Search Results

Search found 71513 results on 2861 pages for 'file extension'.

Page 27/2861 | < Previous Page | 23 24 25 26 27 28 29 30 31 32 33 34  | Next Page >

  • Unset the system immutable bit in Mac OS X

    - by skylarking
    In theory I believe you can unlock and remove the system immutable bit with: chflags noschg /Path/To/File But how can you do this when you've set the bit as root? I have a file that is locked, and even running this command as root will not work as the operation is not permitted. I tried logging in as Single-User mode to no avail. I seem to remember that even though you are in as root you are in at level '1'. And to be able to remove the system-immutable flag you need to be logged in at level '0'. Does this have something to do with this issue?

    Read the article

  • Reliable file copy (move) process - mostly Unix/Linux

    - by mfinni
    Short story : We have a need for a rock-solid reliable file mover process. We have source directories that are often being written to that we need to move files from. The files come in pairs - a big binary, and a small XML index. We get a CTL file that defines these file bundles. There is a process that operates on the files once they are in the destination directory; that gets rid of them when it's done. Would rsync do the best job, or do we need to get more complex? Long story as follows : We have multiple sources to pull from : one set of directories are on a Windows machine (that does have Cygwin and an SSH daemon), and a whole pile of directories are on a set of SFTP servers (Most of these are also Windows.) Our destinations are a list of directories on AIX servers. We used to use a very reliable Perl script on the Windows/Cygwin machine when it was our only source. However, we're working on getting rid of that machine, and there are other sources now, the SFTP servers, that we cannot presently run our own scripts on. For security reasons, we can't run the copy jobs on our AIX servers - they have no access to the source servers. We currently have a homegrown Java program on a Linux machine that uses SFTP to pull from the various new SFTP source directories, copies to a local tmp directory, verifies that everything is present, then copies that to the AIX machines, and then deletes the files from the source. However, we're finding any number of bugs or poorly-handled error checking. None of us are Java experts, so fixing/improving this may be difficult. Concerns for us are: With a remote source (SFTP), will rsync leave alone any file still being written? Some of these files are large. From reading the docs, it seems like rysnc will be very good about not removing the source until the destination is reliably written. Does anyone have experience confirming or disproving this? Additional info We will be concerned about the ingestion process that operates on the files once they are in the destination directory. We don't want it operating on files while we are in the process of copying them; it waits until the small XML index file is present. Our current copy job are supposed to copy the XML file last. Sometimes the network has problems, sometimes the SFTP source servers crap out on us. Sometimes we typo the config files and a destination directory doesn't exist. We never want to lose a file due to this sort of error. We need good logs If you were presented with this, would you just script up some rsync? Or would you build or buy a tool, and if so, what would it be (or what technologies would it use?) I (and others on my team) are decent with Perl.

    Read the article

  • Debian squeeze keyboard and touchpad not working / detected on laptop

    - by Esa
    They work before gdm3 starts. a connected mouse also stops working, but functions after removal and re-plug. no xorg.conf. log doesn't show any loading of drivers for kbd/touchpad [ 33.783] X.Org X Server 1.10.4 Release Date: 2011-08-19 [ 33.783] X Protocol Version 11, Revision 0 [ 33.783] Build Operating System: Linux 3.0.0-1-amd64 x86_64 Debian [ 33.783] Current Operating System: Linux sus 3.2.0-0.bpo.2-amd64 #1 SMP Sun Mar 25 10:33:35 UTC 2012 x86_64 [ 33.783] Kernel command line: BOOT_IMAGE=/boot/vmlinuz-3.2.0-0.bpo.2-amd64 root=UUID=8686f840-d165-4d1e-b995-2ebbd94aa3d2 ro quiet [ 33.783] Build Date: 28 August 2011 09:39:43PM [ 33.783] xorg-server 2:1.10.4-1~bpo60+1 (Cyril Brulebois <[email protected]>) [ 33.783] Current version of pixman: 0.16.4 [ 33.783] Before reporting problems, check http://wiki.x.org to make sure that you have the latest version. [ 33.783] Markers: (--) probed, (**) from config file, (==) default setting, (++) from command line, (!!) notice, (II) informational, (WW) warning, (EE) error, (NI) not implemented, (??) unknown. [ 33.783] (==) Log file: "/var/log/Xorg.0.log", Time: Wed Mar 28 09:34:04 2012 [ 33.837] (==) Using system config directory "/usr/share/X11/xorg.conf.d" [ 33.936] (==) No Layout section. Using the first Screen section. [ 33.936] (==) No screen section available. Using defaults. [ 33.936] (**) |-->Screen "Default Screen Section" (0) [ 33.936] (**) | |-->Monitor "<default monitor>" [ 33.936] (==) No monitor specified for screen "Default Screen Section". Using a default monitor configuration. [ 33.936] (==) Automatically adding devices [ 33.936] (==) Automatically enabling devices [ 34.164] (WW) The directory "/usr/share/fonts/X11/cyrillic" does not exist. [ 34.164] Entry deleted from font path. [ 34.226] (==) FontPath set to: /usr/share/fonts/X11/misc, /usr/share/fonts/X11/100dpi/:unscaled, /usr/share/fonts/X11/75dpi/:unscaled, /usr/share/fonts/X11/Type1, /usr/share/fonts/X11/100dpi, /usr/share/fonts/X11/75dpi, /var/lib/defoma/x-ttcidfont-conf.d/dirs/TrueType, built-ins [ 34.226] (==) ModulePath set to "/usr/lib/xorg/modules" [ 34.226] (II) The server relies on udev to provide the list of input devices. If no devices become available, reconfigure udev or disable AutoAddDevices. [ 34.226] (II) Loader magic: 0x7d3ae0 [ 34.226] (II) Module ABI versions: [ 34.226] X.Org ANSI C Emulation: 0.4 [ 34.226] X.Org Video Driver: 10.0 [ 34.226] X.Org XInput driver : 12.2 [ 34.226] X.Org Server Extension : 5.0 [ 34.227] (--) PCI:*(0:1:5:0) 1002:9712:103c:1661 rev 0, Mem @ 0xd0000000/268435456, 0xf1400000/65536, 0xf1300000/1048576, I/O @ 0x00008000/256 [ 34.227] (--) PCI: (0:2:0:0) 1002:6760:103c:1661 rev 0, Mem @ 0xe0000000/268435456, 0xf0300000/131072, I/O @ 0x00004000/256, BIOS @ 0x????????/131072 [ 34.227] (II) Open ACPI successful (/var/run/acpid.socket) [ 34.227] (II) LoadModule: "extmod" [ 34.249] (II) Loading /usr/lib/xorg/modules/extensions/libextmod.so [ 34.277] (II) Module extmod: vendor="X.Org Foundation" [ 34.277] compiled for 1.10.4, module version = 1.0.0 [ 34.277] Module class: X.Org Server Extension [ 34.277] ABI class: X.Org Server Extension, version 5.0 [ 34.277] (II) Loading extension SELinux [ 34.277] (II) Loading extension MIT-SCREEN-SAVER [ 34.277] (II) Loading extension XFree86-VidModeExtension [ 34.277] (II) Loading extension XFree86-DGA [ 34.277] (II) Loading extension DPMS [ 34.277] (II) Loading extension XVideo [ 34.277] (II) Loading extension XVideo-MotionCompensation [ 34.277] (II) Loading extension X-Resource [ 34.277] (II) LoadModule: "dbe" [ 34.277] (II) Loading /usr/lib/xorg/modules/extensions/libdbe.so [ 34.299] (II) Module dbe: vendor="X.Org Foundation" [ 34.299] compiled for 1.10.4, module version = 1.0.0 [ 34.299] Module class: X.Org Server Extension [ 34.299] ABI class: X.Org Server Extension, version 5.0 [ 34.299] (II) Loading extension DOUBLE-BUFFER [ 34.299] (II) LoadModule: "glx" [ 34.299] (II) Loading /usr/lib/xorg/modules/extensions/libglx.so [ 34.477] (II) Module glx: vendor="X.Org Foundation" [ 34.477] compiled for 1.10.4, module version = 1.0.0 [ 34.477] ABI class: X.Org Server Extension, version 5.0 [ 34.477] (==) AIGLX enabled [ 34.477] (II) Loading extension GLX [ 34.477] (II) LoadModule: "record" [ 34.478] (II) Loading /usr/lib/xorg/modules/extensions/librecord.so [ 34.481] (II) Module record: vendor="X.Org Foundation" [ 34.481] compiled for 1.10.4, module version = 1.13.0 [ 34.481] Module class: X.Org Server Extension [ 34.481] ABI class: X.Org Server Extension, version 5.0 [ 34.481] (II) Loading extension RECORD [ 34.481] (II) LoadModule: "dri" [ 34.481] (II) Loading /usr/lib/xorg/modules/extensions/libdri.so [ 34.512] (II) Module dri: vendor="X.Org Foundation" [ 34.512] compiled for 1.10.4, module version = 1.0.0 [ 34.512] ABI class: X.Org Server Extension, version 5.0 [ 34.512] (II) Loading extension XFree86-DRI [ 34.512] (II) LoadModule: "dri2" [ 34.512] (II) Loading /usr/lib/xorg/modules/extensions/libdri2.so [ 34.515] (II) Module dri2: vendor="X.Org Foundation" [ 34.515] compiled for 1.10.4, module version = 1.2.0 [ 34.515] ABI class: X.Org Server Extension, version 5.0 [ 34.515] (II) Loading extension DRI2 [ 34.515] (==) Matched ati as autoconfigured driver 0 [ 34.515] (==) Matched vesa as autoconfigured driver 1 [ 34.515] (==) Matched fbdev as autoconfigured driver 2 [ 34.515] (==) Assigned the driver to the xf86ConfigLayout [ 34.515] (II) LoadModule: "ati" [ 34.706] (II) Loading /usr/lib/xorg/modules/drivers/ati_drv.so [ 34.724] (II) Module ati: vendor="X.Org Foundation" [ 34.724] compiled for 1.10.3, module version = 6.14.2 [ 34.724] Module class: X.Org Video Driver [ 34.724] ABI class: X.Org Video Driver, version 10.0 [ 34.724] (II) LoadModule: "radeon" [ 34.725] (II) Loading /usr/lib/xorg/modules/drivers/radeon_drv.so [ 34.923] (II) Module radeon: vendor="X.Org Foundation" [ 34.923] compiled for 1.10.3, module version = 6.14.2 [ 34.923] Module class: X.Org Video Driver [ 34.923] ABI class: X.Org Video Driver, version 10.0 [ 34.945] (II) LoadModule: "vesa" [ 34.945] (II) Loading /usr/lib/xorg/modules/drivers/vesa_drv.so [ 34.988] (II) Module vesa: vendor="X.Org Foundation" [ 34.988] compiled for 1.10.3, module version = 2.3.0 [ 34.988] Module class: X.Org Video Driver [ 34.988] ABI class: X.Org Video Driver, version 10.0 [ 34.988] (II) LoadModule: "fbdev" [ 34.988] (II) Loading /usr/lib/xorg/modules/drivers/fbdev_drv.so [ 35.020] (II) Module fbdev: vendor="X.Org Foundation" [ 35.020] compiled for 1.10.3, module version = 0.4.2 [ 35.020] ABI class: X.Org Video Driver, version 10.0 [ 35.020] (II) RADEON: Driver for ATI Radeon chipsets: <snip> [ 35.023] (II) VESA: driver for VESA chipsets: vesa [ 35.023] (II) FBDEV: driver for framebuffer: fbdev [ 35.023] (++) using VT number 7 [ 35.033] (II) Loading /usr/lib/xorg/modules/drivers/radeon_drv.so [ 35.033] (II) [KMS] Kernel modesetting enabled. [ 35.033] (WW) Falling back to old probe method for vesa [ 35.034] (WW) Falling back to old probe method for fbdev [ 35.034] (II) Loading sub module "fbdevhw" [ 35.034] (II) LoadModule: "fbdevhw" [ 35.034] (II) Loading /usr/lib/xorg/modules/libfbdevhw.so [ 35.185] (II) Module fbdevhw: vendor="X.Org Foundation" [ 35.185] compiled for 1.10.4, module version = 0.0.2 [ 35.185] ABI class: X.Org Video Driver, version 10.0 [ 35.288] (II) RADEON(0): Creating default Display subsection in Screen section "Default Screen Section" for depth/fbbpp 24/32 [ 35.288] (==) RADEON(0): Depth 24, (--) framebuffer bpp 32 [ 35.288] (II) RADEON(0): Pixel depth = 24 bits stored in 4 bytes (32 bpp pixmaps) [ 35.288] (==) RADEON(0): Default visual is TrueColor [ 35.288] (==) RADEON(0): RGB weight 888 [ 35.288] (II) RADEON(0): Using 8 bits per RGB (8 bit DAC) [ 35.288] (--) RADEON(0): Chipset: "ATI Mobility Radeon HD 4200" (ChipID = 0x9712) [ 35.288] (II) RADEON(0): PCI card detected [ 35.288] drmOpenDevice: node name is /dev/dri/card0 [ 35.288] drmOpenDevice: open result is 9, (OK) [ 35.288] drmOpenByBusid: Searching for BusID pci:0000:01:05.0 [ 35.288] drmOpenDevice: node name is /dev/dri/card0 [ 35.288] drmOpenDevice: open result is 9, (OK) [ 35.288] drmOpenByBusid: drmOpenMinor returns 9 [ 35.288] drmOpenByBusid: drmGetBusid reports pci:0000:01:05.0 [ 35.288] (II) Loading sub module "exa" [ 35.288] (II) LoadModule: "exa" [ 35.288] (II) Loading /usr/lib/xorg/modules/libexa.so [ 35.335] (II) Module exa: vendor="X.Org Foundation" [ 35.335] compiled for 1.10.4, module version = 2.5.0 [ 35.335] ABI class: X.Org Video Driver, version 10.0 [ 35.335] (II) RADEON(0): KMS Color Tiling: disabled [ 35.335] (II) RADEON(0): KMS Pageflipping: enabled [ 35.335] (II) RADEON(0): SwapBuffers wait for vsync: enabled [ 35.360] (II) RADEON(0): Output VGA-0 has no monitor section [ 35.360] (II) RADEON(0): Output LVDS has no monitor section [ 35.364] (II) RADEON(0): Output HDMI-0 has no monitor section [ 35.388] (II) RADEON(0): EDID for output VGA-0 [ 35.388] (II) RADEON(0): EDID for output LVDS [ 35.388] (II) RADEON(0): Manufacturer: LGD Model: 2ac Serial#: 0 [ 35.388] (II) RADEON(0): Year: 2010 Week: 0 [ 35.388] (II) RADEON(0): EDID Version: 1.3 [ 35.388] (II) RADEON(0): Digital Display Input [ 35.388] (II) RADEON(0): Max Image Size [cm]: horiz.: 34 vert.: 19 [ 35.388] (II) RADEON(0): Gamma: 2.20 [ 35.388] (II) RADEON(0): No DPMS capabilities specified [ 35.388] (II) RADEON(0): Supported color encodings: RGB 4:4:4 YCrCb 4:4:4 [ 35.388] (II) RADEON(0): First detailed timing is preferred mode [ 35.388] (II) RADEON(0): redX: 0.616 redY: 0.371 greenX: 0.355 greenY: 0.606 [ 35.388] (II) RADEON(0): blueX: 0.152 blueY: 0.100 whiteX: 0.313 whiteY: 0.329 [ 35.388] (II) RADEON(0): Manufacturer's mask: 0 [ 35.388] (II) RADEON(0): Supported detailed timing: [ 35.388] (II) RADEON(0): clock: 69.3 MHz Image Size: 344 x 194 mm [ 35.388] (II) RADEON(0): h_active: 1366 h_sync: 1398 h_sync_end 1430 h_blank_end 1486 h_border: 0 [ 35.388] (II) RADEON(0): v_active: 768 v_sync: 770 v_sync_end 774 v_blanking: 782 v_border: 0 [ 35.388] (II) RADEON(0): LG Display [ 35.388] (II) RADEON(0): LP156WH2-TLQB [ 35.388] (II) RADEON(0): EDID (in hex): [ 35.388] (II) RADEON(0): 00ffffffffffff0030e4ac0200000000 [ 35.388] (II) RADEON(0): 00140103802213780ac1259d5f5b9b27 [ 35.388] (II) RADEON(0): 19505400000001010101010101010101 [ 35.388] (II) RADEON(0): 010101010101121b567850000e302020 [ 35.388] (II) RADEON(0): 240058c2100000190000000000000000 [ 35.388] (II) RADEON(0): 00000000000000000000000000fe004c [ 35.388] (II) RADEON(0): 4720446973706c61790a2020000000fe [ 35.388] (II) RADEON(0): 004c503135365748322d544c514200c1 [ 35.388] (II) RADEON(0): Printing probed modes for output LVDS [ 35.388] (II) RADEON(0): Modeline "1366x768"x59.6 69.30 1366 1398 1430 1486 768 770 774 782 -hsync -vsync (46.6 kHz) [ 35.388] (II) RADEON(0): Modeline "1280x720"x59.9 74.50 1280 1344 1472 1664 720 723 728 748 -hsync +vsync (44.8 kHz) [ 35.388] (II) RADEON(0): Modeline "1152x768"x59.8 71.75 1152 1216 1328 1504 768 771 781 798 -hsync +vsync (47.7 kHz) [ 35.388] (II) RADEON(0): Modeline "1024x768"x59.9 63.50 1024 1072 1176 1328 768 771 775 798 -hsync +vsync (47.8 kHz) [ 35.388] (II) RADEON(0): Modeline "800x600"x59.9 38.25 800 832 912 1024 600 603 607 624 -hsync +vsync (37.4 kHz) [ 35.388] (II) RADEON(0): Modeline "848x480"x59.7 31.50 848 872 952 1056 480 483 493 500 -hsync +vsync (29.8 kHz) [ 35.388] (II) RADEON(0): Modeline "720x480"x59.7 26.75 720 744 808 896 480 483 493 500 -hsync +vsync (29.9 kHz) [ 35.388] (II) RADEON(0): Modeline "640x480"x59.4 23.75 640 664 720 800 480 483 487 500 -hsync +vsync (29.7 kHz) [ 35.392] (II) RADEON(0): EDID for output HDMI-0 [ 35.392] (II) RADEON(0): Output VGA-0 disconnected [ 35.392] (II) RADEON(0): Output LVDS connected [ 35.392] (II) RADEON(0): Output HDMI-0 disconnected [ 35.392] (II) RADEON(0): Using exact sizes for initial modes [ 35.392] (II) RADEON(0): Output LVDS using initial mode 1366x768 [ 35.392] (II) RADEON(0): Using default gamma of (1.0, 1.0, 1.0) unless otherwise stated. [ 35.392] (II) RADEON(0): mem size init: gart size :1fdff000 vram size: s:10000000 visible:fba0000 [ 35.392] (II) RADEON(0): EXA: Driver will allow EXA pixmaps in VRAM [ 35.392] (==) RADEON(0): DPI set to (96, 96) [ 35.392] (II) Loading sub module "fb" [ 35.392] (II) LoadModule: "fb" [ 35.392] (II) Loading /usr/lib/xorg/modules/libfb.so [ 35.492] (II) Module fb: vendor="X.Org Foundation" [ 35.492] compiled for 1.10.4, module version = 1.0.0 [ 35.492] ABI class: X.Org ANSI C Emulation, version 0.4 [ 35.492] (II) Loading sub module "ramdac" [ 35.492] (II) LoadModule: "ramdac" [ 35.492] (II) Module "ramdac" already built-in [ 35.492] (II) UnloadModule: "vesa" [ 35.492] (II) Unloading vesa [ 35.492] (II) UnloadModule: "fbdev" [ 35.492] (II) Unloading fbdev [ 35.492] (II) UnloadModule: "fbdevhw" [ 35.492] (II) Unloading fbdevhw [ 35.492] (--) Depth 24 pixmap format is 32 bpp [ 35.492] (II) RADEON(0): [DRI2] Setup complete [ 35.492] (II) RADEON(0): [DRI2] DRI driver: r600 [ 35.492] (II) RADEON(0): Front buffer size: 4224K [ 35.492] (II) RADEON(0): VRAM usage limit set to 228096K [ 35.615] (==) RADEON(0): Backing store disabled [ 35.615] (II) RADEON(0): Direct rendering enabled [ 35.658] (II) RADEON(0): Setting EXA maxPitchBytes [ 35.658] (II) EXA(0): Driver allocated offscreen pixmaps [ 35.658] (II) EXA(0): Driver registered support for the following operations: [ 35.658] (II) Solid [ 35.658] (II) Copy [ 35.658] (II) Composite (RENDER acceleration) [ 35.658] (II) UploadToScreen [ 35.658] (II) DownloadFromScreen [ 35.687] (II) RADEON(0): Acceleration enabled [ 35.687] (==) RADEON(0): DPMS enabled [ 35.687] (==) RADEON(0): Silken mouse enabled [ 35.721] (II) RADEON(0): Set up textured video [ 35.721] (II) RADEON(0): RandR 1.2 enabled, ignore the following RandR disabled message. [ 35.721] (--) RandR disabled [ 35.721] (II) Initializing built-in extension Generic Event Extension [ 35.721] (II) Initializing built-in extension SHAPE [ 35.721] (II) Initializing built-in extension MIT-SHM [ 35.721] (II) Initializing built-in extension XInputExtension [ 35.721] (II) Initializing built-in extension XTEST [ 35.721] (II) Initializing built-in extension BIG-REQUESTS [ 35.721] (II) Initializing built-in extension SYNC [ 35.721] (II) Initializing built-in extension XKEYBOARD [ 35.721] (II) Initializing built-in extension XC-MISC [ 35.721] (II) Initializing built-in extension SECURITY [ 35.721] (II) Initializing built-in extension XINERAMA [ 35.721] (II) Initializing built-in extension XFIXES [ 35.721] (II) Initializing built-in extension RENDER [ 35.721] (II) Initializing built-in extension RANDR [ 35.721] (II) Initializing built-in extension COMPOSITE [ 35.721] (II) Initializing built-in extension DAMAGE [ 35.721] (II) SELinux: Disabled on system [ 35.982] (II) AIGLX: enabled GLX_MESA_copy_sub_buffer [ 35.982] (II) AIGLX: enabled GLX_INTEL_swap_event [ 35.982] (II) AIGLX: enabled GLX_SGI_swap_control and GLX_MESA_swap_control [ 35.982] (II) AIGLX: enabled GLX_SGI_make_current_read [ 35.982] (II) AIGLX: GLX_EXT_texture_from_pixmap backed by buffer objects [ 35.982] (II) AIGLX: Loaded and initialized /usr/lib/dri/r600_dri.so [ 35.982] (II) GLX: Initialized DRI2 GL provider for screen 0 [ 35.999] (II) RADEON(0): Setting screen physical size to 361 x 203 [ 43.896] (II) RADEON(0): EDID vendor "LGD", prod id 684 [ 43.896] (II) RADEON(0): Printing DDC gathered Modelines: [ 43.896] (II) RADEON(0): Modeline "1366x768"x0.0 69.30 1366 1398 1430 1486 768 770 774 782 -hsync -vsync (46.6 kHz) [ 43.924] (II) RADEON(0): EDID vendor "LGD", prod id 684 [ 43.924] (II) RADEON(0): Printing DDC gathered Modelines: [ 43.924] (II) RADEON(0): Modeline "1366x768"x0.0 69.30 1366 1398 1430 1486 768 770 774 782 -hsync -vsync (46.6 kHz) [ 43.988] (II) RADEON(0): EDID vendor "LGD", prod id 684 [ 43.988] (II) RADEON(0): Printing DDC gathered Modelines: [ 43.988] (II) RADEON(0): Modeline "1366x768"x0.0 69.30 1366 1398 1430 1486 768 770 774 782 -hsync -vsync (46.6 kHz) [ 67.375] (II) config/udev: Adding input device Logitech USB Optical Mouse (/dev/input/event1) [ 67.376] (**) Logitech USB Optical Mouse: Applying InputClass "evdev pointer catchall" [ 67.376] (II) LoadModule: "evdev" [ 67.376] (II) Loading /usr/lib/xorg/modules/input/evdev_drv.so [ 67.392] (II) Module evdev: vendor="X.Org Foundation" [ 67.392] compiled for 1.10.3, module version = 2.6.0 [ 67.392] Module class: X.Org XInput Driver [ 67.392] ABI class: X.Org XInput driver, version 12.2 [ 67.392] (II) Using input driver 'evdev' for 'Logitech USB Optical Mouse' [ 67.392] (II) Loading /usr/lib/xorg/modules/input/evdev_drv.so [ 67.392] (**) Logitech USB Optical Mouse: always reports core events [ 67.392] (**) Logitech USB Optical Mouse: Device: "/dev/input/event1" [ 67.392] (--) Logitech USB Optical Mouse: Found 12 mouse buttons [ 67.392] (--) Logitech USB Optical Mouse: Found scroll wheel(s) [ 67.392] (--) Logitech USB Optical Mouse: Found relative axes [ 67.392] (--) Logitech USB Optical Mouse: Found x and y relative axes [ 67.392] (II) Logitech USB Optical Mouse: Configuring as mouse [ 67.392] (II) Logitech USB Optical Mouse: Adding scrollwheel support [ 67.392] (**) Logitech USB Optical Mouse: YAxisMapping: buttons 4 and 5 [ 67.392] (**) Logitech USB Optical Mouse: EmulateWheelButton: 4, EmulateWheelInertia: 10, EmulateWheelTimeout: 200 [ 67.392] (**) Option "config_info" "udev:/sys/devices/pci0000:00/0000:00:13.0/usb5/5-1/5-1:1.0/input/input14/event1" [ 67.392] (II) XINPUT: Adding extended input device "Logitech USB Optical Mouse" (type: MOUSE) [ 67.392] (II) Logitech USB Optical Mouse: initialized for relative axes. [ 67.392] (**) Logitech USB Optical Mouse: (accel) keeping acceleration scheme 1 [ 67.392] (**) Logitech USB Optical Mouse: (accel) acceleration profile 0 [ 67.392] (**) Logitech USB Optical Mouse: (accel) acceleration factor: 2.000 [ 67.392] (**) Logitech USB Optical Mouse: (accel) acceleration threshold: 4 [ 67.392] (II) config/udev: Adding input device Logitech USB Optical Mouse (/dev/input/mouse0) [ 67.392] (II) No input driver/identifier specified (ignoring) [ 78.692] (II) Logitech USB Optical Mouse: Close [ 78.692] (II) UnloadModule: "evdev" [ 78.692] (II) Unloading evdev

    Read the article

  • Web 2.0 Extension for ASP.NET

    - by Visual WebGui
    ASP.NET is now much extended to support line of business and data centric applications, providing Web 2.0 rich user interfaces within a native web environment. New capabilities allowed by the Visual WebGui extension turn Visual Studio into a rapid development tool for the web, leveraging the wide set of ASP.NET web infrastructures runtime and extending its paradigms to support highly interactive applications. Taking advantage of the ASP.NET infrastructures Using the native ASP.NET ISAPI filter: aspnet_isapi...(read more)

    Read the article

  • Moonlight extension not working with Firefox 7

    - by igi
    The web browser I use is Firefox (currently in version 7 in Oneiric). According the Compatibility Check information the Moonlight extension is not compatible with FF7. And, actually, I cannot watch Silverlight streams in an acceptable way:the video gets stuck, the HD keeps buffering (I guess), so I have to close the window. Does anybody know if there is a way to fix this or a suitable alternative?

    Read the article

  • Moonlight extension not working with Firefox 8

    - by igi
    The web browser I use is Firefox (currently in version 8 in Oneiric). According the Compatibility Check information the Moonlight extension is not compatible with FF8. And, actually, I cannot watch Silverlight streams in an acceptable way: the video gets stuck, the HD keeps buffering (I guess), so I have to close the window. Does anybody know if there is a way to fix this or a suitable alternative?

    Read the article

  • La documentation PHP maintenant disponible depuis Google Chrome, grâce à une nouvelle extension

    La documentation PHP est maintenant disponible depuis Google Chrome grâce à l'extension PHP documentation - PHP.net Vous pouvez l'installer ici : https://chrome.google.com/extensions...lgpiochncgdnhd [IMG]https://chrome.google.com/extensions/img/kfiahljocaflpaiopilgpiochncgdnhd/1260755606.08/screenshot/1001[/IMG] [IMG]https://chrome.google.com/extensions/img/kfiahljocaflpaiopilgpiochncgdnhd/1260755606.08/screenshot/1[/IMG]...

    Read the article

  • How do I access the popup page DOM from bg page in Chrome extension?

    - by Fletcher Moore
    In Google Chrome's extension developer section, it says The HTML pages inside an extension have complete access to each other's DOMs, and they can invoke functions on each other. ... The popup's contents are a web page defined by an HTML file (popup.html). The popup doesn't need to duplicate code that's in the background page (background.html) because the popup can invoke functions on the background page I've loaded and tested jQuery, and can access DOM elements in background.html with jQuery, but I cannot figure out how to get access to DOM elements in popup.html from background.html.

    Read the article

  • Why is it impossible to declare extension methods in a generic static class?

    - by Hun1Ahpu
    I'd like to create a lot of extension methods for some generic class, e.g. for public class SimpleLinkedList<T> where T:IComparable And I've started creating methods like this: public static class LinkedListExtensions { public static T[] ToArray<T>(this SimpleLinkedList<T> simpleLinkedList) where T:IComparable { //// code } } But when I tried to make LinkedListExtensions class generic like this: public static class LinkedListExtensions<T> where T:IComparable { public static T[] ToArray(this SimpleLinkedList<T> simpleLinkedList) { ////code } } I get "Extension methods can only be declared in non-generic, non-nested static class". And I'm trying to guess where this restriction came from and have no ideas.

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • Copy mdf file and use it in run time

    - by Anibas
    After I copy mdf file (and his log file) I tries to Insert data. I receive the following message: "An attempt to attach an auto-named database for file [fileName].mdf failed. A database with the same name exists, or specified file cannot be opened, or it is located on UNC share. When I copied the file manual everything worked normally. Is it correct the order File.Copy leaves the file engaged?

    Read the article

  • Designing a database file format

    - by RoliSoft
    I would like to design my own database engine for educational purposes, for the time being. Designing a binary file format is not hard nor the question, I've done it in the past, but while designing a database file format, I have come across a very important question: How to handle the deletion of an item? So far, I've thought of the following two options: Each item will have a "deleted" bit which is set to 1 upon deletion. Pro: relatively fast. Con: potentially sensitive data will remain in the file. 0x00 out the whole item upon deletion. Pro: potentially sensitive data will be removed from the file. Con: relatively slow. Recreating the whole database. Pro: no empty blocks which makes the follow-up question void. Con: it's a really good idea to overwrite the whole 4 GB database file because a user corrected a typo. I will sell this method to Twitter ASAP! Now let's say you already have a few empty blocks in your database (deleted items). The follow-up question is how to handle the insertion of a new item? Append the item to the end of the file. Pro: fastest possible. Con: file will get huge because of all the empty blocks that remain because deleted items aren't actually deleted. Search for an empty block exactly the size of the one you're inserting. Pro: may get rid of some blocks. Con: you may end up scanning the whole file at each insert only to find out it's very unlikely to come across a perfectly fitting empty block. Find the first empty block which is equal or larger than the item you're inserting. Pro: you probably won't end up scanning the whole file, as you will find an empty block somewhere mid-way; this will keep the file size relatively low. Con: there will still be lots of leftover 0x00 bytes at the end of items which were inserted into bigger empty blocks than they are. Rigth now, I think the first deletion method and the last insertion method are probably the "best" mix, but they would still have their own small issues. Alternatively, the first insertion method and scheduled full database recreation. (Probably not a good idea when working with really large databases. Also, each small update in that method will clone the whole item to the end of the file, thus accelerating file growth at a potentially insane rate.) Unless there is a way of deleting/inserting blocks from/to the middle of the file in a file-system approved way, what's the best way to do this? More importantly, how do databases currently used in production usually handle this?

    Read the article

  • Why is my Extension Method not showing up in my test class?

    - by Robert Harvey
    I created an extension method called HasContentPermission on the System.Security.Principal.IIdentity interface: namespace System.Security.Principal { public static bool HasContentPermission (this IIdentity itentity, int contentID) { // I do stuff here return result; } } And I call it like this: bool hasPermission = User.Identity.HasPermission(contentID); Works like a charm. Now I want to unit test it. To do that, all I really need to do is call the extension method directly, so: using System.Security.Principal; namespace MyUnitTests { [TestMethod] public void HasContentPermission_PermissionRecordExists_ReturnsTrue() { IIdentity identity; bool result = identity.HasContentPermission(... But HasContentPermission won't intellisense. I tried creating a stub class that inherits from IIdentity, but that didn't work either. Why? Or am I going about this the wrong way?

    Read the article

  • How to remove the file extension in a zsh completion?

    - by meeselet
    I want to adjust zsh so that I can tab complete: myprog <tab> using all *.foo files in ~/somedir, but have it so that it displays them without the .foo extension. Is there any way to do this? This is what I have so far: #compdef myprog typeset -A opt_args local context state line local -a mydirs mydirs="(. ~/somedir)" _arguments -s -S \ "*:name:->foos" \ && return 0 case $state in (foos) _files -W ${mydirs} -g '*.foo(:r)' && return 0 ;; esac return 1 However, this displays double the output for every file (that is, each .foo file is listed with and without its extension). Is there any way around this?

    Read the article

  • opening and viewing a file in php

    - by Christian Burgos
    how do i open/view for editing an uploaded file in php? i have tried this but it doesn't open the file. $my_file = 'file.txt'; $handle = fopen($my_file, 'r'); $data = fread($handle,filesize($my_file)); i've also tried this but it wont work. $my_file = 'file.txt'; $handle = fopen($my_file, 'w') or die('Cannot open file: '.$my_file); $data = 'This is the data'; fwrite($handle, $data); what i have in mind is like when you want to view an uploaded resume,documents or any other ms office files like .docx,.xls,.pptx and be able to edit them, save and close the said file. edit: latest tried code... <?php // Connects to your Database include "configdb.php"; //Retrieves data from MySQL $data = mysql_query("SELECT * FROM employees") or die(mysql_error()); //Puts it into an array while($info = mysql_fetch_array( $data )) { //Outputs the image and other data //Echo "<img src=localhost/uploadfile/images".$info['photo'] ."> <br>"; Echo "<b>Name:</b> ".$info['name'] . "<br> "; Echo "<b>Email:</b> ".$info['email'] . " <br>"; Echo "<b>Phone:</b> ".$info['phone'] . " <hr>"; //$file=fopen("uploadfile/images/".$info['photo'],"r+"); $file=fopen("Applications/XAMPP/xamppfiles/htdocs/uploadfile/images/file.odt","r") or exit("unable to open file");; } ?> i am getting the error: Warning: fopen(Applications/XAMPP/xamppfiles/htdocs/uploadfile/images/file.odt): failed to open stream: No such file or directory in /Applications/XAMPP/xamppfiles/htdocs/uploadfile/view.php on line 17 unable to open file the file is in that folder, i don't know it wont find it.

    Read the article

  • Is there a Chrome extension to add mailto links to email addresses?

    - by Martin Burch
    Wait, wait, this is a programming question! I want to build an extension if none exists. Imagine this: you come across a webpage that says "Just send a message to [email protected]" but to actually send the email, you need to highlight the address and then cut and paste it into the recipient field of a new compose window of your email client of choice. Obviously life would be easier if it were simply a mailto: link, so you could click on it and have a new message created automatically. (Or if the page designer had used a form, perhaps ...) I was originally going to ask if there was an extension to enable similar functionality for unlinked twitter @username mentions but I thought this email address problem would be a simpler situation. If you think it would be useless, perhaps I should look at the twitter username problem instead. Thanks for your feedback.

    Read the article

  • How can I use SVN to manage my Firefox Extension project?

    - by 4AM
    I'm using SVN to manage my Firefox extension project, and this project contains an XPCOM component. Firefox is loading directly from my working directory by placing a text file with the working directory's path in the ./extensions directory of my user profile. When Firefox starts, my extension fails to load & overlay; examining the Error Console, I see that the error states that ".svn cannot be loaded as a component" - a reference to the .svn directory inside my "components" directory of the plug-in structure. Is there any way to get Firefox to ignore this directory, or get SVN to generate a working copy without the .svn directories in it?

    Read the article

  • Reading data from text file in C

    - by themake
    I have a text file which contains words separated by space. I want to take each word from the file and store it. So i have opened the file but am unsure how to assign the word to a char. FILE *fp; fp = fopen("file.txt", "r"); //then i want char one = the first word in the file char two = the second word in the file

    Read the article

< Previous Page | 23 24 25 26 27 28 29 30 31 32 33 34  | Next Page >