectId]; Still the same result. UPDATE 3 I've checked the save:&error, error is nil.

    Read the article

  • C++ run error: pointer being freed was not allocated

    - by Dale Reves
    I'm learning c++ and am working on a program that keeps giving me a 'pointer being freed was not allocated' error. It's a grocery store program that inputs data from a txt file, then user can enter item# & qty. I've read through similar questions but what's throwing me off is the 'pointer' issue. I would appreciate if someone could take a look and help me out. I'm using Netbeans IDE 7.2 on a Mac. I'll just post the whole piece I have so far. Thx. #include <iostream> #include <fstream> #include <string> #include <vector> using namespace std; class Product { public: // PLU Code int getiPluCode() { return iPluCode; } void setiPluCode( int iTempPluCode) { iPluCode = iTempPluCode; } // Description string getsDescription() { return sDescription; } void setsDescription( string sTempDescription) { sDescription = sTempDescription; } // Price double getdPrice() { return dPrice; } void setdPrice( double dTempPrice) { dPrice = dTempPrice; } // Type..weight or unit int getiType() { return iType; } void setiType( int iTempType) { iType = iTempType; } // Inventory quantity double getdInventory() { return dInventory; } void setdInventory( double dTempInventory) { dInventory = dTempInventory; } private: int iPluCode; string sDescription; double dPrice; int iType; double dInventory; }; int main () { Product paInventory[21]; // Create inventory array Product paPurchase[21]; // Create customer purchase array // Constructor to open inventory input file ifstream InputInventory ("inventory.txt", ios::in); //If ifstream could not open the file if (!InputInventory) { cerr << "File could not be opened" << endl; exit (1); }//end if int x = 0; while (!InputInventory.eof () ) { int iTempPluCode; string sTempDescription; double dTempPrice; int iTempType; double dTempInventory; InputInventory >> iTempPluCode >> sTempDescription >> dTempPrice >> iTempType >> dTempInventory; paInventory[x].setiPluCode(iTempPluCode); paInventory[x].setsDescription(sTempDescription); paInventory[x].setdPrice(dTempPrice); paInventory[x].setiType(iTempType); paInventory[x].setdInventory(dTempInventory); x++; } bool bQuit = false; //CREATE MY TOTAL VARIABLE HERE! int iUserItemCount; do { int iUserPLUCode; double dUserAmount; double dAmountAvailable; int iProductIndex = -1; //CREATE MY SUBTOTAL VARIABLE HERE! while(iProductIndex == -1) { cout<<"Please enter the PLU Code of the product."<< endl; cin>>iUserPLUCode; for(int i = 0; i < 21; i++) { if(iUserPLUCode == paInventory[i].getiPluCode()) { dAmountAvailable = paInventory[i].getdInventory(); iProductIndex = i; } } //PLU code entry validation if(iProductIndex == -1) { cout << "You have entered an invalid PLU Code."; } } cout<<"Enter the quantity to buy.\n"<< "There are "<< dAmountAvailable << "available.\n"; cin>> dUserAmount; while(dUserAmount > dAmountAvailable) { cout<<"That's too many, please try again"; cin>>dUserAmount; } paPurchase[iUserItemCount].setiPluCode(iUserPLUCode);// Array of objects function calls paPurchase[iUserItemCount].setdInventory(dUserAmount); paPurchase[iUserItemCount].setdPrice(paInventory[iProductIndex].getdPrice()); paInventory[iProductIndex].setdInventory( paInventory[iProductIndex].getdInventory() - dUserAmount ); iUserItemCount++; cout <<"Are you done purchasing items? Enter 1 for yes and 0 for no.\n"; cin >> bQuit; //NOTE: Put Amount * quantity for subtotal //NOTE: Put code to update subtotal (total += subtotal) // NOTE: Need to create the output txt file! }while(!bQuit); return 0; }

    Read the article

  • Help Writing Input Data to Database With Wordpress Plugin

    - by HollerTrain
    Hi I am making a wordpress plugin where I need the Admin to enter data into a database table. I am able to install the db table when the Plugin is activated, however I can't figure out how to save the user input. I've asked on the WP forums but they're dead... Any experienced guru who can lend some guidance would be greatly appreciated. <?php /******************************************************************* * INSTALL DB TABLE - ONLY AT RUN TIME * *******************************************************************/ function ed_xml_install() { global $wpdb; $ed_xml_data = $wpdb->prefix . "ed_xml_data"; if($wpdb->get_var("SHOW TABLES LIKE '$ed_xml_data'") != $ed_xml_data) { $sql = "CREATE TABLE " . ed_xml_data . " ( id mediumint(9) NOT NULL AUTO_INCREMENT, name tinytext NOT NULL, address text NOT NULL, url VARCHAR(55) NOT NULL, phone bigint(11) DEFAULT '0' NOT NULL, UNIQUE KEY id (id) );"; require_once(ABSPATH . 'wp-admin/includes/upgrade.php'); dbDelta($sql); $name = "Example Business Name"; $address = "1234 Example Street"; $url = "http://www.google.com"; $phone = "523-3232-323232"; $insert = "INSERT INTO " . ed_xml_data . " (phone, name, address, url) " . "VALUES ('" . phone() . "','" . $wpdb->escape($name) . "','" . $wpdb->escape($address) . "', '" . $wpdb->escape($url) . "')"; $results = $wpdb->query( $insert ); } } //call the install hook register_activation_hook(__FILE__,'ed_xml_install'); /******************************************************************* * CREATE MENU, CREATE MENU CONTENT * *******************************************************************/ if ( is_admin() ){ /* place it under the ED menu */ //TODO $allowed_group = ''; /* Call the html code */ add_action('admin_menu', 'ed_xmlcreator_admin_menu'); function ed_xmlcreator_admin_menu() { add_options_page('ED XML Creator', 'ED XML Creator', 'administrator', 'ed_xml_creator', 'ed_xmlcreator_html_page'); } } /******************************************************************* * CONTENT OF MENU CONTENT * *******************************************************************/ function ed_xmlcreator_html_page() { <div> <h2>Editors Deal XML Options</h2> <p>Fill in the below information which will get passed to the .XML file.</p> <p>[<a href="" title="view XML file">view XML file</a>]</p> <form method="post" action="options.php"> <?php wp_nonce_field('update-options'); ?> <table width="510"> <!-- title --> <tr valign="top"> <th width="92" scope="row">Deal URL</th> <td width="406"> <input name="url" type="text" id="url" value="<?php echo get_option('url'); ?>" /> </td> </tr> <!-- description --> <tr valign="top"> <th width="92" scope="row">Deal Address</th> <td width="406"> <input name="address" type="text" id="address" value="<?php echo get_option('address'); ?>" /> </td> </tr> <!-- business name --> <tr valign="top"> <th width="92" scope="row">Business Phone</th> <td width="406"> <input name="phone" type="text" id="phone" value="<?php echo get_option('phone'); ?>" /> </td> </tr> <!-- address --> <tr valign="top"> <th width="92" scope="row">Business Name</th> <td width="406"> <input name="name" type="text" id="name" value="<?php echo get_option('name'); ?>" /> </td> </tr> </table> <input type="hidden" name="action" value="update" /> <input type="hidden" name="page_options" value="hello_world_data" /> <p> <input type="submit" value="<?php _e('Save Changes') ?>" /> </p> </form> </div> ?>

    Read the article

  • jQuery .closest returns undefined

    - by Andy Holmes
    I've got the code below which works fine, however the jquery to add the items doesnt find the data-parent-room value and just returns undefined. This is the only thing not working :( HTML: <div id="inventoryRooms"> <!--BOX SHART--> <div class="widget box formHolder" data-parent-room="1"> <!--ROOM NAME--> <form class="widget-header rooms"> <input type="text" placeholder="Type Room name" name="roomName[]" class="form-input add-room-input input-width-xxlarge"> <input type="hidden" class="roomId" name="roomId[]"> <input type="hidden" class="inventoryId" name="inventoryId[]" value="<?=$_GET['inventory_id']?>"> <div class="toolbar no-padding"> <div class="btn-group"> <span class="btn saveRoom"><i class="icon-ok"></i> Save Room</span> </div> </div> </form> <!--/END--> <!--GENERIC ROW TITLES--> <div class="widget-header header-margin hide"> <div class="row row-title"> <div class="col-md-3"><h5>ITEM</h5></div> <div class="col-md-3"><h5>DESCRIPTION</h5></div> <div class="col-md-3"><h5>CONDITION</h5></div> <div class="col-md-2"><h5>PHOTOGRAPH</h5></div> <div class="col-md-1 align-center"><h5><i class="icon-cog"> </i></h5></div> </div> </div> <!--/END--> <!--ADD ITEM--> <div class="items"> </div> <!--/END--> <div class="toolbar-small"> <div class="btn-group"> <span class="btn addItem"><i class="icon-plus"></i> Add Item</span> <span data-toggle="dropdown" class="btn dropdown-toggle"><i class="icon-gear"></i> Options<span class="button-space"></span><i class="icon-angle-down"></i></span> <ul class="dropdown-menu pull-right"> <li><a href="#"><i class="icon-trash"></i> Delete Room</a></li> </ul> </div> </div> </div> </div> jQuery: $(document).on('click','.addItem', function(){ $('<!--ROW START-->\ <form class="widget-content item">\ <div class="row">\ <div class="col-md-3"><input type="text" class="form-control" name="itemName[]"></div>\ <div class="col-md-3"><textarea class="auto form-control" name="itemDescription[]" cols="20" rows="1" style="word-wrap: break-word; resize: vertical;"></textarea></div>\ <div class="col-md-3"><textarea class="auto form-control" name="itemCondition[]" cols="20" rows="1" style="word-wrap: break-word; resize: vertical;"></textarea></div>\ <input type="hidden" class="itemId" name="itemId[]" value="">\ <input type="hidden" name="itemInventoryId[]" value="<?=$_GET["inventory_id"]?>">\ <input type="hidden" name="itemParent[]" value="'+$(this).closest().attr('data-parent-room')+'">\ <div class="col-md-2">\ <div class="fileinput-holder input-group">\ <input id="fileupload" type="file" name="files[]" data-url="uploads/">\ </div>\ </div>\ <div class="col-md-1 align-center"><i class="save icon-ok large"> </i>&nbsp;&nbsp;&nbsp;<i class="delete icon-trash large"> </i></div>\ </div>\ </form>\ <!--/ROW END-->').fadeIn(500).appendTo($(this).parents().siblings('.items')); $(this).parent().parent().siblings('.widget-header, .header-margin, .hide').removeClass('hide').fadeIn(); }); Like i say, it all works fine apart from that damn data-parent-room value. Any help is appreciated! using jQuery 1.10.1

    Read the article

  • Jquery Serialize data

    - by Richard
    So I have several text boxes, drop down menus, and radio options on this form. When the user clicks submit i want to save ALL that information so I can put it into a database. So this is all the form's inputs <div id="reg2a"> First Name: <br/><input type="text" name="fname" /> <br/> Last Name: <br/><input type="text" name="lname" /> <br/> Address: <br/><input type="text" name="address" /> <br/> City: <br/><input type="text" name="city" /> <br/> State: <br/><input type="text" name="state" /> <br/> Zip Code: <br/><input type="text" name="zip" /> <br/> Phone Number: <br/><input type="text" name="phone" /> <br/> Fax: <br/><input type="text" name="fax" /> <br/> Email: <br/><input type="text" name="email" /> <br/> Ethnicity: <i>Used only for grant reporting purposes</i> <br/><input type="text" name="ethnicity" /> <br/><br/> Instutional Information Type (select the best option) <br/> <select name="iitype"> <option value="none">None</option> <option value="uni">University</option> <option value="commorg">Community Organization</option> </select> <br/><br/> Number of sessions willing to present: <select id="vennum_select" name="vnum"> <?php for($i=0;$i<=3;$i++) { ?> <option value="<?php echo $i ?>"><?php echo $i ?></option> <?php } ?><br/> </select><br/> Number of tables requested: <select id="tabnum_select" name="tnum"> <?php for($i=1;$i<=3;$i++) { ?> <option value="<?php echo $i ?>"><?php echo $i ?></option> <?php } ?> </select><br/><br/> Awarding of a door prize during the conference will result in a reduction in the cost of your first table. <br/><br/> I am providing a door prize for delivery during the conference of $75 or more <select id="prize_select" name="pnum"> <option value="0">No</option> <option value="1">Yes</option> </select><br/> Prize name: <input type="text" name="prize_name" /><br/> Description: <input type="text" name="descr" /><br/> Value: <input type="text" name="retail" /><br/><br/> Name of Institution: <br/><input type="text" name="institution" /> <br/><br/> Type (select the best option) <br/> <select name="type"> <option value="none">None</option> <option value="k5">K-5</option> <option value="k8">K-8</option> <option value="68">6-8</option> <option value="912">9-12</option> </select> <br/><br/> Address: <br/><input type="text" name="address_sch" /> <br/> City: <br/><input type="text" name="city_sch" /> <br/> State: <br/><input type="text" name="state_sch" /> <br/> Zip Code: <br/><input type="text" name="zip_sch" /> <br/> <form name="frm2sub" id="frm2sub" action="page3.php" method="post"> <input type="submit" name="submit" value="Submit" id="submit" /> </form> </div> This is my jquery function: $("#frm2sub").submit( function() { var values = {}; values["fname"] = $("#fname").val(); }); I can do this for each one of the input boxes but I want to give all this data to the next page. So how do I put this array into $_POST? Btw, I've tried doing var data = $("#reg2a").serialize(); and var data = $(document).serialize(); Data ended up being empty. Any ideas? Thanks

    Read the article

  • c++ to vb.net , problem with callback function

    - by johan
    I'm having a hard time here trying to find a solution for my problem. I'm trying to convert a client API funktion from C++ to VB.NET, and i think have some problems with the callback function. parts of the C++ code: typedef struct{ BYTE m_bRemoteChannel; BYTE m_bSendMode; BYTE m_nImgFormat; // =0 cif ; = 1 qcif char *m_sIPAddress; char *m_sUserName; char *m_sUserPassword; BOOL m_bUserCheck; HWND m_hShowVideo; }CLIENT_VIDEOINFO, *PCLIENT_VIDEOINFO; CPLAYER_API LONG __stdcall MP4_ClientStart(PCLIENT_VIDEOINFO pClientinfo,void(CALLBACK *ReadDataCallBack)(DWORD nPort,UCHAR *pPacketBuffer,DWORD nPacketSize)); void CALLBACK ReadDataCallBack(DWORD nPort,UCHAR *pPacketBuffer,DWORD nPacketSize) { TRACE("%d\n",nPacketSize); } ..... aa5.m_sUserName = "123"; aa5.m_sUserPassword="w"; aa5.m_bUserCheck = TRUE; MP4_ClientSetTTL(64); nn1 = MP4_ClientStart(&aa5,ReadDataCallBack); if (nn1 == -1) { MessageBox("error"); return; } SDK description: MP4_ClientStart This function starts a connection. The format of the call is: LONG __stdcall MP4_ClientStart(PCLIENT_VIDEOINFO pClientinfo, void(*ReadDataCallBack)(DWORD nChannel,UCHAR *pPacketBuffer,DWORD nPacketSize)) Parameters pClientinfo holds the information. of this connection. nChannel holds the channel of card. pPacketBuffer holds the pointer to the receive buffer. nPacketSize holds the length of the receive buffer. Return Values If the function succeeds the return value is the context of this connection. If the function fails the return value is -1. Remarks typedef struct{ BYTE m_bRemoteChannel; BYTE m_bSendMode; BYTE m_bImgFormat; char *m_sIPAddress; char *m_sUserName; char *m_sUserPassword; BOOL m_bUserCheck; HWND m_hShowVideo; } CLIENT_VIDEOINFO, * PCLIENT_VIDEOINFO; m_bRemoteChannel holds the channel which the client wants to connect to. m_bSendMode holds the network mode of the connection. m_bImgFormat : Image format, 0 is main channel video, 1 is sub channel video m_sIPAddress holds the IP address of the server. m_sUserName holds the user’s name. m_sUserPassword holds the user’s password. m_bUserCheck holds the value whether sends the user’s name and password or not. m_hShowVideo holds Handle for this video window. If m_hShowVideo holds NULL, the client can be record only without decoder. If m_bUserCheck is FALSE, we will send m_sUserName and m_sUserPassword as NULL, else we will send each 50 bytes. The length of m_sIPAddress and m_sUserName must be more than 50 bytes. ReadDataCallBack: When the library receives a packet from a server, this callback is called. My VB.Net code: Imports System.Runtime.InteropServices Public Class Form1 Const WM_USER = &H400 Public Structure CLIENT_VIDEOINFO Public m_bRemoteChannel As Byte Public m_bSendMode As Byte Public m_bImgFormat As Byte Public m_sIPAddress As String Public m_sUserName As String Public m_sUserPassword As String Public m_bUserCheck As Boolean Public m_hShowVideo As Long 'hWnd End Structure Public Declare Function MP4_ClientSetNetPort Lib "hikclient.dll" (ByVal dServerPort As Integer, ByVal dClientPort As Integer) As Boolean Public Declare Function MP4_ClientStartup Lib "hikclient.dll" (ByVal nMessage As UInteger, ByVal hWnd As System.IntPtr) As Boolean <DllImport("hikclient.dll")> Public Shared Function MP4_ClientStart(ByVal Clientinfo As CLIENT_VIDEOINFO, ByRef ReadDataCallBack As CALLBACKdel) As Long End Function Public Delegate Sub CALLBACKdel(ByVal nPort As Long, <MarshalAs(UnmanagedType.LPArray)> ByRef pPacketBuffer As Byte(), ByVal nPacketSize As Long) Public Sub CALLBACK(ByVal nPort As Long, <MarshalAs(UnmanagedType.LPArray)> ByRef pPacketBuffer As Byte(), ByVal nPacketSize As Long) End Sub Public mydel As New CALLBACKdel(AddressOf CALLBACK) Private Sub Form1_Load(ByVal sender As System.Object, ByVal e As System.EventArgs) Handles MyBase.Load Dim Clientinfo As New CLIENT_VIDEOINFO() Clientinfo.m_bRemoteChannel = 0 Clientinfo.m_bSendMode = 0 Clientinfo.m_bImgFormat = 0 Clientinfo.m_sIPAddress = "193.168.1.100" Clientinfo.m_sUserName = "1" Clientinfo.m_sUserPassword = "a" Clientinfo.m_bUserCheck = False Clientinfo.m_hShowVideo = Me.Handle 'Nothing MP4_ClientSetNetPort(850, 850) MP4_ClientStartup(WM_USER + 1, Me.Handle) MP4_ClientStart(Clientinfo, mydel) End Sub End Class here is some other examples of the code in: C# http://blog.csdn.net/nenith1981/archive/2007/09/17/1787692.aspx VB ://read.pudn.com/downloads70/sourcecode/graph/250633/MD%E5%AE%A2%E6%88%B7%E7%AB%AF%28VB%29/hikclient.bas__.htm ://read.pudn.com/downloads70/sourcecode/graph/250633/MD%E5%AE%A2%E6%88%B7%E7%AB%AF%28VB%29/Form1.frm__.htm Delphi ://read.pudn.com/downloads91/sourcecode/multimedia/streaming/349759/Delphi_client/Unit1.pas__.htm

    Read the article

  • System.ServiceModel.Channels.MessageHeader Error

    - by user220511
    I'm trying to get the following to work on my machine but I get an error (Cannot create an instance of the abstract class or interface 'System.ServiceModel.Channels.MessageHeader') using System; using System.IO; using System.Reflection; namespace com.mycompanyname.business { /// /// Summary description for SessionCreateRQClient. /// class SessionCreateRQClient { /// /// The main entry point. /// [STAThread] static void Main(string[] args) { try { // Set user information, including security credentials and the IPCC. string username = "user"; string password = "password"; string ipcc = "IPCC"; string domain = "DEFAULT"; string temp = Environment.GetEnvironmentVariable("tmp"); // Get temp directory string PropsFileName = temp + "/session.properties"; // Define dir and file name DateTime dt = DateTime.UtcNow; string tstamp = dt.ToString("s") + "Z"; //Create the message header and provide the conversation ID. MessageHeader msgHeader = new MessageHeader(); msgHeader.ConversationId = "TestSession"; // Set the ConversationId From from = new From(); PartyId fromPartyId = new PartyId(); PartyId[] fromPartyIdArr = new PartyId[1]; fromPartyId.Value = "WebServiceClient"; fromPartyIdArr[0] = fromPartyId; from.PartyId = fromPartyIdArr; msgHeader.From = from; To to = new To(); PartyId toPartyId = new PartyId(); PartyId[] toPartyIdArr = new PartyId[1]; toPartyId.Value = "WebServiceSupplier"; toPartyIdArr[0] = toPartyId; to.PartyId = toPartyIdArr; msgHeader.To = to; //Add the value for eb:CPAId, which is the IPCC. //Add the value for the action code of this Web service, SessionCreateRQ. msgHeader.CPAId = ipcc; msgHeader.Action = "SessionCreateRQ"; Service service = new Service(); service.Value = "SessionCreate"; msgHeader.Service = service; MessageData msgData = new MessageData(); msgData.MessageId = "mid:[email protected]"; msgData.Timestamp = tstamp; msgHeader.MessageData = msgData; Security security = new Security(); SecurityUsernameToken securityUserToken = new SecurityUsernameToken(); securityUserToken.Username = username; securityUserToken.Password = password; securityUserToken.Organization = ipcc; securityUserToken.Domain = domain; security.UsernameToken = securityUserToken; SessionCreateRQ req = new SessionCreateRQ(); SessionCreateRQPOS pos = new SessionCreateRQPOS(); SessionCreateRQPOSSource source = new SessionCreateRQPOSSource(); source.PseudoCityCode = ipcc; pos.Source = source; req.POS = pos; SessionCreateRQService serviceObj = new SessionCreateRQService(); serviceObj.MessageHeaderValue = msgHeader; serviceObj.SecurityValue = security; SessionCreateRS resp = serviceObj.SessionCreateRQ(req); // Send the request if (resp.Errors != null && resp.Errors.Error != null) { Console.WriteLine("Error : " + resp.Errors.Error.ErrorInfo.Message); } else { msgHeader = serviceObj.MessageHeaderValue; security = serviceObj.SecurityValue; Console.WriteLine("**********************************************"); Console.WriteLine("Response of SessionCreateRQ service"); Console.WriteLine("BinarySecurityToken returned : " + security.BinarySecurityToken); Console.WriteLine("**********************************************"); string ConvIdLine = "convid="+msgHeader.ConversationId; // ConversationId to a string string TokenLine = "securitytoken="+security.BinarySecurityToken; // BinarySecurityToken to a string string ipccLine = "ipcc="+ipcc; // IPCC to a string File.Delete(PropsFileName); // Clean up TextWriter tw = new StreamWriter(PropsFileName); // Create & open the file tw.WriteLine(DateTime.Now); // Write the date for reference tw.WriteLine(TokenLine); // Write the BinarySecurityToken tw.WriteLine(ConvIdLine); // Write the ConversationId tw.WriteLine(ipccLine); // Write the IPCC tw.Close(); //Console.Read(); } } catch(Exception e) { Console.WriteLine("Exception Message : " + e.Message ); Console.WriteLine("Exception Stack Trace : " + e.StackTrace); Console.Read(); } } } } I have added the reference System.ServiceModel and the lines: using System.ServiceModel; using System.ServiceModel.Channels; but I continue to get that error when trying to compile -- "Cannot create an instance of the abstract class or interface 'System.ServiceModel.Channels.MessageHeader'" I am using Microsoft Visual Studio 2008 Version 9.0.21022.8 RTM Microsoft .NET Framework Version 3.5 SP1 Professional Edition Is there another reference I have to add? Or a dll to move over? I wonder was the code above written for Framework 2.0 only? Thanks for your help.

    Read the article

  • how can i update view when fragment change?

    - by user1524393
    i have a activity that have 2 sherlockfragment in this The first two pages display fragments with custom list views which are built from xml from server using AsyncTask. However, when the app runs, only one list view is displayed, the other page is just blank public class VpiAbsTestActivity extends SherlockFragmentActivity { private static final String[] CONTENT = new String[] { "1","2"}; TestFragmentAdapter mAdapter; ViewPager mPager; PageIndicator mIndicator; protected void onCreate(Bundle savedInstanceState) { setRequestedOrientation(ActivityInfo.SCREEN_ORIENTATION_PORTRAIT); super.onCreate(savedInstanceState); setContentView(R.layout.simple_tabs); mAdapter = new TestFragmentAdapter(getSupportFragmentManager()); mPager = (ViewPager)findViewById(R.id.pager); mPager.setAdapter(mAdapter); mIndicator = (TabPageIndicator)findViewById(R.id.indicator); mIndicator.setViewPager(mPager); mIndicator.notifyDataSetChanged(); } class TestFragmentAdapter extends FragmentPagerAdapter { private int mCount = CONTENT.length; public TestFragmentAdapter(FragmentManager fm) { super(fm); } @Override public Fragment getItem(int position) { switch(position) { case 0: return new customlist(); case 1: return new customlistnotuser(); default: return null; } } @Override public int getCount() { return mCount; } public CharSequence getPageTitle(int position) { return VpiAbsTestActivity.CONTENT[position % VpiAbsTestActivity.CONTENT.length].toUpperCase(); } @Override public void destroyItem(View collection, int position, Object view) { ((ViewPager) collection).removeView((View) view); } } } what can i update viewpager when change pages ? the customlistnotuser page likes customlist page but not show public class customlistnotuser extends SherlockFragment { // All static variables static final String URL = "url"; // XML node keys static final String KEY_TEST = "test"; // parent node static final String KEY_ID = "id"; static final String KEY_TITLE = "title"; static final String KEY_Description = "description"; static final String KEY_DURATION = "duration"; static final String KEY_THUMB_URL = "thumb_url"; static final String KEY_PRICE = "price"; static final String KEY_URL = "url"; private ProgressDialog pDialog; ListView list; LazyAdapterbeth adapter; XMLParser parser = new XMLParser(); public void onActivityCreated(Bundle savedInstanceState) { super.onActivityCreated(savedInstanceState); } public void onCreate(Bundle savedInstanceState) { super.onCreate(savedInstanceState); new getFeed().execute(); } public View onCreateView(LayoutInflater inflater, ViewGroup container, Bundle savedInstanceState) { View thisfragment = inflater.inflate(R.layout.dovomi, container, false); return thisfragment; } private class getFeed extends AsyncTask<Void, Void, Document> { } protected Document doInBackground(Void... params) { XMLParser parser = new XMLParser(); String xml = parser.getXmlFromUrl(URL); // getting XML from URL Document doc = parser.getDomElement(xml); // getting DOM element return doc; } protected void onPostExecute(Document doc) { ArrayList<HashMap<String, String>> songsList = new ArrayList<HashMap<String, String>>(); NodeList nl = doc.getElementsByTagName(KEY_TEST); // looping through all song nodes <song> for (int i = 0; i < nl.getLength(); i++) { // creating new HashMap HashMap<String, String> map = new HashMap<String, String>(); Element e = (Element) nl.item(i); // adding each child node to HashMap key => value map.put(KEY_ID, parser.getValue(e, KEY_ID)); map.put(KEY_TITLE, parser.getValue(e, KEY_TITLE)); map.put(KEY_Description, parser.getValue(e, KEY_Description)); map.put(KEY_DURATION, parser.getValue(e, KEY_DURATION)); map.put(KEY_THUMB_URL, parser.getValue(e, KEY_THUMB_URL)); map.put(KEY_PRICE, parser.getValue(e, KEY_PRICE)); map.put(KEY_URL, parser.getValue(e, KEY_URL)); // adding HashList to ArrayList songsList.add(map); pDialog.dismiss(); } list=(ListView)getActivity().findViewById(R.id.list); // Getting adapter by passing xml data ArrayList adapter=new LazyAdapterbeth(getActivity(), songsList); list.setAdapter(adapter); // Click event for single list row list.setOnItemClickListener(new OnItemClickListener() {

    Read the article

  • Different behavior for REF CURSOR between Oracle 10g and 11g when unique index present?

    - by wweicker
    Description I have an Oracle stored procedure that has been running for 7 or so years both locally on development instances and on multiple client test and production instances running Oracle 8, then 9, then 10, and recently 11. It has worked consistently until the upgrade to Oracle 11g. Basically, the procedure opens a reference cursor, updates a table then completes. In 10g the cursor will contain the expected results but in 11g the cursor will be empty. No DML or DDL changed after the upgrade to 11g. This behavior is consistent on every 10g or 11g instance I've tried (10.2.0.3, 10.2.0.4, 11.1.0.7, 11.2.0.1 - all running on Windows). The specific code is much more complicated but to explain the issue in somewhat realistic overview: I have some data in a header table and a bunch of child tables that will be output to PDF. The header table has a boolean (NUMBER(1) where 0 is false and 1 is true) column indicating whether that data has been processed yet. The view is limited to only show rows in that have not been processed (the view also joins on some other tables, makes some inline queries and function calls, etc). So at the time when the cursor is opened, the view shows one or more rows, then after the cursor is opened an update statement runs to flip the flag in the header table, a commit is issued, then the procedure completes. On 10g, the cursor opens, it contains the row, then the update statement flips the flag and running the procedure a second time would yield no data. On 11g, the cursor never contains the row, it's as if the cursor does not open until after the update statement runs. I'm concerned that something may have changed in 11g (hopefully a setting that can be configured) that might affect other procedures and other applications. What I'd like to know is whether anyone knows why the behavior is different between the two database versions and whether the issue can be resolved without code changes. Update 1: I managed to track the issue down to a unique constraint. It seems that when the unique constraint is present in 11g the issue is reproducible 100% of the time regardless of whether I'm running the real world code against the actual objects or the following simple example. Update 2: I was able to completely eliminate the view from the equation. I have updated the simple example to show the problem exists even when querying directly against the table. Simple Example CREATE TABLE tbl1 ( col1 VARCHAR2(10), col2 NUMBER(1) ); INSERT INTO tbl1 (col1, col2) VALUES ('TEST1', 0); /* View is no longer required to demonstrate the problem CREATE OR REPLACE VIEW vw1 (col1, col2) AS SELECT col1, col2 FROM tbl1 WHERE col2 = 0; */ CREATE OR REPLACE PACKAGE pkg1 AS TYPE refWEB_CURSOR IS REF CURSOR; PROCEDURE proc1 (crs OUT refWEB_CURSOR); END pkg1; CREATE OR REPLACE PACKAGE BODY pkg1 IS PROCEDURE proc1 (crs OUT refWEB_CURSOR) IS BEGIN OPEN crs FOR SELECT col1 FROM tbl1 WHERE col1 = 'TEST1' AND col2 = 0; UPDATE tbl1 SET col2 = 1 WHERE col1 = 'TEST1'; COMMIT; END proc1; END pkg1; Anonymous Block Demo DECLARE crs1 pkg1.refWEB_CURSOR; TYPE rectype1 IS RECORD ( col1 vw1.col1%TYPE ); rec1 rectype1; BEGIN pkg1.proc1 ( crs1 ); DBMS_OUTPUT.PUT_LINE('begin first test'); LOOP FETCH crs1 INTO rec1; EXIT WHEN crs1%NOTFOUND; DBMS_OUTPUT.PUT_LINE(rec1.col1); END LOOP; DBMS_OUTPUT.PUT_LINE('end first test'); END; /* After creating this index, the problem is seen */ CREATE UNIQUE INDEX unique_col1 ON tbl1 (col1); /* Reset data to initial values */ TRUNCATE TABLE tbl1; INSERT INTO tbl1 (col1, col2) VALUES ('TEST1', 0); DECLARE crs1 pkg1.refWEB_CURSOR; TYPE rectype1 IS RECORD ( col1 vw1.col1%TYPE ); rec1 rectype1; BEGIN pkg1.proc1 ( crs1 ); DBMS_OUTPUT.PUT_LINE('begin second test'); LOOP FETCH crs1 INTO rec1; EXIT WHEN crs1%NOTFOUND; DBMS_OUTPUT.PUT_LINE(rec1.col1); END LOOP; DBMS_OUTPUT.PUT_LINE('end second test'); END; Example of what the output on 10g would be:   begin first test   TEST1   end first test   begin second test   TEST1   end second test Example of what the output on 11g would be:   begin first test   TEST1   end first test   begin second test   end second test Clarification I can't remove the COMMIT because in the real world scenario the procedure is called from a web application. When the data provider on the front end calls the procedure it will issue an implicit COMMIT when disconnecting from the database anyways. So if I remove the COMMIT in the procedure then yes, the anonymous block demo would work but the real world scenario would not because the COMMIT would still happen. Question Why is 11g behaving differently? Is there anything I can do other than re-write the code?

    Read the article

  • Why this code is not working on linux server ?

    - by user488001
    Hello Experts, I am new in Zend Framework, and this code is use for downloading contents. This code is working in localhost but when i tried to execute in linux server it shows error file not found. public function downloadAnnouncementsAction() { $file= $this-_getParam('file'); $file = str_replace("%2F","/",$this-_getParam('file')); // Allow direct file download (hotlinking)? // Empty - allow hotlinking // If set to nonempty value (Example: example.com) will only allow downloads when referrer contains this text define('ALLOWED_REFERRER', ''); // Download folder, i.e. folder where you keep all files for download. // MUST end with slash (i.e. "/" ) define('BASE_DIR','file_upload'); // log downloads? true/false define('LOG_DOWNLOADS',true); // log file name define('LOG_FILE','downloads.log'); // Allowed extensions list in format 'extension' => 'mime type' // If myme type is set to empty string then script will try to detect mime type // itself, which would only work if you have Mimetype or Fileinfo extensions // installed on server. $allowed_ext = array ( // audio 'mp3' => 'audio/mpeg', 'wav' => 'audio/x-wav', // video 'mpeg' => 'video/mpeg', 'mpg' => 'video/mpeg', 'mpe' => 'video/mpeg', 'mov' => 'video/quicktime', 'avi' => 'video/x-msvideo' ); // If hotlinking not allowed then make hackers think there are some server problems if (ALLOWED_REFERRER !== '' && (!isset($_SERVER['HTTP_REFERER']) || strpos(strtoupper($_SERVER['HTTP_REFERER']),strtoupper(ALLOWED_REFERRER)) === false) ) { die("Internal server error. Please contact system administrator."); } // Make sure program execution doesn't time out // Set maximum script execution time in seconds (0 means no limit) set_time_limit(0); if (!isset($file) || empty($file)) { die("Please specify file name for download."); } // Nullbyte hack fix if (strpos($file, "\0") !== FALSE) die(''); // Get real file name. // Remove any path info to avoid hacking by adding relative path, etc. $fname = basename($file); // Check if the file exists // Check in subfolders too function find_file ($dirname, $fname, &$file_path) { $dir = opendir($dirname); while ($file = readdir($dir)) { if (empty($file_path) && $file != '.' && $file != '..') { if (is_dir($dirname.'/'.$file)) { find_file($dirname.'/'.$file, $fname, $file_path); } else { if (file_exists($dirname.'/'.$fname)) { $file_path = $dirname.'/'.$fname; return; } } } } } // find_file // get full file path (including subfolders) $file_path = ''; find_file(BASE_DIR, $fname, $file_path); if (!is_file($file_path)) { die("File does not exist. Make sure you specified correct file name."); } // file size in bytes $fsize = filesize($file_path); // file extension $fext = strtolower(substr(strrchr($fname,"."),1)); // check if allowed extension if (!array_key_exists($fext, $allowed_ext)) { die("Not allowed file type."); } // get mime type if ($allowed_ext[$fext] == '') { $mtype = ''; // mime type is not set, get from server settings if (function_exists('mime_content_type')) { $mtype = mime_content_type($file_path); } else if (function_exists('finfo_file')) { $finfo = finfo_open(FILEINFO_MIME); // return mime type $mtype = finfo_file($finfo, $file_path); finfo_close($finfo); } if ($mtype == '') { $mtype = "application/force-download"; } } else { // get mime type defined by admin $mtype = $allowed_ext[$fext]; } // Browser will try to save file with this filename, regardless original filename. // You can override it if needed. if (!isset($_GET['fc']) || empty($_GET['fc'])) { $asfname = $fname; } else { // remove some bad chars $asfname = str_replace(array('"',"'",'\\','/'), '', $_GET['fc']); if ($asfname === '') $asfname = 'NoName'; } // set headers header("Pragma: public"); header("Expires: 0"); header("Cache-Control: must-revalidate, post-check=0, pre-check=0"); header("Cache-Control: public"); header("Content-Description: File Transfer"); header("Content-Type: $mtype"); header("Content-Disposition: attachment; filename=\"$asfname\""); header("Content-Transfer-Encoding: binary"); header("Content-Length: " . $fsize); // download // @readfile($file_path); $file = @fopen($file_path,"rb"); if ($file) { while(!feof($file)) { print(fread($file, 1024*8)); flush(); if (connection_status()!=0) { @fclose($file); die(); } } @fclose($file); } // log downloads if (!LOG_DOWNLOADS) die(); $f = @fopen(LOG_FILE, 'a+'); if ($f) { @fputs($f, date("m.d.Y g:ia")." ".$_SERVER['REMOTE_ADDR']." ".$fname."\n"); @fclose($f); } } please Help...

    Read the article

  • ASP.NET MVC2 - usage of LINQ-generated class (validation problem)

    - by ile
    There are few things not clear to me about ASP.NET MV2. In database I have table Contacts with several fields, and there is an additional field XmlFields of which type is xml. In that field are stored additional description fields. There are 4 classes: Contact class which corresponds to Contact table and is defined by default when creating LINQ classes ContactListView class which inherits Contact class and has some additional properties ContactXmlView class that contains fields from XmlFields field ContactDetailsView class which merges ContactListView and ContactXmlView into one class and this one is used to display data in view pages ContactListView class has re-defined some properties from Contact class (so that I can add [Required] filter used for validation) - but I get warning message: 'ObjectTest.Models.Contacts.ContactListView.FirstName' hides inherited member 'SA.Model.Contact.FirstName'. Use the new keyword if hiding was intended. ContactDetailsView class is also used in a form when creating new contact and adding it to database. I am not sure if this is correct way, and the warning message confuses me a bit. Any advise about this? Thanks, Ile EDIT According to Jakob's instructions I tried it from scratch: [MetadataType(typeof(Person_Validation))] public partial class Person { } public class Person_Validation { [Required] string FirstName { get; set; } [Required] string LastName { get; set; } [Required] int Age { get; set; } } In Controller I have this: [HttpPost] public ActionResult Create(Person person, FormCollection collection) { if (ModelState.IsValid) { try { personRepository.Add(person); personRepository.Save(); } catch { return View(person); } } return RedirectToAction("Index"); } View: <%@ Page Title="" Language="C#" MasterPageFile="~/Views/Shared/Site.Master" Inherits="System.Web.Mvc.ViewPage<Validate.Models.Person>" %> <asp:Content ID="Content1" ContentPlaceHolderID="TitleContent" runat="server"> Create </asp:Content> <asp:Content ID="Content2" ContentPlaceHolderID="MainContent" runat="server"> <h2>Create</h2> <% using (Html.BeginForm()) {%> <%= Html.ValidationSummary(true) %> <fieldset> <legend>Fields</legend> <div class="editor-label"> <%= Html.LabelFor(model => model.FirstName) %> </div> <div class="editor-field"> <%= Html.TextBoxFor(model => model.FirstName) %> <%= Html.ValidationMessageFor(model => model.FirstName) %> </div> <div class="editor-label"> <%= Html.LabelFor(model => model.LastName) %> </div> <div class="editor-field"> <%= Html.TextBoxFor(model => model.LastName) %> <%= Html.ValidationMessageFor(model => model.LastName) %> </div> <div class="editor-label"> <%= Html.LabelFor(model => model.Age) %> </div> <div class="editor-field"> <%= Html.TextBoxFor(model => model.Age) %> <%= Html.ValidationMessageFor(model => model.Age) %> </div> <p> <input type="submit" value="Create" /> </p> </fieldset> <% } %> <div> <%= Html.ActionLink("Back to List", "Index") %> </div> </asp:Content> When posting new person with no values, nothing happens (page is just reloaded). When posting with some values, person is added to db. I have no idea what am I doing wrong.

    Read the article

  • Can anyone help me with this VHDL code (currently malfunctioning)?

    - by xx77aBs
    This code should be (and is) very simple, and I don't know what I am doing wrong. Here is description of what it should do: It should display a number on one 7-segment display. That number should be increased by one every time someone presses the push button. There is also reset button which sets the number to 0. That's it. Here is VHDL code: library IEEE; use IEEE.STD_LOGIC_1164.ALL; use IEEE.STD_LOGIC_ARITH.ALL; use IEEE.STD_LOGIC_UNSIGNED.ALL; entity PWM is Port ( cp_in : in STD_LOGIC; inc : in STD_LOGIC; rst: in std_logic; AN : out STD_LOGIC_VECTOR (3 downto 0); segments : out STD_LOGIC_VECTOR (6 downto 0)); end PWM; architecture Behavioral of PWM is signal cp: std_logic; signal CurrentPWMState: integer range 0 to 10; signal inco: std_logic; signal temp: std_logic_vector (3 downto 0); begin --cp = 100 Hz counter: entity djelitelj generic map (CountTo => 250000) port map (cp_in, cp); debounce: entity debounce port map (inc, cp, inco); temp <= conv_std_logic_vector(CurrentPWMState, 4); ss: entity decoder7seg port map (temp, segments); process (inco, rst) begin if inco = '1' then CurrentPWMState <= CurrentPWMState + 1; elsif rst='1' then CurrentPWMState <= 0; end if; end process; AN <= "1110"; end Behavioral; Entity djelitelj (the counter used to divide 50MHz clock): library IEEE; use IEEE.STD_LOGIC_1164.ALL; use IEEE.STD_LOGIC_ARITH.ALL; use IEEE.STD_LOGIC_UNSIGNED.ALL; entity PWM is Port ( cp_in : in STD_LOGIC; inc : in STD_LOGIC; rst: in std_logic; AN : out STD_LOGIC_VECTOR (3 downto 0); segments : out STD_LOGIC_VECTOR (6 downto 0)); end PWM; architecture Behavioral of PWM is signal cp: std_logic; signal CurrentPWMState: integer range 0 to 10; signal inco: std_logic; signal temp: std_logic_vector (3 downto 0); begin --cp = 100 Hz counter: entity djelitelj generic map (CountTo => 250000) port map (cp_in, cp); debounce: entity debounce port map (inc, cp, inco); temp <= conv_std_logic_vector(CurrentPWMState, 4); ss: entity decoder7seg port map (temp, segments); process (inco, rst) begin if inco = '1' then CurrentPWMState <= CurrentPWMState + 1; elsif rst='1' then CurrentPWMState <= 0; end if; end process; AN <= "1110"; end Behavioral; Debouncing entity: library IEEE; use IEEE.STD_LOGIC_1164.all; use IEEE.STD_LOGIC_ARITH.all; use IEEE.STD_LOGIC_UNSIGNED.all; ENTITY debounce IS PORT(pb, clock_100Hz : IN STD_LOGIC; pb_debounced : OUT STD_LOGIC); END debounce; ARCHITECTURE a OF debounce IS SIGNAL SHIFT_PB : STD_LOGIC_VECTOR(3 DOWNTO 0); BEGIN -- Debounce Button: Filters out mechanical switch bounce for around 40Ms. -- Debounce clock should be approximately 10ms process begin wait until (clock_100Hz'EVENT) AND (clock_100Hz = '1'); SHIFT_PB(2 Downto 0) <= SHIFT_PB(3 Downto 1); SHIFT_PB(3) <= NOT PB; If SHIFT_PB(3 Downto 0)="0000" THEN PB_DEBOUNCED <= '1'; ELSE PB_DEBOUNCED <= '0'; End if; end process; end a; And here is BCD to 7-segment decoder: library IEEE; use IEEE.STD_LOGIC_1164.ALL; use IEEE.STD_LOGIC_ARITH.ALL; use IEEE.STD_LOGIC_UNSIGNED.ALL; entity decoder7seg is port ( bcd: in std_logic_vector (3 downto 0); segm: out std_logic_vector (6 downto 0)); end decoder7seg; architecture Behavioral of decoder7seg is begin with bcd select segm<= "0000001" when "0000", -- 0 "1001111" when "0001", -- 1 "0010010" when "0010", -- 2 "0000110" when "0011", -- 3 "1001100" when "0100", -- 4 "0100100" when "0101", -- 5 "0100000" when "0110", -- 6 "0001111" when "0111", -- 7 "0000000" when "1000", -- 8 "0000100" when "1001", -- 9 "1111110" when others; -- just - character end Behavioral; Does anyone see where I made my mistake(s) ? I've tried that design on Spartan-3 Started board and it isn't working ... Every time I press the push button, I get crazy (random) values. The reset button is working properly. Thanks !!!!

    Read the article

  • high tweet status IDs causing failed to open stream errors?

    - by escarp
    Erg. Starting in the past few days high tweet IDs (at least, it appears it's ID related, but I suppose it could be some recent change in the api returns) are breaking my code. At first I tried passing the ID as a string instead of an integer to this function, and I thought this worked, but in reality it was just the process of uploading the file from my end. In short, a php script generates these function calls, and when it does so, they fail. If I download the php file the call is generated into, delete the server copy and re-upload the exact same file without changing it, it works fine. Does anyone know what could be causing this behavior? Below is what I suspect to be the most important part of the individual files that are pulling the errors. Each of the files is named for a status ID (e.g. the below file is named 12058543656.php) <?php require "singlePost.php"; SinglePost(12058543656) ?> Here's the code that writes the above files: $postFileName = $single_post_id.".php"; if(!file_exists($postFileName)){ $created_at_full = date("l, F jS, Y", strtotime($postRow[postdate])-(18000)); $postFileHandle = fopen($postFileName, 'w+'); fwrite($postFileHandle, '<html> <head> <title><?php $thisTITLE = "escarp | A brief poem or short story by '.$authorname.' on '.$created_at_full.'"; echo $thisTITLE;?></title><META NAME="Description" CONTENT="This brief poem or short story, by '.$authorname.', was published on '.$created_at_full.'"> <?php include("head.php");?> To receive other poems or short stories like this one from <a href=http://twitter.com/escarp>escarp</a> on your cellphone, <a href=http://twitter.com/signup>create</a> and/or <a href=http://twitter.com/devices>associate</a> a Twitter account with your cellphone</a>, follow <a href=http://twitter.com/escarp>us</a>, and turn device updates on. <pre><?php require "singlePost.php"; SinglePost("'.$single_post_id.'") ?> </div></div></pre><?php include("foot.php");?> </body> </html>'); fclose($postFileHandle);} $postcounter++; } I can post more if you don't see anything here, but there are several files involved and I'm trying to avoid dumping tons of irrelevant code. Error: Warning: include(head.php) [function.include]: failed to open stream: No such file or directory in /f2/escarp/public/12177797583.php on line 4 Warning: include(head.php) [function.include]: failed to open stream: No such file or directory in /f2/escarp/public/12177797583.php on line 4 Warning: include() [function.include]: Failed opening 'head.php' for inclusion (include_path='.:/nfsn/apps/php5/lib/php/:/nfsn/apps/php/lib/php/') in /f2/escarp/public/12177797583.php on line 4 To receive other poems or short stories like this one from escarp on your cellphone, create and/or associate a Twitter account with your cellphone, follow us, and turn device updates on. Warning: require(singlePost.php) [function.require]: failed to open stream: No such file or directory in /f2/escarp/public/12177797583.php on line 7 Warning: require(singlePost.php) [function.require]: failed to open stream: No such file or directory in /f2/escarp/public/12177797583.php on line 7 Fatal error: require() [function.require]: Failed opening required 'singlePost.php' (include_path='.:/nfsn/apps/php5/lib/php/:/nfsn/apps/php/lib/php/') in /f2/escarp/public/12177797583.php on line 7 <?php function SinglePost($statusID) { require "nicetime.php"; $db = sqlite_open("db.escarp"); $updates = sqlite_query($db, "SELECT * FROM posts WHERE postID = '$statusID'"); $row = sqlite_fetch_array($updates, SQLITE_ASSOC); $id = $row[authorID]; $result = sqlite_query($db, "SELECT * FROM authors WHERE authorID = '$id'"); $row5 = sqlite_fetch_array($result, SQLITE_ASSOC); $created_at_full = date("l, F jS, Y", strtotime($row[postdate])-(18000)); $created_at = nicetime($row[postdate]); if($row5[url]==""){ $authorurl = ''; } else{ /*I'm omitting a few pages of output code and associated regex*/ return; } ?>

    Read the article

  • Creating a custom categories widget

    - by Scott B
    The code below is an attempt to take the WP_Widget_Categories class and use it as the basis for a custom categories widget based on the default categories widget. I'm getting no output however and the widget is not showing up in the "Available Widgets" listing. What am I doing wrong? <?php /* Plugin Name: My Categories Widget Version: 1.0 */ class MY_Widget_Categories extends WP_Widget { function MY_Widget_Categories() { $widget_ops = array( 'classname' => 'widget_categories', 'description' => __( "A list or dropdown of categories" ) ); $this->WP_Widget('categories', __('Categories'), $widget_ops); } function widget( $args, $instance ) { extract( $args ); $title = apply_filters('widget_title', empty( $instance['title'] ) ? __( 'Categories' ) : $instance['title']); $c = $instance['count'] ? '1' : '0'; $h = $instance['hierarchical'] ? '1' : '0'; $d = $instance['dropdown'] ? '1' : '0'; echo $before_widget; if ( $title ) echo $before_title . $title . $after_title; $cat_args = array('orderby' => 'name', 'show_count' => $c, 'hierarchical' => $h); if ( $d ) { $cat_args['show_option_none'] = __('Select Category'); wp_dropdown_categories(apply_filters('widget_categories_dropdown_args', $cat_args)); ?> <script type='text/javascript'> /* <![CDATA[ */ var dropdown = document.getElementById("cat"); function onCatChange() { if ( dropdown.options[dropdown.selectedIndex].value > 0 ) { location.href = "<?php echo get_option('home'); ?>/?cat="+dropdown.options[dropdown.selectedIndex].value; } } dropdown.onchange = onCatChange; /* ]]> */ </script> <?php } else { ?> <ul> <?php $cat_args['title_li'] = ''; wp_list_categories(apply_filters('widget_categories_args', $cat_args)); ?> </ul> <?php } echo $after_widget; } function update( $new_instance, $old_instance ) { $instance = $old_instance; $instance['title'] = strip_tags($new_instance['title']); $instance['count'] = $new_instance['count'] ? 1 : 0; $instance['hierarchical'] = $new_instance['hierarchical'] ? 1 : 0; $instance['dropdown'] = $new_instance['dropdown'] ? 1 : 0; return $instance; } function form( $instance ) { //Defaults $instance = wp_parse_args( (array) $instance, array( 'title' => '') ); $title = esc_attr( $instance['title'] ); $count = isset($instance['count']) ? (bool) $instance['count'] :false; $hierarchical = isset( $instance['hierarchical'] ) ? (bool) $instance['hierarchical'] : false; $dropdown = isset( $instance['dropdown'] ) ? (bool) $instance['dropdown'] : false; ?> <p><label for="<?php echo $this->get_field_id('title'); ?>"><?php _e( 'Title:' ); ?></label> <input class="widefat" id="<?php echo $this->get_field_id('title'); ?>" name="<?php echo $this->get_field_name('title'); ?>" type="text" value="<?php echo $title; ?>" /></p> <p><input type="checkbox" class="checkbox" id="<?php echo $this->get_field_id('dropdown'); ?>" name="<?php echo $this->get_field_name('dropdown'); ?>"<?php checked( $dropdown ); ?> /> <label for="<?php echo $this->get_field_id('dropdown'); ?>"><?php _e( 'Show as dropdown' ); ?></label><br /> <input type="checkbox" class="checkbox" id="<?php echo $this->get_field_id('count'); ?>" name="<?php echo $this->get_field_name('count'); ?>"<?php checked( $count ); ?> /> <label for="<?php echo $this->get_field_id('count'); ?>"><?php _e( 'Show post counts' ); ?></label><br /> <input type="checkbox" class="checkbox" id="<?php echo $this->get_field_id('hierarchical'); ?>" name="<?php echo $this->get_field_name('hierarchical'); ?>"<?php checked( $hierarchical ); ?> /> <label for="<?php echo $this->get_field_id('hierarchical'); ?>"><?php _e( 'Show hierarchy' ); ?></label></p> <?php } } function my_categories_init() { register_sidebar_widget(__('My Categories Widget'), 'MY_Widget_Categories'); } add_action("plugins_loaded", "my_categories_init"); ?>

    Read the article

  • Map wont show rigth in Joomla

    - by user1653126
    I have the following code of a map using api google, I have tested the code in several html editor and its work perfectly, but when i upload in my web page doesn’t work. The map appears all zoomed in some random point in the ocean. I create an article in Joomla 1.5.20, paste the code. Its shows right in the preview but not in the web page. I disable filtering and use none editor and still won’t work. Thanks for the help. <!DOCTYPE html> <html> <head> <meta name="viewport" content="initial-scale=1.0, user-scalable=no" /> <style type="text/css"> html { height: 100% } body { height: 100%; margin: 0; padding: 0 } #map_canvas { height: 100% } </style> <script type="text/javascript" src="http://maps.googleapis.com/maps/api/js?key=AIzaSyBInlv7FuwtKGhzBP0oISDoB2Iu79HNrPU&sensor=false"> </script> <script type="text/javascript"> var map; // lets define some vars to make things easier later var kml = { a: { name: "Productor", url: "https://maps.google.hn/maps/ms?authuser=0&vps=2&hl=es&ie=UTF8&msa=0&output=kml&msid=200984447026903306654.0004c934a224eca7c3ad4" }, b: { name: "A&S", url: "https://maps.google.hn/maps/ms?ie=UTF8&authuser=0&msa=0&output=kml&msid=200984447026903306654.0004c94bac74cf2304c71" } // keep adding more if ye like }; // initialize our goo function initializeMap() { var options = { center: new google.maps.LatLng(13.324182,-87.080071), zoom: 9, mapTypeId: google.maps.MapTypeId.TERRAIN } map = new google.maps.Map(document.getElementById("map_canvas"), options); var ctaLayer = new google.maps.KmlLayer('https://maps.google.hn/maps/ms?authuser=0&vps=5&hl=es&ie=UTF8&oe=UTF8&msa=0&output=kml&msid=200984447026903306654.0004c94bc3bce6f638aa1'); ctaLayer.setMap(map); var ctaLayer = new google.maps.KmlLayer('https://maps.google.hn/maps/ms?authuser=0&vps=2&ie=UTF8&msa=0&output=kml&msid=200984447026903306654.0004c94ec7e838242b67d'); ctaLayer.setMap(map); createTogglers(); }; google.maps.event.addDomListener(window, 'load', initializeMap); // the important function... kml[id].xxxxx refers back to the top function toggleKML(checked, id) { if (checked) { var layer = new google.maps.KmlLayer(kml[id].url, { preserveViewport: true, suppressInfoWindows: true }); google.maps.event.addListener(layer, 'click', function(kmlEvent) { var text = kmlEvent.featureData.description; showInContentWindow(text); }); function showInContentWindow(text) { var sidediv = document.getElementById('content_window'); sidediv.innerHTML = text; } // store kml as obj kml[id].obj = layer; kml[id].obj.setMap(map); } else { kml[id].obj.setMap(null); delete kml[id].obj; } }; // create the controls dynamically because it's easier, really function createTogglers() { var html = "<form><ul>"; for (var prop in kml) { html += "<li id=\"selector-" + prop + "\"><input type='checkbox' id='" + prop + "'" + " onclick='highlight(this,\"selector-" + prop + "\"); toggleKML(this.checked, this.id)' \/>" + kml[prop].name + "<\/li>"; } html += "<li class='control'><a href='#' onclick='removeAll();return false;'>" + "Limpiar el Mapa<\/a><\/li>" + "<\/ul><\/form>"; document.getElementById("toggle_box").innerHTML = html; }; // easy way to remove all objects function removeAll() { for (var prop in kml) { if (kml[prop].obj) { kml[prop].obj.setMap(null); delete kml[prop].obj; } } }; // Append Class on Select function highlight(box, listitem) { var selected = 'selected'; var normal = 'normal'; document.getElementById(listitem).className = (box.checked ? selected: normal); }; </script> <style type="text/css"> .selected { font-weight: bold; } </style> </head> <body> <div id="map_canvas" style="width: 80%; height: 400px; float:left"></div> <div id="toggle_box" style="position: absolute; top: 100px; right: 640px; padding: 10px; background: #fff; z-index: 5; "></div> <div id="content_window" style="width:10%; height:10%; float:left"></div> </body> </html>

    Read the article

  • .NET 3.5SP1 64-bit memory model vs. 32-bit memory model

    - by James Dunne
    As I understand it, the .NET memory model on a 32-bit machine guarantees 32-bit word writes and reads to be atomic operations but does not provide this guarantee on 64-bit words. I have written a quick tool to demonstrate this effect on a Windows XP 32-bit OS and am getting results consistent with that memory model description. However, I have taken this same tool's executable and run it on a Windows 7 Enterprise 64-bit OS and am getting wildly different results. Both the machines are identical specs just with different OSes installed. I would have expected that the .NET memory model would guarantee writes and reads to BOTH 32-bit and 64-bit words to be atomic on a 64-bit OS. I find results completely contrary to BOTH assumptions. 32-bit reads and writes are not demonstrated to be atomic on this OS. Can someone explain to me why this fails on a 64-bit OS? Tool code: using System; using System.Threading; namespace ConsoleApplication1 { class Program { static void Main(string[] args) { var th = new Thread(new ThreadStart(RunThread)); var th2 = new Thread(new ThreadStart(RunThread)); int lastRecordedInt = 0; long lastRecordedLong = 0L; th.Start(); th2.Start(); while (!done) { int newIntValue = intValue; long newLongValue = longValue; if (lastRecordedInt > newIntValue) Console.WriteLine("BING(int)! {0} > {1}, {2}", lastRecordedInt, newIntValue, (lastRecordedInt - newIntValue)); if (lastRecordedLong > newLongValue) Console.WriteLine("BING(long)! {0} > {1}, {2}", lastRecordedLong, newLongValue, (lastRecordedLong - newLongValue)); lastRecordedInt = newIntValue; lastRecordedLong = newLongValue; } th.Join(); th2.Join(); Console.WriteLine("{0} =? {2}, {1} =? {3}", intValue, longValue, Int32.MaxValue / 2, (long)Int32.MaxValue + (Int32.MaxValue / 2)); } private static long longValue = Int32.MaxValue; private static int intValue; private static bool done = false; static void RunThread() { for (int i = 0; i < Int32.MaxValue / 4; ++i) { ++longValue; ++intValue; } done = true; } } } Results on Windows XP 32-bit: Windows XP 32-bit Intel Core2 Duo P8700 @ 2.53GHz BING(long)! 2161093208 > 2161092246, 962 BING(long)! 2162448397 > 2161273312, 1175085 BING(long)! 2270110050 > 2270109040, 1010 BING(long)! 2270115061 > 2270110059, 5002 BING(long)! 2558052223 > 2557528157, 524066 BING(long)! 2571660540 > 2571659563, 977 BING(long)! 2646433569 > 2646432557, 1012 BING(long)! 2660841714 > 2660840732, 982 BING(long)! 2661795522 > 2660841715, 953807 BING(long)! 2712855281 > 2712854239, 1042 BING(long)! 2737627472 > 2735210929, 2416543 1025780885 =? 1073741823, 3168207035 =? 3221225470 Notice how BING(int) is never written and demonstrates that 32-bit reads/writes are atomic on this 32-bit OS. Results on Windows 7 Enterprise 64-bit: Windows 7 Enterprise 64-bit Intel Core2 Duo P8700 @ 2.53GHz BING(long)! 2208482159 > 2208121217, 360942 BING(int)! 280292777 > 279704627, 588150 BING(int)! 308158865 > 308131694, 27171 BING(long)! 2549116628 > 2548884894, 231734 BING(int)! 534815527 > 534708027, 107500 BING(int)! 545113548 > 544270063, 843485 BING(long)! 2710030799 > 2709941968, 88831 BING(int)! 668662394 > 667539649, 1122745 1006355562 =? 1073741823, 3154727581 =? 3221225470 Notice that BING(long) AND BING(int) are both displayed! Why are the 32-bit operations failing, let alone the 64-bit ones?

    Read the article

  • Cant update table in using isset

    - by Ali Munandar
    I have a table called settings, when I would change or enter data into the form it did not change the data in the table. In addition on form an image upload file is not running, There may be the wrong code below. <div class="maintitle">Site Settings</div> <?php $act=isset($_GET['act'])?$_GET['act']:""; if($act=='sub'){ $name=isset($_POST['site'])?$_POST['site']:""; $keys=isset($_POST['keywords'])?$_POST['keywords']:""; $desc=isset($_POST['descrp'])?$_POST['descrp']:""; $email=isset($_POST['email'])?$_POST['email']:""; $fbpage=isset($_POST['fbpage'])?$_POST['fbpage']:""; $twitter=isset($_POST['twitter'])?$_POST['twitter']:""; $gplus=isset($_POST['gplus'])?$_POST['gplus']:""; $disclaimer=isset($_POST['disclaimer'])?$_POST['disclaimer']:""; $template=isset($_POST['template'])?$_POST['template']:""; mysql_query("UPDATE settings SET site='$name',keywords='$keys',descrp='$desc',email='$email',fbpage='$fbpage',twitter='$twitter',gplus='$gplus',disclaimer='$disclaimer',template='$template' WHERE id=1"); if($_FILES["file"]["name"]!=''){ move_uploaded_file($_FILES["file"]["tmp_name"], "../images/logo.png"); }?> <div class="infomsgbox">Settings updated successfully.</div> <?php } $q=mysql_query("select * from settings where id=1"); $s=mysql_fetch_assoc($q); ?> <div class="box"> <div class="inbox"> <!--form--> <form action="index.php?act=sub" method="post" enctype="multipart/form-data"> <label class="artlbl">Site Name</label> <div class="formdiv"> <input type="text" name='site' value='<?php echo $s['name']?>'/> </div> <label class="artlbl">Logo (264px x 85px)</label> <div class="formdiv"> <input type='file' class="file" name='file'/> </div> <div class="clear"></div> <label class="artlbl">Meta Keywords (Separated by Commas)</label> <div class="formdiv"> <textarea name='keywords' cols=40 rows=5 ><?php echo $s['keywords']?></textarea> </div> <label class="artlbl">Meta Description</label> <div class="formdiv"> <textarea name='descrp' cols=40 rows=5 ><?php echo $s['descrp']?></textarea> </div> <label class="artlbl">Email</label> <div class="formdiv"> <input type="text" name='email' value='<?php echo $s['email']?>'/> </div> <label class="artlbl">Facebook Fan Page</label> <div class="formdiv"> <input type="text" name='fbpage' value='<?php echo $s['fbpage']?>'/> </div> <label class="artlbl">Twitter URL</label> <div class="formdiv"> <input type="text" name='twitter' value='<?php echo $s['twitter']?>'/> </div> <label class="artlbl">Google+ URL</label> <div class="formdiv"> <input type="text" name='gplus' value='<?php echo $s['gplus']?>'/> </div> <label class="artlbl">Site Disclaimer</label> <div class="formdiv"> <textarea name='disclaimer' cols=40 rows=5 ><?php echo $s['disclaimer']?></textarea> </div> <label class="artlbl">Template</label> <div class="formdiv"> <select name="template" id="template"> <option value="<?php echo $s['template'];?>"><?php echo ucfirst($s['template']);?></option> <?php foreach(glob('../templates/*', GLOB_ONLYDIR) as $dir) { $TemplateDir = substr($dir, 13); $TemplateName = ucfirst($TemplateDir) ?> <option value="<?php echo $TemplateDir;?>"><?php echo $TemplateName;?></option> <?php }?> </select> </div> <div class="clear"></div> </br> <div class="formdiv"> <div class="sbutton"><input type="submit" id="submit" value="Update Site Settings"/></div> </div> </form> </div> </div><!--box--> Maybe someone can help me Related to this.

    Read the article

  • Using FiddlerCore to capture HTTP Requests with .NET

    - by Rick Strahl
    Over the last few weeks I’ve been working on my Web load testing utility West Wind WebSurge. One of the key components of a load testing tool is the ability to capture URLs effectively so that you can play them back later under load. One of the options in WebSurge for capturing URLs is to use its built-in capture tool which acts as an HTTP proxy to capture any HTTP and HTTPS traffic from most Windows HTTP clients, including Web Browsers as well as standalone Windows applications and services. To make this happen, I used Eric Lawrence’s awesome FiddlerCore library, which provides most of the functionality of his desktop Fiddler application, all rolled into an easy to use library that you can plug into your own applications. FiddlerCore makes it almost too easy to capture HTTP content! For WebSurge I needed to capture all HTTP traffic in order to capture the full HTTP request – URL, headers and any content posted by the client. The result of what I ended up creating is this semi-generic capture form: In this post I’m going to demonstrate how easy it is to use FiddlerCore to build this HTTP Capture Form.  If you want to jump right in here are the links to get Telerik’s Fiddler Core and the code for the demo provided here. FiddlerCore Download FiddlerCore on NuGet Show me the Code (WebSurge Integration code from GitHub) Download the WinForms Sample Form West Wind Web Surge (example implementation in live app) Note that FiddlerCore is bound by a license for commercial usage – see license.txt in the FiddlerCore distribution for details. Integrating FiddlerCore FiddlerCore is a library that simply plugs into your application. You can download it from the Telerik site and manually add the assemblies to your project, or you can simply install the NuGet package via:       PM> Install-Package FiddlerCore The library consists of the FiddlerCore.dll as well as a couple of support libraries (CertMaker.dll and BCMakeCert.dll) that are used for installing SSL certificates. I’ll have more on SSL captures and certificate installation later in this post. But first let’s see how easy it is to use FiddlerCore to capture HTTP content by looking at how to build the above capture form. Capturing HTTP Content Once the library is installed it’s super easy to hook up Fiddler functionality. Fiddler includes a number of static class methods on the FiddlerApplication object that can be called to hook up callback events as well as actual start monitoring HTTP URLs. In the following code directly lifted from WebSurge, I configure a few filter options on Form level object, from the user inputs shown on the form by assigning it to a capture options object. In the live application these settings are persisted configuration values, but in the demo they are one time values initialized and set on the form. Once these options are set, I hook up the AfterSessionComplete event to capture every URL that passes through the proxy after the request is completed and start up the Proxy service:void Start() { if (tbIgnoreResources.Checked) CaptureConfiguration.IgnoreResources = true; else CaptureConfiguration.IgnoreResources = false; string strProcId = txtProcessId.Text; if (strProcId.Contains('-')) strProcId = strProcId.Substring(strProcId.IndexOf('-') + 1).Trim(); strProcId = strProcId.Trim(); int procId = 0; if (!string.IsNullOrEmpty(strProcId)) { if (!int.TryParse(strProcId, out procId)) procId = 0; } CaptureConfiguration.ProcessId = procId; CaptureConfiguration.CaptureDomain = txtCaptureDomain.Text; FiddlerApplication.AfterSessionComplete += FiddlerApplication_AfterSessionComplete; FiddlerApplication.Startup(8888, true, true, true); } The key lines for FiddlerCore are just the last two lines of code that include the event hookup code as well as the Startup() method call. Here I only hook up to the AfterSessionComplete event but there are a number of other events that hook various stages of the HTTP request cycle you can also hook into. Other events include BeforeRequest, BeforeResponse, RequestHeadersAvailable, ResponseHeadersAvailable and so on. In my case I want to capture the request data and I actually have several options to capture this data. AfterSessionComplete is the last event that fires in the request sequence and it’s the most common choice to capture all request and response data. I could have used several other events, but AfterSessionComplete is one place where you can look both at the request and response data, so this will be the most common place to hook into if you’re capturing content. The implementation of AfterSessionComplete is responsible for capturing all HTTP request headers and it looks something like this:private void FiddlerApplication_AfterSessionComplete(Session sess) { // Ignore HTTPS connect requests if (sess.RequestMethod == "CONNECT") return; if (CaptureConfiguration.ProcessId > 0) { if (sess.LocalProcessID != 0 && sess.LocalProcessID != CaptureConfiguration.ProcessId) return; } if (!string.IsNullOrEmpty(CaptureConfiguration.CaptureDomain)) { if (sess.hostname.ToLower() != CaptureConfiguration.CaptureDomain.Trim().ToLower()) return; } if (CaptureConfiguration.IgnoreResources) { string url = sess.fullUrl.ToLower(); var extensions = CaptureConfiguration.ExtensionFilterExclusions; foreach (var ext in extensions) { if (url.Contains(ext)) return; } var filters = CaptureConfiguration.UrlFilterExclusions; foreach (var urlFilter in filters) { if (url.Contains(urlFilter)) return; } } if (sess == null || sess.oRequest == null || sess.oRequest.headers == null) return; string headers = sess.oRequest.headers.ToString(); var reqBody = sess.GetRequestBodyAsString(); // if you wanted to capture the response //string respHeaders = session.oResponse.headers.ToString(); //var respBody = session.GetResponseBodyAsString(); // replace the HTTP line to inject full URL string firstLine = sess.RequestMethod + " " + sess.fullUrl + " " + sess.oRequest.headers.HTTPVersion; int at = headers.IndexOf("\r\n"); if (at < 0) return; headers = firstLine + "\r\n" + headers.Substring(at + 1); string output = headers + "\r\n" + (!string.IsNullOrEmpty(reqBody) ? reqBody + "\r\n" : string.Empty) + Separator + "\r\n\r\n"; BeginInvoke(new Action<string>((text) => { txtCapture.AppendText(text); UpdateButtonStatus(); }), output); } The code starts by filtering out some requests based on the CaptureOptions I set before the capture is started. These options/filters are applied when requests actually come in. This is very useful to help narrow down the requests that are captured for playback based on options the user picked. I find it useful to limit requests to a certain domain for captures, as well as filtering out some request types like static resources – images, css, scripts etc. This is of course optional, but I think it’s a common scenario and WebSurge makes good use of this feature. AfterSessionComplete like other FiddlerCore events, provides a Session object parameter which contains all the request and response details. There are oRequest and oResponse objects to hold their respective data. In my case I’m interested in the raw request headers and body only, as you can see in the commented code you can also retrieve the response headers and body. Here the code captures the request headers and body and simply appends the output to the textbox on the screen. Note that the Fiddler events are asynchronous, so in order to display the content in the UI they have to be marshaled back the UI thread with BeginInvoke, which here simply takes the generated headers and appends it to the existing textbox test on the form. As each request is processed, the headers are captured and appended to the bottom of the textbox resulting in a Session HTTP capture in the format that Web Surge internally supports, which is basically raw request headers with a customized 1st HTTP Header line that includes the full URL rather than a server relative URL. When the capture is done the user can either copy the raw HTTP session to the clipboard, or directly save it to file. This raw capture format is the same format WebSurge and also Fiddler use to import/export request data. While this code is application specific, it demonstrates the kind of logic that you can easily apply to the request capture process, which is one of the reasonsof why FiddlerCore is so powerful. You get to choose what content you want to look up as part of your own application logic and you can then decide how to capture or use that data as part of your application. The actual captured data in this case is only a string. The user can edit the data by hand or in the the case of WebSurge, save it to disk and automatically open the captured session as a new load test. Stopping the FiddlerCore Proxy Finally to stop capturing requests you simply disconnect the event handler and call the FiddlerApplication.ShutDown() method:void Stop() { FiddlerApplication.AfterSessionComplete -= FiddlerApplication_AfterSessionComplete; if (FiddlerApplication.IsStarted()) FiddlerApplication.Shutdown(); } As you can see, adding HTTP capture functionality to an application is very straight forward. FiddlerCore offers tons of features I’m not even touching on here – I suspect basic captures are the most common scenario, but a lot of different things can be done with FiddlerCore’s simple API interface. Sky’s the limit! The source code for this sample capture form (WinForms) is provided as part of this article. Adding Fiddler Certificates with FiddlerCore One of the sticking points in West Wind WebSurge has been that if you wanted to capture HTTPS/SSL traffic, you needed to have the full version of Fiddler and have HTTPS decryption enabled. Essentially you had to use Fiddler to configure HTTPS decryption and the associated installation of the Fiddler local client certificate that is used for local decryption of incoming SSL traffic. While this works just fine, requiring to have Fiddler installed and then using a separate application to configure the SSL functionality isn’t ideal. Fortunately FiddlerCore actually includes the tools to register the Fiddler Certificate directly using FiddlerCore. Why does Fiddler need a Certificate in the first Place? Fiddler and FiddlerCore are essentially HTTP proxies which means they inject themselves into the HTTP conversation by re-routing HTTP traffic to a special HTTP port (8888 by default for Fiddler) and then forward the HTTP data to the original client. Fiddler injects itself as the system proxy in using the WinInet Windows settings  which are the same settings that Internet Explorer uses and that are configured in the Windows and Internet Explorer Internet Settings dialog. Most HTTP clients running on Windows pick up and apply these system level Proxy settings before establishing new HTTP connections and that’s why most clients automatically work once Fiddler – or FiddlerCore/WebSurge are running. For plain HTTP requests this just works – Fiddler intercepts the HTTP requests on the proxy port and then forwards them to the original port (80 for HTTP and 443 for SSL typically but it could be any port). For SSL however, this is not quite as simple – Fiddler can easily act as an HTTPS/SSL client to capture inbound requests from the server, but when it forwards the request to the client it has to also act as an SSL server and provide a certificate that the client trusts. This won’t be the original certificate from the remote site, but rather a custom local certificate that effectively simulates an SSL connection between the proxy and the client. If there is no custom certificate configured for Fiddler the SSL request fails with a certificate validation error. The key for this to work is that a custom certificate has to be installed that the HTTPS client trusts on the local machine. For a much more detailed description of the process you can check out Eric Lawrence’s blog post on Certificates. If you’re using the desktop version of Fiddler you can install a local certificate into the Windows certificate store. Fiddler proper does this from the Options menu: This operation does several things: It installs the Fiddler Root Certificate It sets trust to this Root Certificate A new client certificate is generated for each HTTPS site monitored Certificate Installation with FiddlerCore You can also provide this same functionality using FiddlerCore which includes a CertMaker class. Using CertMaker is straight forward to use and it provides an easy way to create some simple helpers that can install and uninstall a Fiddler Root certificate:public static bool InstallCertificate() { if (!CertMaker.rootCertExists()) { if (!CertMaker.createRootCert()) return false; if (!CertMaker.trustRootCert()) return false; } return true; } public static bool UninstallCertificate() { if (CertMaker.rootCertExists()) { if (!CertMaker.removeFiddlerGeneratedCerts(true)) return false; } return true; } InstallCertificate() works by first checking whether the root certificate is already installed and if it isn’t goes ahead and creates a new one. The process of creating the certificate is a two step process – first the actual certificate is created and then it’s moved into the certificate store to become trusted. I’m not sure why you’d ever split these operations up since a cert created without trust isn’t going to be of much value, but there are two distinct steps. When you trigger the trustRootCert() method, a message box will pop up on the desktop that lets you know that you’re about to trust a local private certificate. This is a security feature to ensure that you really want to trust the Fiddler root since you are essentially installing a man in the middle certificate. It’s quite safe to use this generated root certificate, because it’s been specifically generated for your machine and thus is not usable from external sources, the only way to use this certificate in a trusted way is from the local machine. IOW, unless somebody has physical access to your machine, there’s no useful way to hijack this certificate and use it for nefarious purposes (see Eric’s post for more details). Once the Root certificate has been installed, FiddlerCore/Fiddler create new certificates for each site that is connected to with HTTPS. You can end up with quite a few temporary certificates in your certificate store. To uninstall you can either use Fiddler and simply uncheck the Decrypt HTTPS traffic option followed by the remove Fiddler certificates button, or you can use FiddlerCore’s CertMaker.removeFiddlerGeneratedCerts() which removes the root cert and any of the intermediary certificates Fiddler created. Keep in mind that when you uninstall you uninstall the certificate for both FiddlerCore and Fiddler, so use UninstallCertificate() with care and realize that you might affect the Fiddler application’s operation by doing so as well. When to check for an installed Certificate Note that the check to see if the root certificate exists is pretty fast, while the actual process of installing the certificate is a relatively slow operation that even on a fast machine takes a few seconds. Further the trust operation pops up a message box so you probably don’t want to install the certificate repeatedly. Since the check for the root certificate is fast, you can easily put a call to InstallCertificate() in any capture startup code – in which case the certificate installation only triggers when a certificate is in fact not installed. Personally I like to make certificate installation explicit – just like Fiddler does, so in WebSurge I use a small drop down option on the menu to install or uninstall the SSL certificate:   This code calls the InstallCertificate and UnInstallCertificate functions respectively – the experience with this is similar to what you get in Fiddler with the extra dialog box popping up to prompt confirmation for installation of the root certificate. Once the cert is installed you can then capture SSL requests. There’s a gotcha however… Gotcha: FiddlerCore Certificates don’t stick by Default When I originally tried to use the Fiddler certificate installation I ran into an odd problem. I was able to install the certificate and immediately after installation was able to capture HTTPS requests. Then I would exit the application and come back in and try the same HTTPS capture again and it would fail due to a missing certificate. CertMaker.rootCertExists() would return false after every restart and if re-installed the certificate a new certificate would get added to the certificate store resulting in a bunch of duplicated root certificates with different keys. What the heck? CertMaker and BcMakeCert create non-sticky CertificatesI turns out that FiddlerCore by default uses different components from what the full version of Fiddler uses. Fiddler uses a Windows utility called MakeCert.exe to create the Fiddler Root certificate. FiddlerCore however installs the CertMaker.dll and BCMakeCert.dll assemblies, which use a different crypto library (Bouncy Castle) for certificate creation than MakeCert.exe which uses the Windows Crypto API. The assemblies provide support for non-windows operation for Fiddler under Mono, as well as support for some non-Windows certificate platforms like iOS and Android for decryption. The bottom line is that the FiddlerCore provided bouncy castle assemblies are not sticky by default as the certificates created with them are not cached as they are in Fiddler proper. To get certificates to ‘stick’ you have to explicitly cache the certificates in Fiddler’s internal preferences. A cache aware version of InstallCertificate looks something like this:public static bool InstallCertificate() { if (!CertMaker.rootCertExists()) { if (!CertMaker.createRootCert()) return false; if (!CertMaker.trustRootCert()) return false; App.Configuration.UrlCapture.Cert = FiddlerApplication.Prefs.GetStringPref("fiddler.certmaker.bc.cert", null); App.Configuration.UrlCapture.Key = FiddlerApplication.Prefs.GetStringPref("fiddler.certmaker.bc.key", null); } return true; } public static bool UninstallCertificate() { if (CertMaker.rootCertExists()) { if (!CertMaker.removeFiddlerGeneratedCerts(true)) return false; } App.Configuration.UrlCapture.Cert = null; App.Configuration.UrlCapture.Key = null; return true; } In this code I store the Fiddler cert and private key in an application configuration settings that’s stored with the application settings (App.Configuration.UrlCapture object). These settings automatically persist when WebSurge is shut down. The values are read out of Fiddler’s internal preferences store which is set after a new certificate has been created. Likewise I clear out the configuration settings when the certificate is uninstalled. In order for these setting to be used you have to also load the configuration settings into the Fiddler preferences *before* a call to rootCertExists() is made. I do this in the capture form’s constructor:public FiddlerCapture(StressTestForm form) { InitializeComponent(); CaptureConfiguration = App.Configuration.UrlCapture; MainForm = form; if (!string.IsNullOrEmpty(App.Configuration.UrlCapture.Cert)) { FiddlerApplication.Prefs.SetStringPref("fiddler.certmaker.bc.key", App.Configuration.UrlCapture.Key); FiddlerApplication.Prefs.SetStringPref("fiddler.certmaker.bc.cert", App.Configuration.UrlCapture.Cert); }} This is kind of a drag to do and not documented anywhere that I could find, so hopefully this will save you some grief if you want to work with the stock certificate logic that installs with FiddlerCore. MakeCert provides sticky Certificates and the same functionality as Fiddler But there’s actually an easier way. If you want to skip the above Fiddler preference configuration code in your application you can choose to distribute MakeCert.exe instead of certmaker.dll and bcmakecert.dll. When you use MakeCert.exe, the certificates settings are stored in Windows so they are available without any custom configuration inside of your application. It’s easier to integrate and as long as you run on Windows and you don’t need to support iOS or Android devices is simply easier to deal with. To integrate into your project, you can remove the reference to CertMaker.dll (and the BcMakeCert.dll assembly) from your project. Instead copy MakeCert.exe into your output folder. To make sure MakeCert.exe gets pushed out, include MakeCert.exe in your project and set the Build Action to None, and Copy to Output Directory to Copy if newer. Note that the CertMaker.dll reference in the project has been removed and on disk the files for Certmaker.dll, as well as the BCMakeCert.dll files on disk. Keep in mind that these DLLs are resources of the FiddlerCore NuGet package, so updating the package may end up pushing those files back into your project. Once MakeCert.exe is distributed FiddlerCore checks for it first before using the assemblies so as long as MakeCert.exe exists it’ll be used for certificate creation (at least on Windows). Summary FiddlerCore is a pretty sweet tool, and it’s absolutely awesome that we get to plug in most of the functionality of Fiddler right into our own applications. A few years back I tried to build this sort of functionality myself for an app and ended up giving up because it’s a big job to get HTTP right – especially if you need to support SSL. FiddlerCore now provides that functionality as a turnkey solution that can be plugged into your own apps easily. The only downside is FiddlerCore’s documentation for more advanced features like certificate installation which is pretty sketchy. While for the most part FiddlerCore’s feature set is easy to work with without any documentation, advanced features are often not intuitive to gleam by just using Intellisense or the FiddlerCore help file reference (which is not terribly useful). While Eric Lawrence is very responsive on his forum and on Twitter, there simply isn’t much useful documentation on Fiddler/FiddlerCore available online. If you run into trouble the forum is probably the first place to look and then ask a question if you can’t find the answer. The best documentation you can find is Eric’s Fiddler Book which covers a ton of functionality of Fiddler and FiddlerCore. The book is a great reference to Fiddler’s feature set as well as providing great insights into the HTTP protocol. The second half of the book that gets into the innards of HTTP is an excellent read for anybody who wants to know more about some of the more arcane aspects and special behaviors of HTTP – it’s well worth the read. While the book has tons of information in a very readable format, it’s unfortunately not a great reference as it’s hard to find things in the book and because it’s not available online you can’t electronically search for the great content in it. But it’s hard to complain about any of this given the obvious effort and love that’s gone into this awesome product for all of these years. A mighty big thanks to Eric Lawrence  for having created this useful tool that so many of us use all the time, and also to Telerik for picking up Fiddler/FiddlerCore and providing Eric the resources to support and improve this wonderful tool full time and keeping it free for all. Kudos! Resources FiddlerCore Download FiddlerCore NuGet Fiddler Capture Sample Form Fiddler Capture Form in West Wind WebSurge (GitHub) Eric Lawrence’s Fiddler Book© Rick Strahl, West Wind Technologies, 2005-2014Posted in .NET  HTTP   Tweet !function(d,s,id){var js,fjs=d.getElementsByTagName(s)[0];if(!d.getElementById(id)){js=d.createElement(s);js.id=id;js.src="//platform.twitter.com/widgets.js";fjs.parentNode.insertBefore(js,fjs);}}(document,"script","twitter-wjs"); (function() { var po = document.createElement('script'); po.type = 'text/javascript'; po.async = true; po.src = 'https://apis.google.com/js/plusone.js'; var s = document.getElementsByTagName('script')[0]; s.parentNode.insertBefore(po, s); })();

    Read the article

  • What is New in ASP.NET 4.0 Code Access Security

    - by Xiaohong
    ASP.NET Code Access Security (CAS) is a feature that helps protect server applications on hosting multiple Web sites, ASP.NET lets you assign a configurable trust level that corresponds to a predefined set of permissions. ASP.NET has predefined ASP.NET Trust Levels and Policy Files that you can assign to applications, you also can assign custom trust level and policy files. Most web hosting companies run ASP.NET applications in Medium Trust to prevent that one website affect or harm another site etc. As .NET Framework's Code Access Security model has evolved, ASP.NET 4.0 Code Access Security also has introduced several changes and improvements. The main change in ASP.NET 4.0 CAS In ASP.NET v4.0 partial trust applications, application domain can have a default partial trust permission set as opposed to being full-trust, the permission set name is defined in the <trust /> new attribute permissionSetName that is used to initialize the application domain . By default, the PermissionSetName attribute value is "ASP.Net" which is the name of the permission set you can find in all predefined partial trust configuration files. <trust level="Something" permissionSetName="ASP.Net" /> This is ASP.NET 4.0 new CAS model. For compatibility ASP.NET 4.0 also support legacy CAS model where application domain still has full trust permission set. You can specify new legacyCasModel attribute on the <trust /> element to indicate whether the legacy CAS model is enabled. By default legacyCasModel is false which means that new 4.0 CAS model is the default. <trust level="Something" legacyCasModel="true|false" /> In .Net FX 4.0 Config directory, there are two set of predefined partial trust config files for each new CAS model and legacy CAS model, trust config files with name legacy.XYZ.config are for legacy CAS model: New CAS model: Legacy CAS model: web_hightrust.config legacy.web_hightrust.config web_mediumtrust.config legacy.web_mediumtrust.config web_lowtrust.config legacy.web_lowtrust.config web_minimaltrust.config legacy.web_minimaltrust.config   The figure below shows in ASP.NET 4.0 new CAS model what permission set to grant to code for partial trust application using predefined partial trust levels and policy files:    There also some benefits that comes with the new CAS model: You can lock down a machine by making all managed code no-execute by default (e.g. setting the MyComputer zone to have no managed execution code permissions), it should still be possible to configure ASP.NET web applications to run as either full-trust or partial trust. UNC share doesn’t require full trust with CASPOL at machine-level CAS policy. Side effect that comes with the new CAS model: processRequestInApplicationTrust attribute is deprecated  in new CAS model since application domain always has partial trust permission set in new CAS model.   In ASP.NET 4.0 legacy CAS model or ASP.NET 2.0 CAS model, even though you assign partial trust level to a application but the application domain still has full trust permission set. The figure below shows in ASP.NET 4.0 legacy CAS model (or ASP.NET 2.0 CAS model) what permission set to grant to code for partial trust application using predefined partial trust levels and policy files:     What $AppDirUrl$, $CodeGen$, $Gac$ represents: $AppDirUrl$ The application's virtual root directory. This allows permissions to be applied to code that is located in the application's bin directory. For example, if a virtual directory is mapped to C:\YourWebApp, then $AppDirUrl$ would equate to C:\YourWebApp. $CodeGen$ The directory that contains dynamically generated assemblies (for example, the result of .aspx page compiles). This can be configured on a per application basis and defaults to %windir%\Microsoft.NET\Framework\{version}\Temporary ASP.NET Files. $CodeGen$ allows permissions to be applied to dynamically generated assemblies. $Gac$ Any assembly that is installed in the computer's global assembly cache (GAC). This allows permissions to be granted to strong named assemblies loaded from the GAC by the Web application.   The new customization of CAS Policy in ASP.NET 4.0 new CAS model 1. Define which named permission set in partial trust configuration files By default the permission set that will be assigned at application domain initialization time is the named "ASP.Net" permission set found in all predefined partial trust configuration files. However ASP.NET 4.0 allows you set PermissionSetName attribute to define which named permission set in a partial trust configuration file should be the one used to initialize an application domain. Example: add "ASP.Net_2" named permission set in partial trust configuration file: <PermissionSet class="NamedPermissionSet" version="1" Name="ASP.Net_2"> <IPermission class="FileIOPermission" version="1" Read="$AppDir$" PathDiscovery="$AppDir$" /> <IPermission class="ReflectionPermission" version="1" Flags ="RestrictedMemberAccess" /> <IPermission class="SecurityPermission " version="1" Flags ="Execution, ControlThread, ControlPrincipal, RemotingConfiguration" /></PermissionSet> Then you can use "ASP.Net_2" named permission set for the application domain permission set: <trust level="Something" legacyCasModel="false" permissionSetName="ASP.Net_2" /> 2. Define a custom set of Full Trust Assemblies for an application By using the new fullTrustAssemblies element to configure a set of Full Trust Assemblies for an application, you can modify set of partial trust assemblies to full trust at the machine, site or application level. The configuration definition is shown below: <fullTrustAssemblies> <add assemblyName="MyAssembly" version="1.1.2.3" publicKey="hex_char_representation_of_key_blob" /></fullTrustAssemblies> 3. Define <CodeGroup /> policy in partial trust configuration files ASP.NET 4.0 new CAS model will retain the ability for developers to optionally define <CodeGroup />with membership conditions and assigned permission sets. The specific restriction in ASP.NET 4.0 new CAS model though will be that the results of evaluating custom policies can only result in one of two outcomes: either an assembly is granted full trust, or an assembly is granted the partial trust permission set currently associated with the running application domain. It will not be possible to use custom policies to create additional custom partial trust permission sets. When parsing the partial trust configuration file: Any assemblies that match to code groups associated with "PermissionSet='FullTrust'" will run at full trust. Any assemblies that match to code groups associated with "PermissionSet='Nothing'" will result in a PolicyError being thrown from the CLR. This is acceptable since it provides administrators with a way to do a blanket-deny of managed code followed by selectively defining policy in a <CodeGroup /> that re-adds assemblies that would be allowed to run. Any assemblies that match to code groups associated with other permissions sets will be interpreted to mean the assembly should run at the permission set of the appdomain. This means that even though syntactically a developer could define additional "flavors" of partial trust in an ASP.NET partial trust configuration file, those "flavors" will always be ignored. Example: defines full trust in <CodeGroup /> for my strong named assemblies in partial trust config files: <CodeGroup class="FirstMatchCodeGroup" version="1" PermissionSetName="Nothing"> <IMembershipCondition    class="AllMembershipCondition"    version="1" /> <CodeGroup    class="UnionCodeGroup"    version="1"    PermissionSetName="FullTrust"    Name="My_Strong_Name"    Description="This code group grants code signed full trust. "> <IMembershipCondition      class="StrongNameMembershipCondition" version="1"       PublicKeyBlob="hex_char_representation_of_key_blob" /> </CodeGroup> <CodeGroup   class="UnionCodeGroup" version="1" PermissionSetName="ASP.Net">   <IMembershipCondition class="UrlMembershipCondition" version="1" Url="$AppDirUrl$/*" /> </CodeGroup> <CodeGroup class="UnionCodeGroup" version="1" PermissionSetName="ASP.Net">   <IMembershipCondition class="UrlMembershipCondition" version="1" Url="$CodeGen$/*"   /> </CodeGroup></CodeGroup>   4. Customize CAS policy at runtime in ASP.NET 4.0 new CAS model ASP.NET 4.0 new CAS model allows to customize CAS policy at runtime by using custom HostSecurityPolicyResolver that overrides the ASP.NET code access security policy. Example: use custom host security policy resolver to resolve partial trust web application bin folder MyTrustedAssembly.dll to full trust at runtime: You can create a custom host security policy resolver and compile it to assembly MyCustomResolver.dll with strong name enabled and deploy in GAC: public class MyCustomResolver : HostSecurityPolicyResolver{ public override HostSecurityPolicyResults ResolvePolicy(Evidence evidence) { IEnumerator hostEvidence = evidence.GetHostEnumerator(); while (hostEvidence.MoveNext()) { object hostEvidenceObject = hostEvidence.Current; if (hostEvidenceObject is System.Security.Policy.Url) { string assemblyName = hostEvidenceObject.ToString(); if (assemblyName.Contains(“MyTrustedAssembly.dll”) return HostSecurityPolicyResult.FullTrust; } } //default fall-through return HostSecurityPolicyResult.DefaultPolicy; }} Because ASP.NET accesses the custom HostSecurityPolicyResolver during application domain initialization, and a custom policy resolver requires full trust, you also can add a custom policy resolver in <fullTrustAssemblies /> , or deploy in the GAC. You also need configure a custom HostSecurityPolicyResolver instance by adding the HostSecurityPolicyResolverType attribute in the <trust /> element: <trust level="Something" legacyCasModel="false" hostSecurityPolicyResolverType="MyCustomResolver, MyCustomResolver" permissionSetName="ASP.Net" />   Note: If an assembly policy define in <CodeGroup/> and also in hostSecurityPolicyResolverType, hostSecurityPolicyResolverType will win. If an assembly added in <fullTrustAssemblies/> then the assembly has full trust no matter what policy in <CodeGroup/> or in hostSecurityPolicyResolverType.   Other changes in ASP.NET 4.0 CAS Use the new transparency model introduced in .Net Framework 4.0 Change in dynamically compiled code generated assemblies by ASP.NET: In new CAS model they will be marked as security transparent level2 to use Framework 4.0 security transparent rule that means partial trust code is treated as completely Transparent and it is more strict enforcement. In legacy CAS model they will be marked as security transparent level1 to use Framework 2.0 security transparent rule for compatibility. Most of ASP.NET products runtime assemblies are also changed to be marked as security transparent level2 to switch to SecurityTransparent code by default unless SecurityCritical or SecuritySafeCritical attribute specified. You also can look at Security Changes in the .NET Framework 4 for more information about these security attributes. Support conditional APTCA If an assembly is marked with the Conditional APTCA attribute to allow partially trusted callers, and if you want to make the assembly both visible and accessible to partial-trust code in your web application, you must add a reference to the assembly in the partialTrustVisibleAssemblies section: <partialTrustVisibleAssemblies> <add assemblyName="MyAssembly" publicKey="hex_char_representation_of_key_blob" />/partialTrustVisibleAssemblies>   Most of ASP.NET products runtime assemblies are also changed to be marked as conditional APTCA to prevent use of ASP.NET APIs in partial trust environments such as Winforms or WPF UI controls hosted in Internet Explorer.   Differences between ASP.NET new CAS model and legacy CAS model: Here list some differences between ASP.NET new CAS model and legacy CAS model ASP.NET 4.0 legacy CAS model  : Asp.net partial trust appdomains have full trust permission Multiple different permission sets in a single appdomain are allowed in ASP.NET partial trust configuration files Code groups Machine CAS policy is honored processRequestInApplicationTrust attribute is still honored    New configuration setting for legacy model: <trust level="Something" legacyCASModel="true" ></trust><partialTrustVisibleAssemblies> <add assemblyName="MyAssembly" publicKey="hex_char_representation_of_key_blob" /></partialTrustVisibleAssemblies>   ASP.NET 4.0 new CAS model: ASP.NET will now run in homogeneous application domains. Only full trust or the app-domain's partial trust grant set, are allowable permission sets. It is no longer possible to define arbitrary permission sets that get assigned to different assemblies. If an application currently depends on fine-tuning the partial trust permission set using the ASP.NET partial trust configuration file, this will no longer be possible. processRequestInApplicationTrust attribute is deprecated Dynamically compiled assemblies output by ASP.NET build providers will be updated to explicitly mark assemblies as transparent. ASP.NET partial trust grant sets will be independent from any enterprise, machine, or user CAS policy levels. A simplified model for locking down web servers that only allows trusted managed web applications to run. Machine policy used to always grant full-trust to managed code (based on membership conditions) can instead be configured using the new ASP.NET 4.0 full-trust assembly configuration section. The full-trust assembly configuration section requires explicitly listing each assembly as opposed to using membership conditions. Alternatively, the membership condition(s) used in machine policy can instead be re-defined in a <CodeGroup /> within ASP.NET's partial trust configuration file to grant full-trust.   New configuration setting for new model: <trust level="Something" legacyCASModel="false" permissionSetName="ASP.Net" hostSecurityPolicyResolverType=".NET type string" ></trust><fullTrustAssemblies> <add assemblyName=”MyAssembly” version=”1.0.0.0” publicKey="hex_char_representation_of_key_blob" /></fullTrustAssemblies><partialTrustVisibleAssemblies> <add assemblyName="MyAssembly" publicKey="hex_char_representation_of_key_blob" /></partialTrustVisibleAssemblies>     Hope this post is helpful to better understand the ASP.Net 4.0 CAS. Xiaohong Tang ASP.NET QA Team

    Read the article

  • Integrating HTML into Silverlight Applications

    - by dwahlin
    Looking for a way to display HTML content within a Silverlight application? If you haven’t tried doing that before it can be challenging at first until you know a few tricks of the trade.  Being able to display HTML is especially handy when you’re required to display RSS feeds (with embedded HTML), SQL Server Reporting Services reports, PDF files (not actually HTML – but the techniques discussed will work), or other HTML content.  In this post I'll discuss three options for displaying HTML content in Silverlight applications and describe how my company is using these techniques in client applications. Displaying HTML Overlays If you need to display HTML over a Silverlight application (such as an RSS feed containing HTML data in it) you’ll need to set the Silverlight control’s windowless parameter to true. This can be done using the object tag as shown next: <object data="data:application/x-silverlight-2," type="application/x-silverlight-2" width="100%" height="100%"> <param name="source" value="ClientBin/HTMLAndSilverlight.xap"/> <param name="onError" value="onSilverlightError" /> <param name="background" value="white" /> <param name="minRuntimeVersion" value="4.0.50401.0" /> <param name="autoUpgrade" value="true" /> <param name="windowless" value="true" /> <a href="http://go.microsoft.com/fwlink/?LinkID=149156&v=4.0.50401.0" style="text-decoration:none"> <img src="http://go.microsoft.com/fwlink/?LinkId=161376" alt="Get Microsoft Silverlight" style="border-style:none"/> </a> </object> By setting the control to “windowless” you can overlay HTML objects by using absolute positioning and other CSS techniques. Keep in mind that on Windows machines the windowless setting can result in a performance hit when complex animations or HD video are running since the plug-in content is displayed directly by the browser window. It goes without saying that you should only set windowless to true when you really need the functionality it offers. For example, if I want to display my blog’s RSS content on top of a Silverlight application I could set windowless to true and create a user control that grabbed the content and output it using a DataList control: <style type="text/css"> a {text-decoration:none;font-weight:bold;font-size:14pt;} </style> <div style="margin-top:10px; margin-left:10px;margin-right:5px;"> <asp:DataList ID="RSSDataList" runat="server" DataSourceID="RSSDataSource"> <ItemTemplate> <a href='<%# XPath("link") %>'><%# XPath("title") %></a> <br /> <%# XPath("description") %> <br /> </ItemTemplate> </asp:DataList> <asp:XmlDataSource ID="RSSDataSource" DataFile="http://weblogs.asp.net/dwahlin/rss.aspx" XPath="rss/channel/item" CacheDuration="60" runat="server" /> </div> The user control can then be placed in the page hosting the Silverlight control as shown below. This example adds a Close button, additional content to display in the overlay window and the HTML generated from the user control. <div id="RSSDiv"> <div style="background-color:#484848;border:1px solid black;height:35px;width:100%;"> <img alt="Close Button" align="right" src="Images/Close.png" onclick="HideOverlay();" style="cursor:pointer;" /> </div> <div style="overflow:auto;width:800px;height:565px;"> <div style="float:left;width:100px;height:103px;margin-left:10px;margin-top:5px;"> <img src="http://weblogs.asp.net/blogs/dwahlin/dan2008.jpg" style="border:1px solid Gray" /> </div> <div style="float:left;width:300px;height:103px;margin-top:5px;"> <a href="http://weblogs.asp.net/dwahlin" style="margin-left:10px;font-size:20pt;">Dan Wahlin's Blog</a> </div> <br /><br /><br /> <div style="clear:both;margin-top:20px;"> <uc:BlogRoller ID="BlogRoller" runat="server" /> </div> </div> </div> Of course, we wouldn’t want the RSS HTML content to be shown until requested. Once it’s requested the absolute position of where it should show above the Silverlight control can be set using standard CSS styles. The following ID selector named #RSSDiv handles hiding the overlay div shown above and determines where it will be display on the screen. #RSSDiv { background-color:White; position:absolute; top:100px; left:300px; width:800px; height:600px; border:1px solid black; display:none; } Now that the HTML content to display above the Silverlight control is set, how can we show it as a user clicks a HyperlinkButton or other control in the application? Fortunately, Silverlight provides an excellent HTML bridge that allows direct access to content hosted within a page. The following code shows two JavaScript functions that can be called from Siverlight to handle showing or hiding HTML overlay content. The two functions rely on jQuery (http://www.jQuery.com) to make it easy to select HTML objects and manipulate their properties: function ShowOverlay() { rssDiv.css('display', 'block'); } function HideOverlay() { rssDiv.css('display', 'none'); } Calling the ShowOverlay function is as simple as adding the following code into the Silverlight application within a button’s Click event handler: private void OverlayHyperlinkButton_Click(object sender, RoutedEventArgs e) { HtmlPage.Window.Invoke("ShowOverlay"); } The result of setting the Silverlight control’s windowless parameter to true and showing the HTML overlay content is shown in the following screenshot:   Thinking Outside the Box to Show HTML Content Setting the windowless parameter to true may not be a viable option for some Silverlight applications or you may simply want to go about showing HTML content a different way. The next technique I’ll show takes advantage of simple HTML, CSS and JavaScript code to handle showing HTML content while a Silverlight application is running in the browser. Keep in mind that with Silverlight’s HTML bridge feature you can always pop-up HTML content in a new browser window using code similar to the following: System.Windows.Browser.HtmlPage.Window.Navigate( new Uri("http://silverlight.net"), "_blank"); For this example I’ll demonstrate how to hide the Silverlight application while maximizing a container div containing the HTML content to show. This allows HTML content to take up the full screen area of the browser without having to set windowless to true and when done right can make the user feel like they never left the Silverlight application. The following HTML shows several div elements that are used to display HTML within the same browser window as the Silverlight application: <div id="JobPlanDiv"> <div style="vertical-align:middle"> <img alt="Close Button" align="right" src="Images/Close.png" onclick="HideJobPlanIFrame();" style="cursor:pointer;" /> </div> <div id="JobPlan_IFrame_Container" style="height:95%;width:100%;margin-top:37px;"></div> </div> The JobPlanDiv element acts as a container for two other divs that handle showing a close button and hosting an iframe that will be added dynamically at runtime. JobPlanDiv isn’t visible when the Silverlight application loads due to the following ID selector added into the page: #JobPlanDiv { position:absolute; background-color:#484848; overflow:hidden; left:0; top:0; height:100%; width:100%; display:none; } When the HTML content needs to be shown or hidden the JavaScript functions shown next can be used: var jobPlanIFrameID = 'JobPlan_IFrame'; var slHost = null; var jobPlanContainer = null; var jobPlanIFrameContainer = null; var rssDiv = null; $(document).ready(function () { slHost = $('#silverlightControlHost'); jobPlanContainer = $('#JobPlanDiv'); jobPlanIFrameContainer = $('#JobPlan_IFrame_Container'); rssDiv = $('#RSSDiv'); }); function ShowJobPlanIFrame(url) { jobPlanContainer.css('display', 'block'); $('<iframe id="' + jobPlanIFrameID + '" src="' + url + '" style="height:100%;width:100%;" />') .appendTo(jobPlanIFrameContainer); slHost.css('width', '0%'); } function HideJobPlanIFrame() { jobPlanContainer.css('display', 'none'); $('#' + jobPlanIFrameID).remove(); slHost.css('width', '100%'); } ShowJobPlanIFrame() handles showing the JobPlanDiv div and adding an iframe into it dynamically. Once JobPlanDiv is shown, the Silverlight control host has its width set to a value of 0% to allow the control to stay alive while making it invisible to the user. I found that this technique works better across multiple browsers as opposed to manipulating the Silverlight control host div’s display or visibility properties. Now that you’ve seen the code to handle showing and hiding the HTML content area, let’s switch focus to the Silverlight application. As a user clicks on a link such as “View Report” the ShowJobPlanIFrame() JavaScript function needs to be called. The following code handles that task: private void ReportHyperlinkButton_Click(object sender, RoutedEventArgs e) { ShowBrowser(_BaseUrl + "/Report.aspx"); } public void ShowBrowser(string url) { HtmlPage.Window.Invoke("ShowJobPlanIFrame", url); } Any URL can be passed into the ShowBrowser() method which handles invoking the JavaScript function. This includes standard web pages or even PDF files. We’ve used this technique frequently with our SmartPrint control (http://www.smartwebcontrols.com) which converts Silverlight screens into PDF documents and displays them. Here’s an example of the content generated:   Silverlight 4’s WebBrowser Control Both techniques shown to this point work well when Silverlight is running in-browser but not so well when it’s running out-of-browser since there’s no host page that you can access using the HTML bridge. Fortunately, Silverlight 4 provides a WebBrowser control that can be used to perform the same functionality quite easily. We’re currently using it in client applications to display PDF documents, SSRS reports and standard HTML content. Using the WebBrowser control simplifies the application quite a bit since no JavaScript is required if the application only runs out-of-browser. Here’s a simple example of defining the WebBrowser control in XAML. I typically define it in MainPage.xaml when a Silverlight Navigation template is used to create the project so that I can re-use the functionality across multiple screens. <Grid x:Name="WebBrowserGrid" HorizontalAlignment="Stretch" VerticalAlignment="Stretch" Visibility="Collapsed"> <StackPanel HorizontalAlignment="Stretch" VerticalAlignment="Stretch"> <Border Background="#484848" HorizontalAlignment="Stretch" Height="40"> <Image x:Name="WebBrowserImage" Width="100" Height="33" Cursor="Hand" HorizontalAlignment="Right" Source="/HTMLAndSilverlight;component/Assets/Images/Close.png" MouseLeftButtonDown="WebBrowserImage_MouseLeftButtonDown" /> </Border> <WebBrowser x:Name="JobPlanReportWebBrowser" HorizontalAlignment="Stretch" VerticalAlignment="Stretch" /> </StackPanel> </Grid> Looking through the XAML you can see that a close image is defined along with the WebBrowser control. Because the URL that the WebBrowser should navigate to isn’t known at design time no value is assigned to the control’s Source property. If the XAML shown above is left “as is” you’ll find that any HTML content assigned to the WebBrowser doesn’t display properly. This is due to no height or width being set on the control. To handle this issue the following code is added into the XAML’s code-behind file to dynamically determine the height and width of the page and assign it to the WebBrowser. This is done by handling the SizeChanged event. void MainPage_SizeChanged(object sender, SizeChangedEventArgs e) { WebBrowserGrid.Height = JobPlanReportWebBrowser.Height = ActualHeight; WebBrowserGrid.Width = JobPlanReportWebBrowser.Width = ActualWidth; } When the user wants to view HTML content they click a button which executes the code shown in next: public void ShowBrowser(string url) { if (Application.Current.IsRunningOutOfBrowser) { JobPlanReportWebBrowser.NavigateToString("<html><body><iframe src='" + url + "' style='width:100%;height:97%;' /></body></html>"); WebBrowserGrid.Visibility = Visibility.Visible; } else { HtmlPage.Window.Invoke("ShowJobPlanIFrame", url); } } private void WebBrowserImage_MouseLeftButtonDown(object sender, MouseButtonEventArgs e) { WebBrowserGrid.Visibility = Visibility.Collapsed; }   Looking through the code you’ll see that it checks to see if the Silverlight application is running out-of-browser and then either displays the WebBrowser control or runs the JavaScript function discussed earlier. Although the WebBrowser control’s Source property could be assigned the URI of the page to navigate to, by assigning HTML content using the NavigateToString() method and adding an iframe, content can be shown from any site including cross-domain sites. This is especially handy when you need to grab a page from a reporting site that’s in a different domain than the Silverlight application. Here’s an example of viewing  PDF file inside of an out-of-browser application. The first image shows the application running out-of-browser before the user clicks a PDF HyperlinkButton.  The second image shows the PDF being displayed.   While there are certainly other techniques that can be used, the ones shown here have worked well for us in different applications and provide the ability to display HTML content in-browser or out-of-browser. Feel free to add a comment if you have another tip or trick you like to use when working with HTML content in Silverlight applications.   Download Code Sample   For more information about onsite, online and video training, mentoring and consulting solutions for .NET, SharePoint or Silverlight please visit http://www.thewahlingroup.com.

    Read the article

< Previous Page | 253 254 255 256 257 258 259 260 261 262 263 264  | Next Page >