Search Results

Search found 2655 results on 107 pages for 'conversion'.

Page 27/107 | < Previous Page | 23 24 25 26 27 28 29 30 31 32 33 34  | Next Page >

  • How to convert a video to 4:3 or 16:9 aspect ratio without loss of video quality

    - by Linux Jedi
    I uploaded my video to youtube and the highest resolution it appears as is 360p. This is much lower than what I uploaded. I believe that youtube isn't making higher resolutions available for my video because of its aspect ratio. The video is 720x400. How can I convert this to a different aspect ratio without losing any of the picture or picture quality? I don't care if blank space appears around the video so long as the picture doesn't get stretched horizontally or vertically.

    Read the article

  • How can I get ffmpeg to convert a .mov to a .gif?

    - by user29336
    I'm trying to convert a .mov to a .gif and I'm not having success. Here's the error: ffmpeg -pix_fmt rgb24 -i yesbuddy.mov output.gif ffmpeg version 0.11.1 Copyright (c) 2000-2012 the FFmpeg developers built on Jun 12 2012 17:47:34 with clang 2.1 (tags/Apple/clang-163.7.1) configuration: --prefix=/usr/local/Cellar/ffmpeg/0.11.1 --enable-shared --enable-gpl --enable-version3 --enable-nonfree --enable-hardcoded-tables --enable-libfreetype --cc=/usr/bin/clang --enable-libx264 --enable-libfaac --enable-libmp3lame --enable-librtmp --enable-libtheora --enable-libvorbis --enable-libvpx --enable-libxvid --enable-libopencore-amrnb --enable-libopencore-amrwb --enable-libass --enable-libvo-aacenc --disable-ffplay libavutil 51. 54.100 / 51. 54.100 libavcodec 54. 23.100 / 54. 23.100 libavformat 54. 6.100 / 54. 6.100 libavdevice 54. 0.100 / 54. 0.100 libavfilter 2. 77.100 / 2. 77.100 libswscale 2. 1.100 / 2. 1.100 libswresample 0. 15.100 / 0. 15.100 libpostproc 52. 0.100 / 52. 0.100 Option pixel_format not found. If I leave out the -pix_fmt rgb24 part it complains. Thoughts on how to fix?

    Read the article

  • How can I convert and repair MPEG-TS (DVB-S captures) for better playback?

    - by SofaKng
    I have a lot of MPEG-TS video files (H.264 video with AC3 or MP3 in a .TS container) captured from a DVB-S capture card. When I play these videos it's much slower to seek in the video (ie. skip 30 seconds, etc) than with other files. I'm not sure if the problem is the H.264 encoding (reference frame count?) or the MPEG-TS container, or if the MPEG-TS file contains sync errors, etc. Does anybody have a good workflow for converting and repairing these files?

    Read the article

  • How to embed word doc as background picture of an Access report using .EMF or equivalent ?

    - by iDevlop
    My company's standard paper has logo, address and all the details in the right margin with a vertical blue line. I have that as a word template. I want to have the same thing as the background of my Invoices report. I managed to do that 5 years ago by saving to EMF format (vector format, prints out nicely) and putting the file as the background of the report. Now my company is moving, and I need to change the address on my invoices, but I can't find out how I did to convert the word doc to EMF. Any suggestion ? By EMF or another process, but I want to avoid BMP, which is huge and does not print nicely. Thanks !

    Read the article

  • How can I convert a large number of Word documents to HTML as fast as possible?

    - by metal gear solid
    I have to convert 500 Microsoft Word 2003 files into HTML documents. What would be the shortest possible way? I'm not just talking about extension .doc to HTML. I want to convert word files's data into HTML tags. Word 2007 is installed in my system. Any suggestion which can help to accomplish this task quickly would be nice. If you will suggest any tool then that should not be commercial. Should be free or portable.

    Read the article

  • Convert FAT32 to NTFS, risk/time?

    - by Rakward
    After a quick search I found that through a command prompt I can convert a drive from FAT32 to NTFS without losing data(see here). What I want to ask here is, how safe is this method on a 1.5 TB drive with 500 GB of data? What are the chances of this freezing up(or is there really nothin to worry about) and what is the probable time, a couple of minutes or a whole hour? Sorry if this seems like a stupid question, just want to play on the safe side here ...

    Read the article

  • Batch converting video from avc1 to xvid

    - by Tommy Brunn
    I need a way to batch convert 720p video files from avc1 to xvid in Ubuntu 10.04. I'm not terribly concerned about file size, but I do wish to retain the picture quality as much as possible. I believe the audio is encoded as aac, which is fine for my purposes. What would be the best and easiest way to do this? I've tried using Handbrake. During my first attempt, I had it using ffmpeg to convert to MPEG-4, but that just gave me a super-low quality video at twice the file size. Trying h.264 now, so we'll see how that works out. But just in case it doesn't pan out so well, what other ways do you recommend? I was thinking I'd write a bash script to reencode the files one by one, but the problem is that I have very little knowledge about codecs and containers and whatnot - so I wouldn't know what parameters I would pass ffmpeg/mencoder.

    Read the article

  • Converting Powerpoint to PDF solutions?

    - by OWiz
    I asked a version of this question earlier, but I'm in need of other solutions, so this is a more pointed question. I'm in need of a server-based solution for converting ppt files to pdf files. This solution can either sit on the current web server as a console command-triggered service, it can be integrated into the C# code of the web all, or it can be it's own server. It also can't be based off of Libreoffice or Openoffice, as those two have problems converting SmartArt. I'm currently using Libreoffice. I've tried Powerpoint console commands combined with a PDF driver but I can't get that to work from C#. I've tried a .vbs script, but that briefly opens the powerpoint window.

    Read the article

  • Batch convert of Word docs with images to HTML

    - by dylpickle
    OK, here is my situation: I made a knowledge base for a company, they have about 500 word documents with screenshots in them explaining procedures and such. I can easily paste the text into the cms wysiwyg editor on the knowledge base but the images need to be uploaded one at a time, then sized and placed in the article. Question: Is there any suggestions for an automatic method to to convert the documents to html with the appropriate image tags and links to the images in them, and export/package the images for ftp upload? I can already convert them to HTML automatically using a batch file and a program, but converting the images to the correct tags with href link, then exporting them for ftp is where i need some help. Might not even be possible, but if anyone has tried to do something like this I would like to here how you approached this.

    Read the article

  • How to suppress the unsolicited footer when converting HTML -> PDF with Acrobat?

    - by gojira
    I often convert & combine (via contextmenu) HTML pages to PDF using Acrobat (not Acrobat Reader). I use Adobe Acrobat Pro 9 Extended, version 9.1.2. The converted PDFs always have the full path of the original file on the bottom of the PDF-page, also they have an additional header line with the document. I need to suppress that. I do not want the unsolicited header and footer in the resulting PDF files as they are a pain to reomve manually, with a certain page count per document it becomes impossible. Is it possible to suppres that and if, how?

    Read the article

  • Batch convert AppleWorks files into PDF within originating folder, delete original file?

    - by Manca Weeks
    Probably AppleScript is the way to go with this - I have found scripts online that do this, but snag on oversize printable area and put files in the same folder - I need files to stay in the folder the source came from. If the script also deleted the original AppleWorks file, that would be even better, but not required. I have tried the last script from this post: https://discussions.apple.com/message/10127260#10127260#10127260 Any suggestions would be much appreciated.

    Read the article

  • how to know if a video file can be played on a dvd player

    - by user23950
    Is there an application that can emulate a dvd player? I've converted a .mp4 video using allok video converter. And choose the output format to be xVid(.avi)<--that is exactly what is written on the application. I don't want to waste a blank dvd and try if it really can be played. So if you have tried this before please tell me if it works. And I have tried burning .avi files and it works because they are genuine avi files which I did not convert

    Read the article

  • 500 MB Avi video from CD lagging/glitching when reproduced

    - by Caki Esther
    I created an extra cd with Nero Burning that contains both audio tracks (I can hear them correctly) and a .avi presentation (pretty big one, 540 MB on a 700 MB cd). The audio is fine but the problem is that when the video is played from the cd (with whatever media player: Windows Media Player, VLC, etc..) it lags/glitches/stutters. I'd like the video to be smooth, how should I burn the video to reduce this effect? I mean: what kind of compression/format and why?

    Read the article

  • convert video to images

    - by Liam
    How can I convert a video file to a sequence of images, for example one frame every N seconds. Can mplayer or ffmpeg do this? I have used MPlayer to grab screenshots manually but I would like to automate this for a long video.

    Read the article

  • PowerISO for Mac can't convert .img

    - by None
    I have a bootable .img file that I want to convert to a bootable .iso file. I downloaded poweriso for Mac and used this command: poweriso convert MyOS.img -o MyOS.iso -ot iso which returned this output: PowerISO Copyright(C) 2004-2008 PowerISO Computing, Inc Type poweriso -? for help MyOS.img: The file format is invalid or unsupported. I thought PowerISO could convert .img to .iso. Was I incorrect, or did I use the wrong commands or something like that?

    Read the article

  • Is there a good, free way to fix broken/corrupt .wmv files?

    - by chbtn
    I've recovered some files from an hdd that weren't supposed to be deleted in the first place, but they have seeking problems/crash the players. Since they have the right size, I'm thinking it might be a problem of corrupt index/header, so I'm trying to find a way to fix them. It's easy to find examples on how to fix corrupt .avi files with mencoder, but .wmv seems trickier. Also, I realize there might not be a way to fix these files, but I figure I might as well as try. As far as players go, I've tried opening it with vlc/mplayer/windows media player. I can use anything on Windows XP/7 and Ubuntu, as long as it's free. Since the files are 200mb+ and there are quite a few, I don't think trial software would work.

    Read the article

  • creating video from set of images on windows with java language [on hold]

    - by Atif
    I am stuck in making video from set of images, i am using ffmpeg tool on windows platform with java language, for single image it is converting into mp4 but for the set of images it gets failed, i have converted single % to double % with doube quotes but unsuccessful ffmpeg -r 1/5 -i "D:\novoworkspace\MGram\src\biz\novosol\mgram\main\img%%04d.jpg" -c:v libx264 -r 30 -pix_fmt yuv420p D:\novoworkspace\MGram\src\biz\novosol\mgram\main\video.mp4 Above is the exact command i tried from the command line as well from the java language with getRuntime() method. Environment is widows please suggest is it possibe under windows or I have to use some alternative Thanks Atif

    Read the article

  • Convert text to table

    - by Quattro
    I would like convert text into a table. Here is a link to the text http://www.tcdb.org/public/tcdb Short example: >gnl|TC-DB|A0CIB0|1.A.17.3.1 Chromosome undetermined scaffold_19, whole genome shotgun sequence OS=Paramecium tetraurelia GN=GSPATT00007662001 PE=4 SV=1 MDDQNQPILQEQPKPKQKKPLLNTKMVKKQKMQNKKEENLREILNFYTNQVDARKFLQKM KAVVDSNQQEKKYQDDFLNPNEYNEMQDIYEDYNMGDLVIVFPNPDADGVKNPPITYKEA PLTKTNFYSKIGNVSYENDIDELCVDEMEYLRNMRNVDGEHMDQDHVKEEI >gnl|TC-DB|A0CS82|9.B.82.1.5 Chromosome undetermined scaffold_26, whole genome shotgun sequence - Paramecium tetraurelia. MIIEEQIEEKMIYKAIHRVKVNYQKKIDRYILYKKSRWFFNLLLMLLYAYRIQNIGGFYI VTYIYCVYQLQLLIDYFTPLGLPPVNLEDEEEDDDQFQNDFSELPTTLSNKNELNDKEFR PLLRTTSEFKVWQKSVFSVIFAYFCTYIPIWDIPVYWPFLFCYFFVIVGMSIRKYIKHMK KYGYTILDFTKKK I wanted to have columns for example delimited with pipe | or ; |>gnl|TC-DB|A0CIB0|1.A.17.3.1| Chromosome undetermined scaffold_19, whole genome shotgun sequence OS=Paramecium tetraurelia GN=GSPATT00007662001 PE=4 SV=1| MDDQNQPILQEQPKPKQKKPLLNTKMVKKQKMQNKKEENLREILNFYTNQVDARKFLQKM KAVVDSNQQEKKYQDDFLNPNEYNEMQDIYEDYNMGDLVIVFPNPDADGVKNPPITYKEA PLTKTNFYSKIGNVSYENDIDELCVDEMEYLRNMRNVDGEHMDQDHVKEEI I am working with Windows and I don't know how to do it I just know every row starts with > I want to substitute the first whitespace in a row with a delimiter like | or ; after the first regular expression new line in a row, I want also a delimiter everything between the regular expression first new line and > should go into a new column (it's a sequence of a protein)

    Read the article

  • Convert file from VOC to MP3

    - by Thomas
    I would like to convert a sound file (from a digital voice recorder) with the extension .voc to an .mp3 file or some other common sound files. I am on Windows 7 64 bit. I have tried the program voc2wav but it gives me an error message saying that the program isn't 64 bit. The program has to be free and able to run without installing. (The voice recorder did come with a program that I could install, but I would like to avoid that).

    Read the article

  • Importer or converter for ClarisWorks cwk format?

    - by Justin Dearing
    I have several ClarisWorks documents (*.CWK) that I'd like to import into a more modern format like Microsoft Word or Open Office. It seems Star Office can apparently open cwk files, but the product is discontinued and cannot be downloaded any more. There has been a feature request to add a cwk importer to OpenOffice since 2002, so I doubt that OpenOffice will support cwk files any time soon. Are there any utilities that can open a cwk file besides ClarisWorks itself?

    Read the article

  • PDF - re/generate image using stream content

    - by tom_tap
    I have pdf file with 8 content streams (bytes) which behave like image layers (but they are not layers that I can turn off/on in Adobe Reader). I would like to extract these images separately, because they overlap each other (thus I am not able to "Take a Snapshot" or "Copy File to Clipboard"). So now I have these streams in below format: <Start Stream> q 599.7601 0 0 71.99921 5951.03423 4282.48177 cm /Im0 Do Q q 599.7601 0 0 71.99921 5951.03432 4210.48177 cm /Im1 Do Q q 599.7601 0 0 71.99921 5951.03441 4138.48177 cm /Im2 Do [...] My question is: how to use these data to generate or regenerate these images to be able to save it as raster or vector file? I have already tried pstoedit, but it doesn't work properly beacuse of these multi streams. Same with PDFedit.

    Read the article

< Previous Page | 23 24 25 26 27 28 29 30 31 32 33 34  | Next Page >