Search Results

Search found 101628 results on 4066 pages for 'file system'.

Page 27/4066 | < Previous Page | 23 24 25 26 27 28 29 30 31 32 33 34  | Next Page >

  • File mkdirs() method not working in android/java

    - by Leif Andersen
    I've been pulling out my hair on this for a while now. The following method is supposed to download a file, and save it to the location specified on the hard drive. private static void saveImage(Context context, boolean backgroundUpdate, URL url, File file) { if (!Tools.checkNetworkState(context, backgroundUpdate)) return; // Get the image try { // Make the file file.getParentFile().mkdirs(); // Set up the connection URLConnection uCon = url.openConnection(); InputStream is = uCon.getInputStream(); BufferedInputStream bis = new BufferedInputStream(is); // Download the data ByteArrayBuffer baf = new ByteArrayBuffer(50); int current = 0; while ((current = bis.read()) != -1) { baf.append((byte) current); } // Write the bits to the file OutputStream os = new FileOutputStream(file); os.write(baf.toByteArray()); os.close(); } catch (Exception e) { // Any exception is probably a newtork faiilure, bail return; } } Also, if the file doesn't exist, it is supposed to make the directory for the file. (And if there is another file already in that spot, it should just not do anything). However, for some reason, the mkdirs() method never makes the directory. I've tried everything from explicit parentheses, to explicitly making the parent file class, and nothing seems to work. I'm fairly certain that the drive is writable, as it's only called after that has already been determined, also that is true after running through it while debugging. So the method fails because the parent directories aren't made. Can anyone tell me if there is anything wrong with the way I'm calling it? Also, if it helps, here is the source for the file I'm calling it in: https://github.com/LeifAndersen/NetCatch/blob/master/src/net/leifandersen/mobile/android/netcatch/services/RSSService.java Thank you

    Read the article

  • DOS application to allow remote management of files over serial link

    - by tomlogic
    Harken back to the days of DOS. I have an embedded DOS handheld device, and I'm looking for a tool to manage the files stored on it. I picture an application I can launch on the device that opens COM1 up for commands to get a directory listing, send/receive files via x/y/zmodem, move/delete files, and create/move/delete directories. A Windows application can then download a recursive file listing and then manage those files (for example, synchronizing with a local directory). Keep in mind that this is DOS -- 8.3 filenames, 640K of RAM and a 19200bps serial link (yuk!). I'd prefer something with source in case we need to add additional features (for example, the ability to get a checksum of a file for change detection). Now that I've written this description, I realize I'm asking for something like LapLink or pcAnywhere. Norton no longer sells DOS versions of pcAnywhere and LapLink V for DOS seems pricy at $50. Are you aware of any similar apps from those good old days?

    Read the article

  • Reliable file copy (move) process - mostly Unix/Linux

    - by mfinni
    Short story : We have a need for a rock-solid reliable file mover process. We have source directories that are often being written to that we need to move files from. The files come in pairs - a big binary, and a small XML index. We get a CTL file that defines these file bundles. There is a process that operates on the files once they are in the destination directory; that gets rid of them when it's done. Would rsync do the best job, or do we need to get more complex? Long story as follows : We have multiple sources to pull from : one set of directories are on a Windows machine (that does have Cygwin and an SSH daemon), and a whole pile of directories are on a set of SFTP servers (Most of these are also Windows.) Our destinations are a list of directories on AIX servers. We used to use a very reliable Perl script on the Windows/Cygwin machine when it was our only source. However, we're working on getting rid of that machine, and there are other sources now, the SFTP servers, that we cannot presently run our own scripts on. For security reasons, we can't run the copy jobs on our AIX servers - they have no access to the source servers. We currently have a homegrown Java program on a Linux machine that uses SFTP to pull from the various new SFTP source directories, copies to a local tmp directory, verifies that everything is present, then copies that to the AIX machines, and then deletes the files from the source. However, we're finding any number of bugs or poorly-handled error checking. None of us are Java experts, so fixing/improving this may be difficult. Concerns for us are: With a remote source (SFTP), will rsync leave alone any file still being written? Some of these files are large. From reading the docs, it seems like rysnc will be very good about not removing the source until the destination is reliably written. Does anyone have experience confirming or disproving this? Additional info We will be concerned about the ingestion process that operates on the files once they are in the destination directory. We don't want it operating on files while we are in the process of copying them; it waits until the small XML index file is present. Our current copy job are supposed to copy the XML file last. Sometimes the network has problems, sometimes the SFTP source servers crap out on us. Sometimes we typo the config files and a destination directory doesn't exist. We never want to lose a file due to this sort of error. We need good logs If you were presented with this, would you just script up some rsync? Or would you build or buy a tool, and if so, what would it be (or what technologies would it use?) I (and others on my team) are decent with Perl.

    Read the article

  • Minimize Windows Live Mail to the System Tray in Windows 7

    - by Asian Angel
    Are you frustrated that you can not minimize Windows Live Mail to the system tray in Windows 7? With just a few tweaks you can make Live Mail minimize to the system tray just like in earlier versions of Windows. Windows Live Mail in Windows Vista In Windows Vista you could minimize Windows Live Mail to the system tray if desired using the context menu… Windows Live Mail in Windows 7 In Windows 7 you can minimize the app window but not hide it in the system tray. The Hide window when minimized menu entry is missing from the context menu and all you have is the window icon taking up space in your taskbar. How to Add the Context Menu Entry Back Right click on the program shortcut(s) and select properties. When the properties window opens click on the compatibility tab and enable the Run this program in compatibility mode for setting. Choose Windows Vista (Service Pack 2) from the drop-down menu and click OK. Once you have restarted Windows Live Mail you will have access to the Hide window when minimized menu entry again. And just like that your taskbar is clear again when Windows Live Mail is minimized. If you have wanted the ability to minimize Windows Live Mail to the system tray in Windows 7 then this little tweak will fix the problem. Similar Articles Productive Geek Tips Make Windows Live Messenger Minimize to the System Tray in Windows 7Move Live Messenger Icon to the System Tray in Windows 7Backup Windows Mail Messages and Contacts in VistaTurn off New Mail Notification for PocoMail Junk Mail FolderPut Your PuTTY in the System Tray TouchFreeze Alternative in AutoHotkey The Icy Undertow Desktop Windows Home Server – Backup to LAN The Clear & Clean Desktop Use This Bookmarklet to Easily Get Albums Use AutoHotkey to Assign a Hotkey to a Specific Window Latest Software Reviews Tinyhacker Random Tips HippoRemote Pro 2.2 Xobni Plus for Outlook All My Movies 5.9 CloudBerry Online Backup 1.5 for Windows Home Server Know if Someone Accessed Your Facebook Account Shop for Music with Windows Media Player 12 Access Free Documentaries at BBC Documentaries Rent Cameras In Bulk At CameraRenter Download Songs From MySpace Steve Jobs’ iPhone 4 Keynote Video

    Read the article

  • Buffer System For Items

    - by Ohmages
    I am going to reference this image of what I want to accomplish in JavaScript. This is the Diablo buffer system. This question may be a bit advanced (or possibly not even allowed). But I was wondering how you might go about implementing this type of system in a JavaScript game. Currently to implement such a system in JavaScript escapes me, and I am turning to SO to get some suggestions, ideas, and hopefully some insight in how I could accomplish this without being to costly on the CPU. Some thoughts of mine for implementing such a system would be to: Create DIVS within a DIV that hold each position of the inventory Go through each item you own in a container and see which DIV it belongs to Make said item images the DIVs image This type of system might possibly work if ALL items were 1x1, but for this example its not going to work out. I am at a complete lost of ideas how to even accomplish this. Although, maybe rendering directly to the canvas and checking mouse cords could work, there would more than likely be A HUGE annoyance when checking if other items are overlapping each other (meaning you cant place the item down, and possibly switching item with the cursor item ). That said, what am I left with? Do I need to makeshift my own hack system with messy code, or is there some source out there (that I don't know about) that has replicated this type of system in their own game. I would be very grateful to get some replies on how you might go about doing this, and will accept answers that can logically explain how you might implement such a system (code is not required). P.S. Id like to use pure JavaScript, and nothing else (even though it might be "reinventing the wheel", I also like to learn).

    Read the article

  • Developing an Interface to a Dynamic System

    - by radix07
    I work for a small company and have been designing a GUI to interface our embedded system. The problem with this embedded system is that it is not a finished product (may never be) and is constantly under development and being tweaked and updated for different customers and applications in small volumes. So to deal with this I made a program that can export all the data from a spreadsheet where most of the embedded system variables are sourced from and throw them into a small database for the GUI application to use. This database program I made also spits out a cross reference file for the embedded system which allows the GUI to look up all the variables. This system works pretty well so far, and is even integrated with version control among the GUI, database, and embedded system. The big problem is that there is constant development on several projects that use this system and it gets terribly tedious to keep the system up to date and bring in new changes. This has gotten to the point to where I have had to code the GUI to dynamically (generically) generate all interfaces since I am never guaranteed to find the same data the same way. I have not been able to come up with a good way to uniquely identify the data I import from excel since all fields are able to be changed (due to engineering stubbornness, code re-factoring and/or excel issues) and I cannot assign a fixed reference within the sheet itself. So, are there any good methods or ideas on how to handle the chaos?

    Read the article

  • How do I find out which version and derivate of Ubuntu is right for my hardware in terms of minmal system requirements?

    - by con-f-use
    For a given hardware configuration, how do I find out if Ubuntu will run on it? What considerations should I take into account when choosing an Ubuntu version and flavour such as: Xubuntu with a lighter desktop than the usual Gnome and Unity Lubuntu with the even lighter LXDE desktop Obviously Ubuntu does not run on some processor architectures. So how do I go about choosing the right version and derivate. How can I find out the minmal system requirements?

    Read the article

  • How to find out console equivalents of Ubuntu System Settings GUI?

    - by user4514
    How do I in general find out, what the very nice "System Settings GUI" in Ubuntu (say 12.04) does and how to replicate the changes in command line? Many people ask questions like "how to change the keyboard rate using command line", and often the answers do not help and are hard to find. What is the easiest way to find out, what the GUI is actually changing (for various types of settings. I.e. keyboard layout, rate, mouse, network, ...)

    Read the article

  • How do I find out which version and derivative of Ubuntu is right for my hardware in terms of minimal system requirements?

    - by con-f-use
    For a given hardware configuration, how do I find out if Ubuntu will run on it? What considerations should I take into account when choosing an Ubuntu version and flavour such as: Xubuntu with a lighter desktop than the usual Gnome and Unity Lubuntu with the even lighter LXDE desktop Obviously Ubuntu does not run on some processor architectures. So how do I go about choosing the right version and derivate. How can I find out the minmal system requirements?

    Read the article

  • MVC HTML.RenderAction – Error: Duration must be a positive number

    - by BarDev
    On my website I want the user to have the ability to login/logout from any page. When the user select login button a modal dialog will be present to the user for him to enter in his credentials. Since login will be on every page, I thought I would create a partial view for the login and add it to the layout page. But when I did this I got the following error: Exception Details: System.InvalidOperationException: Duration must be a positive number. There are other ways to work around this that would not using partial views, but I believe this should work. So to test this, I decided to make everything simple with the following code: Created a layout page with the following code @{Html.RenderAction("_Login", "Account");} In the AccountController: public ActionResult _Login() { return PartialView("_Login"); } Partial View _Login <a id="signin">Login</a> But when I run this simple version this I still get this error: Exception Details: System.InvalidOperationException: Duration must be a positive number. Source of error points to "@{Html.RenderAction("_Login", "Account");}" There are some conversations on the web that are similar to my problem, which identifies this as bug with MVC (see links below). But the links pertain to Caching, and I'm not doing any caching. OuputCache Cache Profile does not work for child actions http://aspnet.codeplex.com/workitem/7923 Asp.Net MVC 3 Partial Page Output Caching Not Honoring Config Settings Asp.Net MVC 3 Partial Page Output Caching Not Honoring Config Settings Caching ChildActions using cache profiles won't work? Caching ChildActions using cache profiles won't work? I'm not sure if this makes a difference, but I'll go ahead and add it here. I'm using MVC 3 with Razor. Update Stack Trace [InvalidOperationException: Duration must be a positive number.] System.Web.Mvc.OutputCacheAttribute.ValidateChildActionConfiguration() +624394 System.Web.Mvc.OutputCacheAttribute.OnActionExecuting(ActionExecutingContext filterContext) +127 System.Web.Mvc.ControllerActionInvoker.InvokeActionMethodFilter(IActionFilter filter, ActionExecutingContext preContext, Func1 continuation) +72 System.Web.Mvc.ControllerActionInvoker.InvokeActionMethodFilter(IActionFilter filter, ActionExecutingContext preContext, Func1 continuation) +784922 System.Web.Mvc.ControllerActionInvoker.InvokeActionMethodWithFilters(ControllerContext controllerContext, IList1 filters, ActionDescriptor actionDescriptor, IDictionary2 parameters) +314 System.Web.Mvc.ControllerActionInvoker.InvokeAction(ControllerContext controllerContext, String actionName) +784976 System.Web.Mvc.Controller.ExecuteCore() +159 System.Web.Mvc.ControllerBase.Execute(RequestContext requestContext) +335 System.Web.Mvc.<c_DisplayClassb.b_5() +62 System.Web.Mvc.Async.<c_DisplayClass1.b_0() +20 System.Web.Mvc.<c_DisplayClasse.b_d() +54 System.Web.Mvc.<c_DisplayClass4.b_3() +15 System.Web.Mvc.ServerExecuteHttpHandlerWrapper.Wrap(Func`1 func) +41 System.Web.HttpServerUtility.ExecuteInternal(IHttpHandler handler, TextWriter writer, Boolean preserveForm, Boolean setPreviousPage, VirtualPath path, VirtualPath filePath, String physPath, Exception error, String queryStringOverride) +1363 [HttpException (0x80004005): Error executing child request for handler 'System.Web.Mvc.HttpHandlerUtil+ServerExecuteHttpHandlerAsyncWrapper'.] System.Web.HttpServerUtility.ExecuteInternal(IHttpHandler handler, TextWriter writer, Boolean preserveForm, Boolean setPreviousPage, VirtualPath path, VirtualPath filePath, String physPath, Exception error, String queryStringOverride) +2419 System.Web.HttpServerUtility.Execute(IHttpHandler handler, TextWriter writer, Boolean preserveForm, Boolean setPreviousPage) +275 System.Web.HttpServerUtilityWrapper.Execute(IHttpHandler handler, TextWriter writer, Boolean preserveForm) +94 System.Web.Mvc.Html.ChildActionExtensions.ActionHelper(HtmlHelper htmlHelper, String actionName, String controllerName, RouteValueDictionary routeValues, TextWriter textWriter) +838 System.Web.Mvc.Html.ChildActionExtensions.RenderAction(HtmlHelper htmlHelper, String actionName, String controllerName, RouteValueDictionary routeValues) +56 ASP._Page_Views_Shared_SiteLayout_cshtml.Execute() in c:\Projects\Odat Projects\Odat\Source\Presentation\Odat.PublicWebSite\Views\Shared\SiteLayout.cshtml:80 System.Web.WebPages.WebPageBase.ExecutePageHierarchy() +280 System.Web.Mvc.WebViewPage.ExecutePageHierarchy() +104 System.Web.WebPages.WebPageBase.ExecutePageHierarchy(WebPageContext pageContext, TextWriter writer, WebPageRenderingBase startPage) +173 System.Web.WebPages.WebPageBase.Write(HelperResult result) +89 System.Web.WebPages.WebPageBase.RenderSurrounding(String partialViewName, Action1 body) +234 System.Web.WebPages.WebPageBase.PopContext() +234 System.Web.Mvc.ViewResultBase.ExecuteResult(ControllerContext context) +384 System.Web.Mvc.<>c__DisplayClass1c.<InvokeActionResultWithFilters>b__19() +33 System.Web.Mvc.ControllerActionInvoker.InvokeActionResultFilter(IResultFilter filter, ResultExecutingContext preContext, Func1 continuation) +784900 System.Web.Mvc.ControllerActionInvoker.InvokeActionResultFilter(IResultFilter filter, ResultExecutingContext preContext, Func1 continuation) +784900 System.Web.Mvc.ControllerActionInvoker.InvokeActionResultWithFilters(ControllerContext controllerContext, IList1 filters, ActionResult actionResult) +265 System.Web.Mvc.ControllerActionInvoker.InvokeAction(ControllerContext controllerContext, String actionName) +784976 System.Web.Mvc.Controller.ExecuteCore() +159 System.Web.Mvc.ControllerBase.Execute(RequestContext requestContext) +335 System.Web.Mvc.<c_DisplayClassb.b_5() +62 System.Web.Mvc.Async.<c_DisplayClass1.b_0() +20 System.Web.Mvc.<c_DisplayClasse.b_d() +54 System.Web.CallHandlerExecutionStep.System.Web.HttpApplication.IExecutionStep.Execute() +453 System.Web.HttpApplication.ExecuteStep(IExecutionStep step, Boolean& completedSynchronously) +371 Update When I Break in Code, it errors at @{Html.RenderAction("_Login", "Account");} with the following exception. The inner exception Error executing child request for handler 'System.Web.Mvc.HttpHandlerUtil+ServerExecuteHttpHandlerAsyncWrapper'. at System.Web.HttpServerUtility.ExecuteInternal(IHttpHandler handler, TextWriter writer, Boolean preserveForm, Boolean setPreviousPage, VirtualPath path, VirtualPath filePath, String physPath, Exception error, String queryStringOverride) at System.Web.HttpServerUtility.Execute(IHttpHandler handler, TextWriter writer, Boolean preserveForm, Boolean setPreviousPage) at System.Web.HttpServerUtilityWrapper.Execute(IHttpHandler handler, TextWriter writer, Boolean preserveForm) at System.Web.Mvc.Html.ChildActionExtensions.ActionHelper(HtmlHelper htmlHelper, String actionName, String controllerName, RouteValueDictionary routeValues, TextWriter textWriter) at System.Web.Mvc.Html.ChildActionExtensions.RenderAction(HtmlHelper htmlHelper, String actionName, String controllerName, RouteValueDictionary routeValues) at ASP._Page_Views_Shared_SiteLayout_cshtml.Execute() in c:\Projects\Odat Projects\Odat\Source\Presentation\Odat.PublicWebSite\Views\Shared\SiteLayout.cshtml:line 80 at System.Web.WebPages.WebPageBase.ExecutePageHierarchy() at System.Web.Mvc.WebViewPage.ExecutePageHierarchy() at System.Web.WebPages.WebPageBase.ExecutePageHierarchy(WebPageContext pageContext, TextWriter writer, WebPageRenderingBase startPage) at System.Web.WebPages.WebPageBase.Write(HelperResult result) at System.Web.WebPages.WebPageBase.RenderSurrounding(String partialViewName, Action1 body) at System.Web.WebPages.WebPageBase.PopContext() at System.Web.Mvc.ViewResultBase.ExecuteResult(ControllerContext context) at System.Web.Mvc.ControllerActionInvoker.<>c__DisplayClass1c.<InvokeActionResultWithFilters>b__19() at System.Web.Mvc.ControllerActionInvoker.InvokeActionResultFilter(IResultFilter filter, ResultExecutingContext preContext, Func1 continuation) Answer Thanks Darin Dimitrov Come to find out, my AccountController had the following attribute [System.Web.Mvc.OutputCache(NoStore =true, Duration = 0, VaryByParam = "*")]. I don't believe this should caused a problem, but when I removed the attribute everything worked. BarDev

    Read the article

  • System.UriFormatException: Invalid URI: The hostname could not be parsed.

    - by Shane
    All of a sudden I'm getting the following error on my website. It doesnt access a db. just a simple website using .net 2.0. I did recently apply the available windows server 2003 service packs. Could that have changed things? I should add the error randomly comes and goes and has been doing so for today and yesterday. I leave it for 5 minutes and the error is gone. Server Error in '/' Application. Invalid URI: The hostname could not be parsed. Description: An unhandled exception occurred during the execution of the current web request. Please review the stack trace for more information about the error and where it originated in the code. Exception Details: System.UriFormatException: Invalid URI: The hostname could not be parsed. Source Error: An unhandled exception was generated during the execution of the current web request. Information regarding the origin and location of the exception can be identified using the exception stack trace below. Stack Trace: [UriFormatException: Invalid URI: The hostname could not be parsed.] System.Uri.CreateThis(String uri, Boolean dontEscape, UriKind uriKind) +5367536 System.Uri.CreateUri(Uri baseUri, String relativeUri, Boolean dontEscape) +31 System.Uri..ctor(Uri baseUri, String relativeUri) +34 System.Net.HttpWebRequest.CheckResubmit(Exception& e) +5300867 [WebException: Cannot handle redirect from HTTP/HTTPS protocols to other dissimilar ones.] System.Net.HttpWebRequest.GetResponse() +5314029 System.Xml.XmlDownloadManager.GetNonFileStream(Uri uri, ICredentials credentials) +69 System.Xml.XmlDownloadManager.GetStream(Uri uri, ICredentials credentials) +3929371 System.Xml.XmlUrlResolver.GetEntity(Uri absoluteUri, String role, Type ofObjectToReturn) +54 System.Xml.XmlTextReaderImpl.OpenUrlDelegate(Object xmlResolver) +74 System.Threading.CompressedStack.runTryCode(Object userData) +70 System.Runtime.CompilerServices.RuntimeHelpers.ExecuteCodeWithGuaranteedCleanup(TryCode code, CleanupCode backoutCode, Object userData) +0 System.Threading.CompressedStack.Run(CompressedStack compressedStack, ContextCallback callback, Object state) +108 System.Xml.XmlTextReaderImpl.OpenUrl() +186 System.Xml.XmlTextReaderImpl.Read() +208 System.Xml.XmlLoader.Load(XmlDocument doc, XmlReader reader, Boolean preserveWhitespace) +112 System.Xml.XmlDocument.Load(XmlReader reader) +108 System.Web.UI.WebControls.XmlDataSource.PopulateXmlDocument(XmlDocument document, CacheDependency& dataCacheDependency, CacheDependency& transformCacheDependency) +303 System.Web.UI.WebControls.XmlDataSource.GetXmlDocument() +153 System.Web.UI.WebControls.XmlDataSourceView.ExecuteSelect(DataSourceSelectArguments arguments) +29 System.Web.UI.WebControls.BaseDataList.GetData() +39 System.Web.UI.WebControls.DataList.CreateControlHierarchy(Boolean useDataSource) +264 System.Web.UI.WebControls.BaseDataList.OnDataBinding(EventArgs e) +55 System.Web.UI.WebControls.BaseDataList.DataBind() +75 System.Web.UI.WebControls.BaseDataList.EnsureDataBound() +55 System.Web.UI.WebControls.BaseDataList.CreateChildControls() +65 System.Web.UI.Control.EnsureChildControls() +97 System.Web.UI.Control.PreRenderRecursiveInternal() +53 System.Web.UI.Control.PreRenderRecursiveInternal() +202 System.Web.UI.Control.PreRenderRecursiveInternal() +202 System.Web.UI.Control.PreRenderRecursiveInternal() +202 System.Web.UI.Control.PreRenderRecursiveInternal() +202 System.Web.UI.Page.ProcessRequestMain(Boolean includeStagesBeforeAsyncPoint, Boolean includeStagesAfterAsyncPoint) +4588

    Read the article

  • Windows System Tray icons - controlling position

    - by Jamo
    I have a few old apps I've written (in Delphi) which for various reasons use a system tray icon. Most are using AppControls TacTrayIcon or some other similar component. Here's my question: How does one control the position of a tray icon? (i.e. where it is, say, relative to the system time -- 1st position/"slot", 2nd position/"slot", etc). I recall seeing a demo (C#, if memory serves) that allowed the user to "shift icon to the left" and "shift icon to the right", but don't recall how it was done. I'd like to allow the user to select what position they want to icon to appear in, for Windows 2000 - Windows 7. (I understand Windows 7 handles system tray stuff a little differently, but haven't tested that out yet). Thanks for any and all help.

    Read the article

  • Add Trace methods to System.Diagnostics.TraceListner

    - by user200295
    I wrote a Log class derived from System.Diagnostics.TraceListener like so public class Log : TraceListener This acts as a wrapper to Log4Net and allows people to use System.Diagnostics Tracing like so Trace.Listeners.Clear(); Trace.Listeners.Add(new Log("MyProgram")); Trace.TraceInformation("Program Starting"); There is a request to add additional tracing levels then the default Trace ones (Error,Warning,Information) I want to have this added to the System.Diagnostics.Trace so it can be used like Trace.TraceVerbose("blah blah"); Trace.TraceAlert("Alert!"); Is there any way I can do this with an extension class? I tried public static class TraceListenerExtensions { public static void TraceVerbose(this Trace trace) {} } but nothing is being exposed on the trace instance being passed in :(

    Read the article

  • how to create thumbnail system for MP4 files

    - by Pete Herbert Penito
    Hi everyone! I know I know, why am I using MP4 still?? It's because I have like 100 files already in this format and I need to upload to a website, I have the mp4 file embeded in the site already and the file played changes according to php. but what I really need is a way to dynamically create a thumbnail or take a snapshot of the video file to display on the page. I've read a couple things online but they all require the file type to be in FLV, what would be the best way to accomplish this? Thank you Guys!

    Read the article

  • Interacting with system commands using a web dev language

    - by Jamie
    Hi all, First of all, sorry for the vague title. Let me explain. At work we're currently using SunGrid I've been assigned a project to create a web interface wrapper for interacting with the engine. i.e. displaying users jobs, submitting jobs via a nice GUI etc. (most of the sgrid commands output xml which is nice) My question for you chaps is the following: What web dev language would you use to interact with the system? i.e. use the language to do a system call and evaluate the response. I'm not after an argument on which language is best, I just would like to know which language is specifically good for interacting with the system and is also good for web dev.

    Read the article

  • Operating system for visualization app in 6 monitors

    - by Federico
    Hi. I have to plan the development for an application with these major requirements: Show different graphical data and animations in 6 monitors, in fullscreen mode. The hardware to be used is a PC with 3 NVIDIA GeForce 9800 GX2 cards. I have some expertise working with OpenGL, but never with more than one monitor. I have the (some limited) freedom to choose an operating system for the application. My options are: Windows XP, Windows Vista, Windows 7, Ubuntu 8.04/10.04. I would like to know, if you have some expertise or knowledge in the multi-monitor application development field, what is the recommended operating system for this kind of application? And, do I need any software other than the operating system and the NVIDIA drivers to be able to use the 6 monitors in fullscreen, showing different things in each one of them? Any comment/answer will be really appreciated. Thanks in advance! Federico

    Read the article

  • Quickly create large file on a windows system?

    - by Leigh Riffel
    In the same vein as http://stackoverflow.com/questions/257844/quickly-create-a-large-file-on-a-linux-system I'd like to quickly create a large file on a windows system. By large I'm thinking 5GB. The content doesn't matter. A built in command or short batch file would be preferable, but I'll accept an application if there are no other easy ways.

    Read the article

  • How to fetch output when calling R using Qprocess or system

    - by SYK
    Hi Experts, I would like to execute a R script simply as R --file=x.R It runs well on the command line. However when I try the system call in C++ by QProcess::execute("R --file=x.R"); or system("R --file=x.R"); the program R runs and quits but I can't see the output the program is supposed to generate. If a program uses no stdout (such as R), how do I fetch the output after a system call either as a output file or in the program's own console? Thanks for your time.

    Read the article

  • System.Drawing.Image for Images in Business Objects?

    - by Mudu
    Hi Folks I'd like to store an image in a business object. In MSDN I saw that the System.Drawing-namespace provides lots of GDI+-features, etc. Is it okay to store an Image in an System.Drawing.Image class in business layer (which is a class library "only"), and thus including a reference to System.Drawing too? I slightly feel just kind of bad doing that, 'cause it seems like I have UI-specific references in business code. Moreover, the code could become unnecessarily platform-dependant (though this is only a problem in theory, because we do not develop for multiple platforms). If it isn't right that way, which type would fit best? Thank you for any response! Matthias

    Read the article

  • Reducing the pain writing integration and system tests

    - by mdma
    I would like to make integration tests and system tests for my applications but producing good integration and system tests have often needed so much effort that I have not bothered. The few times I tried, I wrote custom, application-specific test harnesses, which felt like re-inventing the wheel each time. I wonder if this is the wrong approach. Is there a "standard" approach to integration and full system testing? EDIT: To clarify, it's automated tests, for desktop and web applications. Ideally a complete test suite that exercises the full functionality of the application.

    Read the article

  • Copy mdf file and use it in run time

    - by Anibas
    After I copy mdf file (and his log file) I tries to Insert data. I receive the following message: "An attempt to attach an auto-named database for file [fileName].mdf failed. A database with the same name exists, or specified file cannot be opened, or it is located on UNC share. When I copied the file manual everything worked normally. Is it correct the order File.Copy leaves the file engaged?

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • Designing a database file format

    - by RoliSoft
    I would like to design my own database engine for educational purposes, for the time being. Designing a binary file format is not hard nor the question, I've done it in the past, but while designing a database file format, I have come across a very important question: How to handle the deletion of an item? So far, I've thought of the following two options: Each item will have a "deleted" bit which is set to 1 upon deletion. Pro: relatively fast. Con: potentially sensitive data will remain in the file. 0x00 out the whole item upon deletion. Pro: potentially sensitive data will be removed from the file. Con: relatively slow. Recreating the whole database. Pro: no empty blocks which makes the follow-up question void. Con: it's a really good idea to overwrite the whole 4 GB database file because a user corrected a typo. I will sell this method to Twitter ASAP! Now let's say you already have a few empty blocks in your database (deleted items). The follow-up question is how to handle the insertion of a new item? Append the item to the end of the file. Pro: fastest possible. Con: file will get huge because of all the empty blocks that remain because deleted items aren't actually deleted. Search for an empty block exactly the size of the one you're inserting. Pro: may get rid of some blocks. Con: you may end up scanning the whole file at each insert only to find out it's very unlikely to come across a perfectly fitting empty block. Find the first empty block which is equal or larger than the item you're inserting. Pro: you probably won't end up scanning the whole file, as you will find an empty block somewhere mid-way; this will keep the file size relatively low. Con: there will still be lots of leftover 0x00 bytes at the end of items which were inserted into bigger empty blocks than they are. Rigth now, I think the first deletion method and the last insertion method are probably the "best" mix, but they would still have their own small issues. Alternatively, the first insertion method and scheduled full database recreation. (Probably not a good idea when working with really large databases. Also, each small update in that method will clone the whole item to the end of the file, thus accelerating file growth at a potentially insane rate.) Unless there is a way of deleting/inserting blocks from/to the middle of the file in a file-system approved way, what's the best way to do this? More importantly, how do databases currently used in production usually handle this?

    Read the article

  • Uninstalling demo/trial of Visual Studio 2008 Team System

    - by Ian Ringrose
    I wish to uninstall the trail copy of VS 2008 Team System, as the trial is coming to its end. I had VS 2008 Professional Edition installed on the machine to start with and it still shows up in Add/Remove Problems. I am hoping that when I uninstall VS 2008 Team System I will be left with a working VS 2008 Professional Edition. When I try to uninstall VS 2008 Team System, I very quickly get an error dialog that says: A problem has been encountered while loading the setup components. Canceling setup. Help! Progress or lack there of so fare I have done dir %temp%*.log in a command prompt and can see any log files that are recent I am going to read http://en.wikipedia.org/wiki/Windows_Installer#Diagnostic_logging to see if I can get any logging Aaron Stebner's WebLog has a post on where VS put's is log files, he also has a post on were some other products put there log files gives some info about where VS setup puts it's logs etc Aaron Ruckman provided me with the solution after I sent him the log files.

    Read the article

< Previous Page | 23 24 25 26 27 28 29 30 31 32 33 34  | Next Page >