Search Results

Search found 2960 results on 119 pages for 'println'.

Page 27/119 | < Previous Page | 23 24 25 26 27 28 29 30 31 32 33 34  | Next Page >

  • toURI method of File transform space character into %20

    - by piero
    toURI method of File transform space character into %20 On windows XP with Java 6 public static void main(String[] args) { File f = new File("C:\\My dir\\test.txt"); URI uri = f.toURI(); System.out.println(f.getAbsolutePath()); System.out.println(uri); } C:\My dir\test.txt file:/C:/My%20dir/test.txt

    Read the article

  • Insert Record by Drag & Drop from ADF Tree to ADF Tree Table

    - by arul.wilson(at)oracle.com
    If you want to create record based on the values Dragged from ADF Tree and Dropped on a ADF Tree Table, then here you go.UseCase DescriptionUser Drags a tree node from ADF Tree and Drops it on a ADF Tree Table node. A new row gets added in the Tree Table based on the source tree node, subsequently a record gets added to the database table on which Tree table in based on.Following description helps to achieve this using ADF BC.Run the DragDropSchema.sql to create required tables.Create Business Components from tables (PRODUCTS, COMPONENTS, SUB_COMPONENTS, USERS, USER_COMPONENTS) created above.Add custom method to App Module Impl, this method will be used to insert record from view layer.   public String createUserComponents(String p_bugdbId, String p_productId, String p_componentId, String p_subComponentId){    Row newUserComponentsRow = this.getUserComponentsView1().createRow();    try {      newUserComponentsRow.setAttribute("Bugdbid", p_bugdbId);      newUserComponentsRow.setAttribute("ProductId", new oracle.jbo.domain.Number(p_productId));      newUserComponentsRow.setAttribute("Component1", p_componentId);      newUserComponentsRow.setAttribute("SubComponent", p_subComponentId);    } catch (Exception e) {        e.printStackTrace();        return "Failure";    }        return "Success";  }Expose this method to client interface.To display the root node we need a custom VO which can be achieved using below query. SELECT Users.ACTIVE, Users.BUGDB_ID, Users.EMAIL, Users.FIRSTNAME, Users.GLOBAL_ID, Users.LASTNAME, Users.MANAGER_ID, Users.MANAGER_PRIVILEGEFROM USERS UsersWHERE Users.MANAGER_ID is NULLCreate VL between UsersView and UsersRootNodeView VOs.Drop ProductsView from DC as ADF Tree to jspx page.Add Tree Level Rule based on ComponentsView and SubComponentsView.Drop UsersRootNodeView as ADF Tree TableAdd Tree Level Rules based on UserComponentsView and UsersView.Add DragSource to ADF Tree and CollectionDropTarget to ADF Tree Table respectively.Bind CollectionDropTarget's DropTarget to backing bean and implement method of signature DnDAction (DropEvent), this method gets invoked when Tree Table encounters a drop action, here details required for creating new record are captured from the drag source and passed to 'createUserComponents' method. public DnDAction onTreeDrop(DropEvent dropEvent) {      String newBugdbId = "";      String msgtxt="";            try {          // Getting the target node bugdb id          Object serverRowKey = dropEvent.getDropSite();          if (serverRowKey != null) {                  //Code for Tree Table as target              String dropcomponent = dropEvent.getDropComponent().toString();              dropcomponent = (String)dropcomponent.subSequence(0, dropcomponent.indexOf("["));              if (dropcomponent.equals("RichTreeTable")){                RichTreeTable richTreeTable = (RichTreeTable)dropEvent.getDropComponent();                richTreeTable.setRowKey(serverRowKey);                int rowIndexTreeTable = richTreeTable.getRowIndex();                //Drop Target Logic                if (((JUCtrlHierNodeBinding)richTreeTable.getRowData(rowIndexTreeTable)).getAttributeValue()==null) {                  //Get Parent                  newBugdbId = (String)((JUCtrlHierNodeBinding)richTreeTable.getRowData(rowIndexTreeTable)).getParent().getAttributeValue();                } else {                  if (isNum(((JUCtrlHierNodeBinding)richTreeTable.getRowData(rowIndexTreeTable)).getAttributeValue().toString())) {                    //Get Parent's parent                              newBugdbId = (String)((JUCtrlHierNodeBinding)richTreeTable.getRowData(rowIndexTreeTable)).getParent().getParent().getAttributeValue();                  } else{                      //Dropped on USER                                          newBugdbId = (String)((JUCtrlHierNodeBinding)richTreeTable.getRowData(rowIndexTreeTable)).getAttributeValue();                  }                  }              }           }                     DataFlavor<RowKeySet> df = DataFlavor.getDataFlavor(RowKeySet.class);          RowKeySet droppedValue = dropEvent.getTransferable().getData(df);            Object[] keys = droppedValue.toArray();          Key componentKey = null;          Key subComponentKey = null;           // binding for createUserComponents method defined in AppModuleImpl class  to insert record in database.                      operationBinding = bindings.getOperationBinding("createUserComponents");            // get the Product, Component, Subcomponent details and insert to UserComponents table.          // loop through the keys if more than one comp/subcomponent is select.                   for (int i = 0; i < keys.length; i++) {                  System.out.println("in for :"+i);              List list = (List)keys[i];                  System.out.println("list "+i+" : "+list);              System.out.println("list size "+list.size());              if (list.size() == 1) {                                // we cannot drag and drop  the highest node !                                msgtxt="You cannot drop Products, please drop Component or SubComponent from the Tree.";                  System.out.println(msgtxt);                                this.showInfoMessage(msgtxt);              } else {                  if (list.size() == 2) {                    // were doing the first branch, in this case all components.                    componentKey = (Key)list.get(1);                    Object[] droppedProdCompValues = componentKey.getAttributeValues();                    operationBinding.getParamsMap().put("p_bugdbId",newBugdbId);                    operationBinding.getParamsMap().put("p_productId",droppedProdCompValues[0]);                    operationBinding.getParamsMap().put("p_componentId",droppedProdCompValues[1]);                    operationBinding.getParamsMap().put("p_subComponentId","ALL");                    Object result = operationBinding.execute();              } else {                    subComponentKey = (Key)list.get(2);                    Object[] droppedProdCompSubCompValues = subComponentKey.getAttributeValues();                    operationBinding.getParamsMap().put("p_bugdbId",newBugdbId);                    operationBinding.getParamsMap().put("p_productId",droppedProdCompSubCompValues[0]);                    operationBinding.getParamsMap().put("p_componentId",droppedProdCompSubCompValues[1]);                    operationBinding.getParamsMap().put("p_subComponentId",droppedProdCompSubCompValues[2]);                    Object result = operationBinding.execute();                  }                   }            }                        /* this.getCil1().setDisabled(false);            this.getCil1().setPartialSubmit(true); */                      return DnDAction.MOVE;        } catch (Exception ex) {          System.out.println("drop failed with : " + ex.getMessage());          ex.printStackTrace();                  /* this.getCil1().setDisabled(true); */          return DnDAction.NONE;          }    } Run jspx page and drop a Component or Subcomponent from Products Tree to UserComponents Tree Table.

    Read the article

  • Why keylistener is not working here?

    - by swift
    i have implemented keylistener interface and implemented all the needed methods but when i press the key nothing happens here, why? package swing; import java.awt.Color; import java.awt.Dimension; import java.awt.Graphics; import java.awt.Graphics2D; import java.awt.GridLayout; import java.awt.Point; import java.awt.RenderingHints; import java.awt.event.ActionEvent; import java.awt.event.ActionListener; import java.awt.event.KeyEvent; import java.awt.event.KeyListener; import java.awt.event.MouseEvent; import java.awt.event.MouseListener; import java.awt.event.MouseMotionListener; import java.awt.event.WindowAdapter; import java.awt.event.WindowEvent; import java.awt.image.BufferedImage; import javax.swing.BorderFactory; import javax.swing.BoxLayout; import javax.swing.ImageIcon; import javax.swing.JButton; import javax.swing.JFrame; import javax.swing.JLayeredPane; import javax.swing.JPanel; import javax.swing.JTextArea; class Paper extends JPanel implements MouseListener,MouseMotionListener,ActionListener,KeyListener { static BufferedImage image; String shape; Color color=Color.black; Point start; Point end; Point mp; Button elipse=new Button("elipse"); int x[]=new int[50]; int y[]=new int[50]; Button rectangle=new Button("rect"); Button line=new Button("line"); Button roundrect=new Button("roundrect"); Button polygon=new Button("poly"); Button text=new Button("text"); ImageIcon erasericon=new ImageIcon("images/eraser.gif"); JButton erase=new JButton(erasericon); JButton[] colourbutton=new JButton[9]; String selected; Point label; String key; int ex,ey;//eraser //DatagramSocket dataSocket; JButton button = new JButton("test"); JLayeredPane layerpane; Point p=new Point(); int w,h; public Paper() { JFrame frame=new JFrame("Whiteboard"); frame.setVisible(true); frame.setDefaultCloseOperation(JFrame.EXIT_ON_CLOSE); frame.setSize(640, 480); frame.setBackground(Color.black); layerpane=frame.getLayeredPane(); setWidth(539,444); setBounds(69,0,555,444); layerpane.add(this,new Integer(2)); layerpane.add(this.addButtons(),new Integer(0)); setLayout(null); setOpaque(false); addMouseListener(this); addMouseMotionListener(this); setFocusable(true); addKeyListener(this); System.out.println(isFocusable()); setBorder(BorderFactory.createLineBorder(Color.black)); } public void paintComponent(Graphics g) { try { super.paintComponent(g); g.drawImage(image, 0, 0, this); Graphics2D g2 = (Graphics2D)g; if(color!=null) g2.setPaint(color); if(start!=null && end!=null) { if(selected==("elipse")) g2.drawOval(start.x, start.y,(end.x-start.x),(end.y-start.y)); else if(selected==("rect")) g2.drawRect(start.x, start.y, (end.x-start.x),(end.y-start.y)); else if(selected==("rrect")) g2.drawRoundRect(start.x, start.y, (end.x-start.x),(end.y-start.y),11,11); else if(selected==("line")) g2.drawLine(start.x,start.y,end.x,end.y); else if(selected==("poly")) g2.drawPolygon(x,y,2); } } catch(Exception e) {} } //Function to draw the shape on image public void draw() { Graphics2D g2 = image.createGraphics(); g2.setPaint(color); if(start!=null && end!=null) { if(selected=="line") g2.drawLine(start.x, start.y, end.x, end.y); else if(selected=="elipse") g2.drawOval(start.x, start.y, (end.x-start.x),(end.y-start.y)); else if(selected=="rect") g2.drawRect(start.x, start.y, (end.x-start.x),(end.y-start.y)); else if(selected==("rrect")) g2.drawRoundRect(start.x, start.y, (end.x-start.x),(end.y-start.y),11,11); else if(selected==("poly")) g2.drawPolygon(x,y,2); } if(label!=null) { JTextArea textarea=new JTextArea(); if(selected==("text")) { textarea.setBounds(label.x, label.y, 50, 50); textarea.setMaximumSize(new Dimension(100,100)); textarea.setBackground(new Color(237,237,237)); add(textarea); g2.drawString("key",label.x,label.y); } } start=null; repaint(); g2.dispose(); } public void text() { System.out.println(label); } //Function which provides the erase functionality public void erase() { Graphics2D pic=(Graphics2D) image.getGraphics(); Color erasecolor=new Color(237,237,237); pic.setPaint(erasecolor); if(start!=null) pic.fillRect(start.x, start.y, 10, 10); } //To set the size of the image public void setWidth(int x,int y) { System.out.println("("+x+","+y+")"); w=x; h=y; image = new BufferedImage(w, h, BufferedImage.TYPE_INT_ARGB); } //Function to add buttons into the panel, calling this function returns a panel public JPanel addButtons() { JPanel buttonpanel=new JPanel(); buttonpanel.setMaximumSize(new Dimension(70,70)); JPanel shape=new JPanel(); JPanel colourbox=new JPanel(); shape.setLayout(new GridLayout(4,2)); shape.setMaximumSize(new Dimension(70,140)); colourbox.setLayout(new GridLayout(3,3)); colourbox.setMaximumSize(new Dimension(70,70)); buttonpanel.setLayout(new BoxLayout(buttonpanel,BoxLayout.Y_AXIS)); elipse.addActionListener(this); elipse.setToolTipText("Elipse"); rectangle.addActionListener(this); rectangle.setToolTipText("Rectangle"); line.addActionListener( this); line.setToolTipText("Line"); erase.addActionListener(this); erase.setToolTipText("Eraser"); roundrect.addActionListener(this); roundrect.setToolTipText("Round rect"); polygon.addActionListener(this); polygon.setToolTipText("Polygon"); text.addActionListener(this); text.setToolTipText("Text"); shape.add(elipse); shape.add(rectangle); shape.add(line); shape.add(erase); shape.add(roundrect); shape.add(polygon); shape.add(text); buttonpanel.add(shape); for(int i=0;i<9;i++) { colourbutton[i]=new JButton(); colourbox.add(colourbutton[i]); if(i==0) colourbutton[0].setBackground(Color.black); else if(i==1) colourbutton[1].setBackground(Color.white); else if(i==2) colourbutton[2].setBackground(Color.red); else if(i==3) colourbutton[3].setBackground(Color.orange); else if(i==4) colourbutton[4].setBackground(Color.blue); else if(i==5) colourbutton[5].setBackground(Color.green); else if(i==6) colourbutton[6].setBackground(Color.pink); else if(i==7) colourbutton[7].setBackground(Color.magenta); else if(i==8) colourbutton[8].setBackground(Color.cyan); colourbutton[i].addActionListener(this); } buttonpanel.add(colourbox); buttonpanel.setBounds(0, 0, 70, 210); return buttonpanel; } public void mouseClicked(MouseEvent e) { if(selected=="text") { label=new Point(); label=e.getPoint(); draw(); } } @Override public void mouseEntered(MouseEvent arg0) { } public void mouseExited(MouseEvent arg0) { } public void mousePressed(MouseEvent e) { if(selected=="line"||selected=="erase"||selected=="text") { start=e.getPoint(); } else if(selected=="elipse"||selected=="rect"||selected=="rrect") { mp = e.getPoint(); } else if(selected=="poly") { x[0]=e.getX(); y[0]=e.getY(); } } public void mouseReleased(MouseEvent e) { if(start!=null) { if(selected=="line") { end=e.getPoint(); } else if(selected=="elipse"||selected=="rect"||selected=="rrect") { end.x = Math.max(mp.x,e.getX()); end.y = Math.max(mp.y,e.getY()); } else if(selected=="poly") { x[1]=e.getX(); y[1]=e.getY(); } draw(); } } public void mouseDragged(MouseEvent e) { if(end==null) end = new Point(); if(start==null) start = new Point(); if(selected=="line") { end=e.getPoint(); } else if(selected=="erase") { start=e.getPoint(); erase(); } else if(selected=="elipse"||selected=="rect"||selected=="rrect") { start.x = Math.min(mp.x,e.getX()); start.y = Math.min(mp.y,e.getY()); end.x = Math.max(mp.x,e.getX()); end.y = Math.max(mp.y,e.getY()); } else if(selected=="poly") { x[1]=e.getX(); y[1]=e.getY(); } repaint(); } public void mouseMoved(MouseEvent arg0) {} public void actionPerformed(ActionEvent e) { if(e.getSource()==elipse) selected="elipse"; else if(e.getSource()==line) selected="line"; else if(e.getSource()==rectangle) selected="rect"; else if(e.getSource()==erase) { selected="erase"; System.out.println(selected); erase(); } else if(e.getSource()==roundrect) selected="rrect"; else if(e.getSource()==polygon) selected="poly"; else if(e.getSource()==text) selected="text"; if(e.getSource()==colourbutton[0]) color=Color.black; else if(e.getSource()==colourbutton[1]) color=Color.white; else if(e.getSource()==colourbutton[2]) color=Color.red; else if(e.getSource()==colourbutton[3]) color=Color.orange; else if(e.getSource()==colourbutton[4]) color=Color.blue; else if(e.getSource()==colourbutton[5]) color=Color.green; else if(e.getSource()==colourbutton[6]) color=Color.pink; else if(e.getSource()==colourbutton[7]) color=Color.magenta; else if(e.getSource()==colourbutton[8]) color=Color.cyan; } @Override public void keyPressed(KeyEvent e) { System.out.println("pressed"); } @Override public void keyReleased(KeyEvent e) { System.out.println("key released"); } @Override public void keyTyped(KeyEvent e) { System.out.println("Typed"); } public static void main(String[] a) { new Paper(); } } class Button extends JButton { String name; public Button(String name) { this.name=name; } public void paintComponent(Graphics g) { super.paintComponent(g); Graphics2D g2 = (Graphics2D)g; g2.setRenderingHint(RenderingHints.KEY_ANTIALIASING, RenderingHints.VALUE_ANTIALIAS_ON); //g2.setStroke(new BasicStroke(1.2f)); if (name == "line") g.drawLine(5,5,30,30); if (name == "elipse") g.drawOval(5,7,25,20); if (name== "rect") g.drawRect(5,5,25,23); if (name== "roundrect") g.drawRoundRect(5,5,25,23,10,10); int a[]=new int[]{20,9,20,23,20}; int b[]=new int[]{9,23,25,20,9}; if (name== "poly") g.drawPolyline(a, b, 5); if (name== "text") g.drawString("Text",5, 22); } }

    Read the article

  • Why doesn't my implementation of El Gamal work for long text strings?

    - by angstrom91
    I'm playing with the El Gamal cryptosystem, and my goal is to be able to encipher and decipher long sequences of text. I have come up with a method that works for short sequences, but does not work for long sequences, and I cannot figure out why. El Gamal requires the plaintext to be an integer. I have turned my string into a byte[] using the .getBytes() method for Strings, and then created a BigInteger out of the byte[]. After encryption/decryption, I turn the BigInteger into a byte[] using the .toByteArray() method for BigIntegers, and then create a new String object from the byte[]. This works perfectly when i call ElGamalEncipher with strings up to 129 characters. With 130 or more characters, the output produced is garbled. Can someone suggest how to solve this issue? Is this an issue with my method of turning the string into a BigInteger? If so, is there a better way to turn my string of text into a BigInteger and back? Below is my encipher/decipher code with a program to demonstrate the problem. import java.math.BigInteger; public class Main { static BigInteger P = new BigInteger("15893293927989454301918026303382412" + "2586402937727056707057089173871237566896685250125642378268385842" + "6917261652781627945428519810052550093673226849059197769795219973" + "9423619267147615314847625134014485225178547696778149706043781174" + "2873134844164791938367765407368476144402513720666965545242487520" + "288928241768306844169"); static BigInteger G = new BigInteger("33234037774370419907086775226926852" + "1714093595439329931523707339920987838600777935381196897157489391" + "8360683761941170467795379762509619438720072694104701372808513985" + "2267495266642743136795903226571831274837537691982486936010899433" + "1742996138863988537349011363534657200181054004755211807985189183" + "22832092343085067869"); static BigInteger R = new BigInteger("72294619754760174015019300613282868" + "7219874058383991405961870844510501809885568825032608592198728334" + "7842806755320938980653857292210955880919036195738252708294945320" + "3969657021169134916999794791553544054426668823852291733234236693" + "4178738081619274342922698767296233937873073756955509269717272907" + "8566607940937442517"); static BigInteger A = new BigInteger("32189274574111378750865973746687106" + "3695160924347574569923113893643975328118502246784387874381928804" + "6865920942258286938666201264395694101012858796521485171319748255" + "4630425677084511454641229993833255506759834486100188932905136959" + "7287419551379203001848457730376230681693887924162381650252270090" + "28296990388507680954"); public static void main(String[] args) { FewChars(); System.out.println(); ManyChars(); } public static void FewChars() { //ElGamalEncipher(String plaintext, BigInteger p, BigInteger g, BigInteger r) BigInteger[] cipherText = ElGamal.ElGamalEncipher("This is a string " + "of 129 characters which works just fine . This is a string " + "of 129 characters which works just fine . This is a s", P, G, R); System.out.println("This is a string of 129 characters which works " + "just fine . This is a string of 129 characters which works " + "just fine . This is a s"); //ElGamalDecipher(BigInteger c, BigInteger d, BigInteger a, BigInteger p) String output = ElGamal.ElGamalDecipher(cipherText[0], cipherText[1], A, P); System.out.println("The decrypted text is: " + output); } public static void ManyChars() { //ElGamalEncipher(String plaintext, BigInteger p, BigInteger g, BigInteger r) BigInteger[] cipherText = ElGamal.ElGamalEncipher("This is a string " + "of 130 characters which doesn’t work! This is a string of " + "130 characters which doesn’t work! This is a string of ", P, G, R); System.out.println("This is a string of 130 characters which doesn’t " + "work! This is a string of 130 characters which doesn’t work!" + " This is a string of "); //ElGamalDecipher(BigInteger c, BigInteger d, BigInteger a, BigInteger p) String output = ElGamal.ElGamalDecipher(cipherText[0], cipherText[1], A, P); System.out.println("The decrypted text is: " + output); } } import java.math.BigInteger; import java.security.SecureRandom; public class ElGamal { public static BigInteger[] ElGamalEncipher(String plaintext, BigInteger p, BigInteger g, BigInteger r) { // returns a BigInteger[] cipherText // cipherText[0] is c // cipherText[1] is d SecureRandom sr = new SecureRandom(); BigInteger[] cipherText = new BigInteger[2]; BigInteger pText = new BigInteger(plaintext.getBytes()); // 1: select a random integer k such that 1 <= k <= p-2 BigInteger k = new BigInteger(p.bitLength() - 2, sr); // 2: Compute c = g^k(mod p) BigInteger c = g.modPow(k, p); // 3: Compute d= P*r^k = P(g^a)^k(mod p) BigInteger d = pText.multiply(r.modPow(k, p)).mod(p); // C =(c,d) is the ciphertext cipherText[0] = c; cipherText[1] = d; return cipherText; } public static String ElGamalDecipher(BigInteger c, BigInteger d, BigInteger a, BigInteger p) { //returns the plaintext enciphered as (c,d) // 1: use the private key a to compute the least non-negative residue // of an inverse of (c^a)' (mod p) BigInteger z = c.modPow(a, p).modInverse(p); BigInteger P = z.multiply(d).mod(p); byte[] plainTextArray = P.toByteArray(); return new String(plainTextArray); } }

    Read the article

  • What's the best Communication Pattern for EJB3-based applications?

    - by Hank
    I'm starting a JEE project that needs to be strongly scalable. So far, the concept was: several Message Driven Beans, responsible for different parts of the architecture each MDB has a Session Bean injected, handling the business logic a couple of Entity Beans, providing access to the persistence layer communication between the different parts of the architecture via Request/Reply concept via JMS messages: MDB receives msg containing activity request uses its session bean to execute necessary business logic returns response object in msg to original requester The idea was that by de-coupling parts of the architecture from each other via the message bus, there is no limit to the scalability. Simply start more components - as long as they are connected to the same bus, we can grow and grow. Unfortunately, we're having massive problems with the request-reply concept. Transaction Mgmt seems to be in our way plenty. It seams that session beans are not supposed to consume messages?! Reading http://blogs.sun.com/fkieviet/entry/request_reply_from_an_ejb and http://forums.sun.com/message.jspa?messageID=10338789, I get the feeling that people actually recommend against the request/reply concept for EJBs. If that is the case, how do you communicate between your EJBs? (Remember, scalability is what I'm after) Details of my current setup: MDB 1 'TestController', uses (local) SLSB 1 'TestService' for business logic TestController.onMessage() makes TestService send a message to queue XYZ and requests a reply TestService uses Bean Managed Transactions TestService establishes a connection & session to the JMS broker via a joint connection factory upon initialization (@PostConstruct) TestService commits the transaction after sending, then begins another transaction and waits 10 sec for the response Message gets to MDB 2 'LocationController', which uses (local) SLSB 2 'LocationService' for business logic LocationController.onMessage() makes LocationService send a message back to the requested JMSReplyTo queue Same BMT concept, same @PostConstruct concept all use the same connection factory to access the broker Problem: The first message gets send (by SLSB 1) and received (by MDB 2) ok. The sending of the returning message (by SLSB 2) is fine as well. However, SLSB 1 never receives anything - it just times out. I tried without the messageSelector, no change, still no receiving message. Is it not ok to consume message by a session bean? SLSB 1 - TestService.java @Resource(name = "jms/mvs.MVSControllerFactory") private javax.jms.ConnectionFactory connectionFactory; @PostConstruct public void initialize() { try { jmsConnection = connectionFactory.createConnection(); session = jmsConnection.createSession(false, Session.AUTO_ACKNOWLEDGE); System.out.println("Connection to JMS Provider established"); } catch (Exception e) { } } public Serializable sendMessageWithResponse(Destination reqDest, Destination respDest, Serializable request) { Serializable response = null; try { utx.begin(); Random rand = new Random(); String correlationId = rand.nextLong() + "-" + (new Date()).getTime(); // prepare the sending message object ObjectMessage reqMsg = session.createObjectMessage(); reqMsg.setObject(request); reqMsg.setJMSReplyTo(respDest); reqMsg.setJMSCorrelationID(correlationId); // prepare the publishers and subscribers MessageProducer producer = session.createProducer(reqDest); // send the message producer.send(reqMsg); System.out.println("Request Message has been sent!"); utx.commit(); // need to start second transaction, otherwise the first msg never gets sent utx.begin(); MessageConsumer consumer = session.createConsumer(respDest, "JMSCorrelationID = '" + correlationId + "'"); jmsConnection.start(); ObjectMessage respMsg = (ObjectMessage) consumer.receive(10000L); utx.commit(); if (respMsg != null) { response = respMsg.getObject(); System.out.println("Response Message has been received!"); } else { // timeout waiting for response System.out.println("Timeout waiting for response!"); } } catch (Exception e) { } return response; } SLSB 2 - LocationService.Java (only the reply method, rest is same as above) public boolean reply(Message origMsg, Serializable o) { boolean rc = false; try { // check if we have necessary correlationID and replyTo destination if (!origMsg.getJMSCorrelationID().equals("") && (origMsg.getJMSReplyTo() != null)) { // prepare the payload utx.begin(); ObjectMessage msg = session.createObjectMessage(); msg.setObject(o); // make it a response msg.setJMSCorrelationID(origMsg.getJMSCorrelationID()); Destination dest = origMsg.getJMSReplyTo(); // send it MessageProducer producer = session.createProducer(dest); producer.send(msg); producer.close(); System.out.println("Reply Message has been sent"); utx.commit(); rc = true; } } catch (Exception e) {} return rc; } sun-resources.xml <admin-object-resource enabled="true" jndi-name="jms/mvs.LocationControllerRequest" res-type="javax.jms.Queue" res-adapter="jmsra"> <property name="Name" value="mvs.LocationControllerRequestQueue"/> </admin-object-resource> <admin-object-resource enabled="true" jndi-name="jms/mvs.LocationControllerResponse" res-type="javax.jms.Queue" res-adapter="jmsra"> <property name="Name" value="mvs.LocationControllerResponseQueue"/> </admin-object-resource> <connector-connection-pool name="jms/mvs.MVSControllerFactoryPool" connection-definition-name="javax.jms.QueueConnectionFactory" resource-adapter-name="jmsra"/> <connector-resource enabled="true" jndi-name="jms/mvs.MVSControllerFactory" pool-name="jms/mvs.MVSControllerFactoryPool" />

    Read the article

  • Java collision detection and player movement: tips

    - by Loris
    I have read a short guide for game develompent (java, without external libraries). I'm facing with collision detection and player (and bullets) movements. Now i put the code. Most of it is taken from the guide (should i link this guide?). I'm just trying to expand and complete it. This is the class that take care of updates movements and firing mechanism (and collision detection): public class ArenaController { private Arena arena; /** selected cell for movement */ private float targetX, targetY; /** true if droid is moving */ private boolean moving = false; /** true if droid is shooting to enemy */ private boolean shooting = false; private DroidController droidController; public ArenaController(Arena arena) { this.arena = arena; this.droidController = new DroidController(arena); } public void update(float delta) { Droid droid = arena.getDroid(); //droid movements if (moving) { droidController.moveDroid(delta, targetX, targetY); //check if arrived if (droid.getX() == targetX && droid.getY() == targetY) moving = false; } //firing mechanism if(shooting) { //stop shot if there aren't bullets if(arena.getBullets().isEmpty()) { shooting = false; } for(int i = 0; i < arena.getBullets().size(); i++) { //current bullet Bullet bullet = arena.getBullets().get(i); System.out.println(bullet.getBounds()); //angle calculation double angle = Math.atan2(bullet.getEnemyY() - bullet.getY(), bullet.getEnemyX() - bullet.getX()); //increments x and y bullet.setX((float) (bullet.getX() + (Math.cos(angle) * bullet.getSpeed() * delta))); bullet.setY((float) (bullet.getY() + (Math.sin(angle) * bullet.getSpeed() * delta))); //collision with obstacles for(int j = 0; j < arena.getObstacles().size(); j++) { Obstacle obs = arena.getObstacles().get(j); if(bullet.getBounds().intersects(obs.getBounds())) { System.out.println("Collision detect!"); arena.removeBullet(bullet); } } //collisions with enemies for(int j = 0; j < arena.getEnemies().size(); j++) { Enemy ene = arena.getEnemies().get(j); if(bullet.getBounds().intersects(ene.getBounds())) { System.out.println("Collision detect!"); arena.removeBullet(bullet); } } } } } public boolean onClick(int x, int y) { //click on empty cell if(arena.getGrid()[(int)(y / Arena.TILE)][(int)(x / Arena.TILE)] == null) { //coordinates targetX = x / Arena.TILE; targetY = y / Arena.TILE; //enables movement moving = true; return true; } //click on enemy: fire if(arena.getGrid()[(int)(y / Arena.TILE)][(int)(x / Arena.TILE)] instanceof Enemy) { //coordinates float enemyX = x / Arena.TILE; float enemyY = y / Arena.TILE; //new bullet Bullet bullet = new Bullet(); //start coordinates bullet.setX(arena.getDroid().getX()); bullet.setY(arena.getDroid().getY()); //end coordinates (enemie) bullet.setEnemyX(enemyX); bullet.setEnemyY(enemyY); //adds bullet to arena arena.addBullet(bullet); //enables shooting shooting = true; return true; } return false; } As you can see for collision detection i'm trying to use Rectangle object. Droid example: import java.awt.geom.Rectangle2D; public class Droid { private float x; private float y; private float speed = 20f; private float rotation = 0f; private float damage = 2f; public static final int DIAMETER = 32; private Rectangle2D rectangle; public Droid() { rectangle = new Rectangle2D.Float(x, y, DIAMETER, DIAMETER); } public float getX() { return x; } public void setX(float x) { this.x = x; //rectangle update rectangle.setRect(x, y, DIAMETER, DIAMETER); } public float getY() { return y; } public void setY(float y) { this.y = y; //rectangle update rectangle.setRect(x, y, DIAMETER, DIAMETER); } public float getSpeed() { return speed; } public void setSpeed(float speed) { this.speed = speed; } public float getRotation() { return rotation; } public void setRotation(float rotation) { this.rotation = rotation; } public float getDamage() { return damage; } public void setDamage(float damage) { this.damage = damage; } public Rectangle2D getRectangle() { return rectangle; } } For now, if i start the application and i try to shot to an enemy, is immediately detected a collision and the bullet is removed! Can you help me with this? If the bullet hit an enemy or an obstacle in his way, it must disappear. Ps: i know that the movements of the bullets should be managed in another class. This code is temporary. update I realized what happens, but not why. With those for loops (which checks collisions) the movements of the bullets are instantaneous instead of gradual. In addition to this, if i add the collision detection to the Droid, the method intersects returns true ALWAYS while the droid is moving! public void moveDroid(float delta, float x, float y) { Droid droid = arena.getDroid(); int bearing = 1; if (droid.getX() > x) { bearing = -1; } if (droid.getX() != x) { droid.setX(droid.getX() + bearing * droid.getSpeed() * delta); //obstacles collision detection for(Obstacle obs : arena.getObstacles()) { if(obs.getRectangle().intersects(droid.getRectangle())) { System.out.println("Collision detected"); //ALWAYS HERE } } //controlla se è arrivato if ((droid.getX() < x && bearing == -1) || (droid.getX() > x && bearing == 1)) droid.setX(x); } bearing = 1; if (droid.getY() > y) { bearing = -1; } if (droid.getY() != y) { droid.setY(droid.getY() + bearing * droid.getSpeed() * delta); if ((droid.getY() < y && bearing == -1) || (droid.getY() > y && bearing == 1)) droid.setY(y); } }

    Read the article

  • Listview selects mutliple items when clicked

    - by xlph
    I'm trying to make a task manager, and I only have one problem. I have a listview that gets inflated. All the elements in the listview are correct. The problem is that when I select an item, the listview will select another item away. I've heard listviews repopulate the list as it scrolls down to save memory. I think this may be some sort of problem. Here is a picture of the problem. If i had more apps loaded, then it would continue to select multiple at once. Here is the code of my adapter and activity and XML associated public class TaskAdapter extends BaseAdapter{ private Context mContext; private List<TaskInfo> mListAppInfo; private PackageManager mPack; public TaskAdapter(Context c, List<TaskInfo> list, PackageManager pack) { mContext = c; mListAppInfo = list; mPack = pack; } @Override public int getCount() { return mListAppInfo.size(); } @Override public Object getItem(int position) { return mListAppInfo.get(position); } @Override public long getItemId(int position) { return position; } @Override public View getView(final int position, View convertView, ViewGroup parent) { TaskInfo entry = mListAppInfo.get(position); if (convertView == null) { LayoutInflater inflater = LayoutInflater.from(mContext); //System.out.println("Setting LayoutInflater in TaskAdapter " +mContext +" " +R.layout.taskinfo +" " +R.id.tmbox); convertView = inflater.inflate(R.layout.taskinfo,null); } ImageView ivIcon = (ImageView)convertView.findViewById(R.id.tmImage); ivIcon.setImageDrawable(entry.getIcon()); TextView tvName = (TextView)convertView.findViewById(R.id.tmbox); tvName.setText(entry.getName()); convertView.setOnClickListener(new OnClickListener() { @Override public void onClick(View v) { final CheckBox checkBox = (CheckBox)v.findViewById(R.id.tmbox); if(v.isSelected()) { System.out.println("Listview not selected "); //CK.get(arg2).setChecked(false); checkBox.setChecked(false); v.setSelected(false); } else { System.out.println("Listview selected "); //CK.get(arg2).setChecked(true); checkBox.setChecked(true); v.setSelected(true); } } }); return convertView; public class TaskManager extends Activity implements Runnable { private ProgressDialog pd; private TextView ram; private String s; @Override public void onCreate(Bundle savedInstanceState) { super.onCreate(savedInstanceState); setContentView(R.layout.taskpage); setTitleColor(Color.YELLOW); Thread thread = new Thread(this); thread.start(); } @Override public void run() { //System.out.println("In Taskmanager Run() Thread"); final PackageManager pm = getPackageManager(); final ListView box = (ListView) findViewById(R.id.cBoxSpace); final List<TaskInfo> CK = populate(box, pm); runOnUiThread(new Runnable() { @Override public void run() { ram.setText(s); box.setAdapter(new TaskAdapter(TaskManager.this, CK, pm)); //System.out.println("In Taskmanager runnable Run()"); endChecked(CK); } }); handler.sendEmptyMessage(0); } Taskinfo.xml <LinearLayout xmlns:android="http://schemas.android.com/apk/res/android" android:layout_width="wrap_content" android:layout_height="wrap_content" android:orientation="horizontal" android:gravity="center_horizontal"> <ImageView android:id="@+id/tmImage" android:layout_width="48dp" android:layout_height="48dp" android:scaleType="centerCrop" android:adjustViewBounds="false" android:focusable="false" /> <CheckBox android:layout_width="wrap_content" android:layout_height="wrap_content" android:id="@+id/tmbox" android:lines="2"/> </LinearLayout> Taskpage.xml <?xml version="1.0" encoding="utf-8"?> <LinearLayout xmlns:android="http://schemas.android.com/apk/res/android" android:layout_width="fill_parent" android:layout_height="fill_parent" android:orientation="vertical"> <ListView android:id="@+id/cBoxSpace" android:layout_width="wrap_content" android:layout_height="400dp" android:orientation="vertical"/> <TextView android:id="@+id/RAM" android:layout_width="wrap_content" android:layout_height="wrap_content" android:textSize="18sp" /> <Button android:id="@+id/endButton" android:layout_width="wrap_content" android:layout_height="wrap_content" android:text="End Selected Tasks" /> </LinearLayout> Any ideas for what reason mutliple items are selected with a single click would be GREATLY appreciated. I've been messing around with different implementations and listeners and listadapters but to no avail.

    Read the article

  • HttpTransportSE requestDump gives NullPointerException

    - by Chamila
    Hi, I'm trying to access a webservice in Android via Ksoap2 for android. The SoapObject is created ok, the S.o.p of the bodyOut outputs the desired strings. But when I do a requestDump of the HttpTransportSE object I create to make the call, a NullPointerException happens. In other words, the transport object is null. How can this happen? Web Service is at http://srilanka.lk:9080/services/CropServiceProxy?wsdl This service works very well with SoapUI. SoapUI Request <soap:Envelope xmlns:soap="http://www.w3.org/2003/05/soap-envelope" xmlns:v1="http://schemas.icta.lk/xsd/crop/handler/v1/"> <soap:Header/> <soap:Body> <v1:getCropDataList> <v1:code>ABK</v1:code> </v1:getCropDataList> </soap:Body> </soap:Envelope> SoapUI Response <soapenv:Envelope xmlns:soapenv="http://www.w3.org/2003/05/soap-envelope"> <soapenv:Body> <ns1:getCropDataListResponse xmlns:ns1="http://schemas.icta.lk/xsd/crop/handler/v1/"> <ns1:cropInfo> <ns1:name>Ambul Kesel</ns1:name> <ns1:price>35.0</ns1:price> <ns1:location>Dambulla</ns1:location> </ns1:cropInfo> <ns1:cropInfo> <ns1:name>Ambul Kesel</ns1:name> <ns1:price>40.0</ns1:price> <ns1:location>Dambulla</ns1:location> </ns1:cropInfo> </ns1:getCropDataListResponse> </soapenv:Body> </soapenv:Envelope> Client Side Complex Type KvmSerializable implementation public class CropInfo implements KvmSerializable { private String name; private float price; private String location; @Override public Object getProperty(int arg0) { switch (arg0){ case 0: return name; case 1: return price; case 2: return location; default: return null; } } @Override public int getPropertyCount() { return 3; } @Override public void getPropertyInfo(int arg0, Hashtable arg1, PropertyInfo arg2) { switch (arg0){ case 0: arg2.type = PropertyInfo.STRING_CLASS; arg2.name = "Name"; break; case 1: arg2.type = Float.class; arg2.name = "Price"; break; case 2: arg2.type = PropertyInfo.STRING_CLASS; arg2.name = "Location"; break; default: break; } } @Override public void setProperty(int arg0, Object arg1) { switch(arg0){ case 0: name = arg1.toString(); break; case 1: price = Float.parseFloat(arg1.toString()); case 2: location = arg1.toString(); default: break; } } } Web Service Call public void btnOnClick(View v){ String NAMESPACE = "http://schemas.icta.lk/xsd/crop/handler/v1/"; String URL = "http://220.247.225.202:9080/services/CropServiceProxy.CropServiceProxyHttpSoap12Endpoint"; String method_name = "getCropDataList"; String SOAP_ACTION = "http://schemas.icta.lk/xsd/crop/handler/v1/getCropDataList"; SoapObject soap_request = new SoapObject(NAMESPACE, method_name); soap_request.addProperty("code", "ABK" ); SoapSerializationEnvelope envelope = new SoapSerializationEnvelope(SoapEnvelope.VER12); envelope.setOutputSoapObject(soap_request); envelope.addMapping(NAMESPACE, "cropInfo", CropInfo.class); //envelope.dotNet=true; Marshal floatMarshal = new MarshalFloat(); floatMarshal.register(envelope); System.out.println("body out : " + envelope.bodyOut.toString()); //AndroidHttpTransport http_transport = new AndroidHttpTransport(URL); HttpTransportSE http_transport = new HttpTransportSE(URL); try { //NullPointerException HERE System.out.println(http_transport.requestDump); http_transport.call(SOAP_ACTION, envelope); //because we should expect a vector, two kinds of prices are given Vector<CropInfo> result_array = (Vector<CropInfo>)envelope.getResponse(); if(result_array != null){ for (CropInfo current_crop: result_array){ System.out.println(current_crop.getName()); System.out.println(Float.toString(current_crop.getPrice())); } } } catch (Exception e) { e.printStackTrace(); answer.setText("error caught"); //System.out.println(http_transport.responseDump); } // String result_string[] = (String[])result; //answer.setText("returned"); } Can anyone explain this?

    Read the article

  • Reasoner Conversion Problems:

    - by Annalyne
    I have this code right here in Java and I wanted to translate it in C++, but I had some problems going: this is the java code: import java.io.*; import java.util.*; public class ClueReasoner { private int numPlayers; private int playerNum; private int numCards; private SATSolver solver; private String caseFile = "cf"; private String[] players = {"sc", "mu", "wh", "gr", "pe", "pl"}; private String[] suspects = {"mu", "pl", "gr", "pe", "sc", "wh"}; private String[] weapons = {"kn", "ca", "re", "ro", "pi", "wr"}; private String[] rooms = {"ha", "lo", "di", "ki", "ba", "co", "bi", "li", "st"}; private String[] cards; public ClueReasoner() { numPlayers = players.length; // Initialize card info cards = new String[suspects.length + weapons.length + rooms.length]; int i = 0; for (String card : suspects) cards[i++] = card; for (String card : weapons) cards[i++] = card; for (String card : rooms) cards[i++] = card; numCards = i; // Initialize solver solver = new SATSolver(); addInitialClauses(); } private int getPlayerNum(String player) { if (player.equals(caseFile)) return numPlayers; for (int i = 0; i < numPlayers; i++) if (player.equals(players[i])) return i; System.out.println("Illegal player: " + player); return -1; } private int getCardNum(String card) { for (int i = 0; i < numCards; i++) if (card.equals(cards[i])) return i; System.out.println("Illegal card: " + card); return -1; } private int getPairNum(String player, String card) { return getPairNum(getPlayerNum(player), getCardNum(card)); } private int getPairNum(int playerNum, int cardNum) { return playerNum * numCards + cardNum + 1; } public void addInitialClauses() { // TO BE IMPLEMENTED AS AN EXERCISE // Each card is in at least one place (including case file). for (int c = 0; c < numCards; c++) { int[] clause = new int[numPlayers + 1]; for (int p = 0; p <= numPlayers; p++) clause[p] = getPairNum(p, c); solver.addClause(clause); } // If a card is one place, it cannot be in another place. // At least one card of each category is in the case file. // No two cards in each category can both be in the case file. } public void hand(String player, String[] cards) { playerNum = getPlayerNum(player); // TO BE IMPLEMENTED AS AN EXERCISE } public void suggest(String suggester, String card1, String card2, String card3, String refuter, String cardShown) { // TO BE IMPLEMENTED AS AN EXERCISE } public void accuse(String accuser, String card1, String card2, String card3, boolean isCorrect) { // TO BE IMPLEMENTED AS AN EXERCISE } public int query(String player, String card) { return solver.testLiteral(getPairNum(player, card)); } public String queryString(int returnCode) { if (returnCode == SATSolver.TRUE) return "Y"; else if (returnCode == SATSolver.FALSE) return "n"; else return "-"; } public void printNotepad() { PrintStream out = System.out; for (String player : players) out.print("\t" + player); out.println("\t" + caseFile); for (String card : cards) { out.print(card + "\t"); for (String player : players) out.print(queryString(query(player, card)) + "\t"); out.println(queryString(query(caseFile, card))); } } public static void main(String[] args) { ClueReasoner cr = new ClueReasoner(); String[] myCards = {"wh", "li", "st"}; cr.hand("sc", myCards); cr.suggest("sc", "sc", "ro", "lo", "mu", "sc"); cr.suggest("mu", "pe", "pi", "di", "pe", null); cr.suggest("wh", "mu", "re", "ba", "pe", null); cr.suggest("gr", "wh", "kn", "ba", "pl", null); cr.suggest("pe", "gr", "ca", "di", "wh", null); cr.suggest("pl", "wh", "wr", "st", "sc", "wh"); cr.suggest("sc", "pl", "ro", "co", "mu", "pl"); cr.suggest("mu", "pe", "ro", "ba", "wh", null); cr.suggest("wh", "mu", "ca", "st", "gr", null); cr.suggest("gr", "pe", "kn", "di", "pe", null); cr.suggest("pe", "mu", "pi", "di", "pl", null); cr.suggest("pl", "gr", "kn", "co", "wh", null); cr.suggest("sc", "pe", "kn", "lo", "mu", "lo"); cr.suggest("mu", "pe", "kn", "di", "wh", null); cr.suggest("wh", "pe", "wr", "ha", "gr", null); cr.suggest("gr", "wh", "pi", "co", "pl", null); cr.suggest("pe", "sc", "pi", "ha", "mu", null); cr.suggest("pl", "pe", "pi", "ba", null, null); cr.suggest("sc", "wh", "pi", "ha", "pe", "ha"); cr.suggest("wh", "pe", "pi", "ha", "pe", null); cr.suggest("pe", "pe", "pi", "ha", null, null); cr.suggest("sc", "gr", "pi", "st", "wh", "gr"); cr.suggest("mu", "pe", "pi", "ba", "pl", null); cr.suggest("wh", "pe", "pi", "st", "sc", "st"); cr.suggest("gr", "wh", "pi", "st", "sc", "wh"); cr.suggest("pe", "wh", "pi", "st", "sc", "wh"); cr.suggest("pl", "pe", "pi", "ki", "gr", null); cr.printNotepad(); cr.accuse("sc", "pe", "pi", "bi", true); } } how can I convert this? there are too many errors I get. for my C++ code (as a commentor asked for) #include <iostream> #include <cstdlib> #include <string> using namespace std; void Scene_Reasoner() { int numPlayer; int playerNum; int cardNum; string filecase = "Case: "; string players [] = {"sc", "mu", "wh", "gr", "pe", "pl"}; string suspects [] = {"mu", "pl", "gr", "pe", "sc", "wh"}; string weapons [] = {"kn", "ca", "re", "ro", "pi", "wr"}; string rooms[] = {"ha", "lo", "di", "ki", "ba", "co", "bi", "li", "st"}; string cards [0]; }; void Scene_Reason_Base () { numPlayer = players.length; // Initialize card info cards = new String[suspects.length + weapons.length + rooms.length]; int i = 0; for (String card : suspects) cards[i++] = card; for (String card : weapons) cards[i++] = card; for (String card : rooms) cards[i++] = card; cardNum = i; }; private int getCardNum (string card) { for (int i = 0; i < numCards; i++) if (card.equals(cards[i])) return i; cout << "Illegal card: " + card <<endl; return -1; }; private int getPairNum(String player, String card) { return getPairNum(getPlayerNum(player), getCardNum(card)); }; private int getPairNum(int playerNum, int cardNum) { return playerNum * numCards + cardNum + 1; }; int main () { return 0; }

    Read the article

  • Why cant i draw an elipse in with code?

    - by bvivek88
    package test; import java.awt.*; import java.awt.event.*; import java.awt.geom.Ellipse2D; import java.awt.image.BufferedImage; import javax.swing.*; public class test_bmp extends JPanel implements MouseListener,MouseMotionListener,ActionListener { static BufferedImage image; Color color; Point start=new Point(); Point end =new Point(); JButton elipse=new JButton("Elipse"); JButton rectangle=new JButton("Rectangle"); JButton line=new JButton("Line"); String selected; public test_bmp() { color = Color.black; setBorder(BorderFactory.createLineBorder(Color.black)); addMouseListener(this); addMouseMotionListener(this); } public void paintComponent(Graphics g) { //super.paintComponent(g); g.drawImage(image, 0, 0, this); Graphics2D g2 = (Graphics2D)g; g2.setPaint(Color.black); if(selected=="elipse") { g2.drawOval(start.x, start.y, (end.x-start.x),(end.y-start.y)); System.out.println("Start : "+start.x+","+start.y); System.out.println("End : "+end.x+","+end.y); } if(selected=="line") g2.drawLine(start.x,start.y,end.x,end.y); } //Draw on Buffered image public void draw() { Graphics2D g2 = image.createGraphics(); g2.setPaint(color); System.out.println("draw"); if(selected=="line") g2.drawLine(start.x, start.y, end.x, end.y); if(selected=="elipse") { g2.drawOval(start.x, start.y, (end.x-start.x),(end.y-start.y)); System.out.println("Start : "+start.x+","+start.y); System.out.println("End : "+end.x+","+end.y); } repaint(); g2.dispose(); } public JPanel addButtons() { JPanel buttonpanel=new JPanel(); buttonpanel.setBackground(color.lightGray); buttonpanel.setLayout(new BoxLayout(buttonpanel,BoxLayout.Y_AXIS)); elipse.addActionListener(this); rectangle.addActionListener(this); line.addActionListener(this); buttonpanel.add(elipse); buttonpanel.add(Box.createRigidArea(new Dimension(15,15))); buttonpanel.add(rectangle); buttonpanel.add(Box.createRigidArea(new Dimension(15,15))); buttonpanel.add(line); return buttonpanel; } public static void main(String args[]) { test_bmp application=new test_bmp(); //Main window JFrame frame=new JFrame("Whiteboard"); frame.setLayout(new BorderLayout()); frame.add(application.addButtons(),BorderLayout.WEST); frame.add(application); //size of the window frame.setSize(600,400); frame.setLocation(0,0); frame.setVisible(true); int w = frame.getWidth(); int h = frame.getHeight(); image = new BufferedImage(w, h, BufferedImage.TYPE_INT_RGB); Graphics2D g2 = image.createGraphics(); g2.setPaint(Color.white); g2.fillRect(0,0,w,h); g2.dispose(); frame.setDefaultCloseOperation(JFrame.EXIT_ON_CLOSE); } @Override public void mouseClicked(MouseEvent arg0) { // TODO Auto-generated method stub } @Override public void mouseEntered(MouseEvent arg0) { // TODO Auto-generated method stub } @Override public void mouseExited(MouseEvent arg0) { // TODO Auto-generated method stub } @Override public void mousePressed(MouseEvent event) { start = event.getPoint(); } @Override public void mouseReleased(MouseEvent event) { end = event.getPoint(); draw(); } @Override public void mouseDragged(MouseEvent e) { end=e.getPoint(); repaint(); } @Override public void mouseMoved(MouseEvent arg0) { // TODO Auto-generated method stub } @Override public void actionPerformed(ActionEvent e) { if(e.getSource()==elipse) selected="elipse"; if(e.getSource()==line) selected="line"; draw(); } } I need to create a paint application, when i draw elipse by dragging mouse from left to right it displays nothing, why?? should i use any other function here?

    Read the article

  • Finding the groups of a user in WLS with OPSS

    - by user12587121
    How to find the group memberships for a user from a web application running in Weblogic server ?  This is useful for building up the profile of the user for security purposes for example. WLS as a container offers an identity store service which applications can access to query and manage identities known to the container.  This article for example shows how to recover the groups of the current user, but how can we find the same information for an arbitrary user ? It is the Oracle Platform for Securtiy Services (OPSS) that looks after the identity store in WLS and so it is in the OPSS APIs that we can find the way to recover this information. This is explained in the following documents.  Starting from the FMW 11.1.1.5 book list, with the Security Overview document we can see how WLS uses OPSS: Proceeding to the more detailed Application Security document, we find this list of useful references for security in FMW. We can follow on into the User/Role API javadoc. The Application Security document explains how to ensure that the identity store is configured appropriately to allow the OPSS APIs to work.  We must verify that the jps-config.xml file where the application  is deployed has it's identity store configured--look for the following elements in that file: <serviceProvider type="IDENTITY_STORE" name="idstore.ldap.provider" class="oracle.security.jps.internal.idstore.ldap.LdapIdentityStoreProvider">             <description>LDAP-based IdentityStore Provider</description>  </serviceProvider> <serviceInstance name="idstore.ldap" provider="idstore.ldap.provider">             <property name="idstore.config.provider" value="oracle.security.jps.wls.internal.idstore.WlsLdapIdStoreConfigProvider"/>             <property name="CONNECTION_POOL_CLASS" value="oracle.security.idm.providers.stdldap.JNDIPool"/></serviceInstance> <serviceInstanceRef ref="idstore.ldap"/> The document contains a code sample for using the identity store here. Once we have the identity store reference we can recover the user's group memberships using the RoleManager interface:             RoleManager roleManager = idStore.getRoleManager();            SearchResponse grantedRoles = null;            try{                System.out.println("Retrieving granted WLS roles for user " + userPrincipal.getName());                grantedRoles = roleManager.getGrantedRoles(userPrincipal, false);                while( grantedRoles.hasNext()){                      Identity id = grantedRoles.next();                      System.out.println("  disp name=" + id.getDisplayName() +                                  " Name=" + id.getName() +                                  " Principal=" + id.getPrincipal() +                                  "Unique Name=" + id.getUniqueName());                     // Here, we must use WLSGroupImpl() to build the Principal otherwise                     // OES does not recognize it.                      retSubject.getPrincipals().add(new WLSGroupImpl(id.getPrincipal().getName()));                 }            }catch(Exception ex) {                System.out.println("Error getting roles for user " + ex.getMessage());                ex.printStackTrace();            }        }catch(Exception ex) {            System.out.println("OESGateway: Got exception instantiating idstore reference");        } This small JDeveloper project has a simple servlet that executes a request for the user weblogic's roles on executing a get on the default URL.  The full code to recover a user's goups is in the getSubjectWithRoles() method in the project.

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • Swing object: first setText() gets "stuck" when using Mac Java SE 6

    - by Tim
    Hi there, I am a Java newbie trying to maintain an application that works fine under J2SE 5.0 (32- and 64-bit) but has a very specific problem when run under Java SE 6 64-bit: [Tims-MPB:~] tlynch% java -version java version "1.6.0_15" Java(TM) SE Runtime Environment (build 1.6.0_15-b03-226) Java HotSpot(TM) 64-Bit Server VM (build 14.1-b02-92, mixed mode) The application is cross-platform and reportedly works correctly on Java SE 6 under Windows, though I haven't been able to verify that myself. The program uses a JTextField for some text entry and a JLabel to indicate the text to be entered. The first time the showDialog() method is called to set the label text and display the dialog, it works correctly, but subsequent calls all result in the display of the label from the initial invocation rather than the one most recently specified via setText(). public void showDialog(String msgText) { System.out.println("set ChatDialog: " + msgText); jLabel1.setText(msgText); jLabel1.repaint(); // I added this; it didn't help System.out.println("get ChatDialog: " + jLabel1.getText()); super.setVisible(true); } [the full text of the class is provided below] The added printlns validate that expected text is passed to the label's setText() method and is confirmed by retrieving it using getText(), but what shows up on the screen/GUI is always the text from the very first time the method was called for the object. A similar issue is observed with a JTextArea used to label another dialog box. These problem are consistent across multiple Mac systems running Java SE 6 under OS 10.5.x and 10.6.x, but they are never observed when one reverts to J2SE 5.0. If there is some background information pertinent to this problem that I have omitted, please let me know. Any insights or advice appreciated. package gui; import java.awt.*; import java.awt.event.KeyEvent; import javax.swing.*; // Referenced classes of package gui: // MyJPanel, ChatDialog_jTextField1_keyAdapter, WarWindow public class ChatDialog extends JDialog { public ChatDialog(JFrame parent, WarWindow w) { super(parent, true); text = ""; borderLayout1 = new BorderLayout(); jPanel1 = new MyJPanel(); borderLayout2 = new BorderLayout(); jPanel2 = new MyJPanel(); jPanel3 = new MyJPanel(); jLabel1 = new JLabel(); jTextField1 = new JTextField(); warWindow = w; try { jbInit(); } catch(Exception exception) { System.out.println("Problem with ChatDialog init"); exception.printStackTrace(); } return; } public String getText() { return text; } void jTextField1_keyPressed(KeyEvent e) { int id = e.getKeyCode(); switch(id) { case 10: // '\n' text = jTextField1.getText(); setVisible(false); break; } } private void jbInit() throws Exception { setLocation(232, 450); setSize(560, 60); setModal(true); setResizable(false); setUndecorated(true); getContentPane().setLayout(borderLayout1); jPanel1.setLayout(borderLayout2); jPanel2.setMinimumSize(new Dimension(10, 20)); jPanel2.setPreferredSize(new Dimension(10, 20)); jLabel1.setPreferredSize(new Dimension(380, 15)); jLabel1.setHorizontalAlignment(0); jLabel1.setText("Chat Message"); jTextField1.setPreferredSize(new Dimension(520, 21)); jTextField1.setRequestFocusEnabled(false); jTextField1.addKeyListener(new ChatDialog_jTextField1_keyAdapter(this)); getContentPane().add(jPanel1, "Center"); jPanel1.add(jPanel2, "North"); jPanel2.add(jLabel1, null); jPanel1.add(jPanel3, "Center"); jPanel3.add(jTextField1, null); } public void setVisible(boolean b) { jTextField1.setText(""); super.setVisible(b); } public void showDialog(String msgText) { System.out.println("set ChatDialog: " + msgText); jLabel1.setText(msgText); jLabel1.repaint(); // I added this; it didn't help System.out.println("get ChatDialog: " + jLabel1.getText()); super.setVisible(true); } void this_keyPressed(KeyEvent e) { int id = e.getKeyCode(); switch(id) { case 10: // '\n' System.exit(88); break; } } BorderLayout borderLayout1; BorderLayout borderLayout2; JLabel jLabel1; JPanel jPanel1; JPanel jPanel2; JPanel jPanel3; JTextField jTextField1; String text; WarWindow warWindow; }

    Read the article

  • Why doesn't JFreeCharts correctly connect the points in my xy-line graph?

    - by Javajava
    /Each letter A,T,G,C represents a direction for the plot to graph. Specifically, “A” means move right, “T” is move down, “C” is move up, and “G” is move left. When the applet reads A,T,C, it plots the graph correctly. However, when I plot G, the graph is messed up. When I input "ACACACA," the graph is like a rising staircase. When I input "gtgtgt," the graph should look like a staircase, but it looks like a lightning bolt instead/ /This is all one code... i don't know why it's all split up like this:/ import java.applet.Applet; import java.awt.*; import java.awt.event.*; import java.util.Scanner.*; import java.jfree.chart.*; import java.jfree.data.xy.*; import java.jfree.chart.plot.PlotOrientation; public class If_Graph extends Applet implements ActionListener{ Panel panel; TextArea textarea, outputArea; Button move; String thetext; Scanner reader = new Scanner(System.in); String thetext2; int size,p,q; int x,y; public void init(){ setSize(500,500); //set size of applet panel = new Panel(); add(panel); setVisible(true); textarea= new TextArea(10,20); add(textarea); move=new Button("Graph"); move.addActionListener(this); add(move); } public void actionPerformed(ActionEvent e) { XYSeries series = new XYSeries("DNA Walk"); x= 0; y = 0; series.add(x,y); if(e.getSource() == move) { thetext=textarea.getText(); //the text is the DNA bases pasted thetext=thetext.replaceAll(" ",""); //removes spaces thetext2 = ""; for(int i=0; i<thetext.length(); i++) { char a = thetext.charAt(i); switch (a) { case 'A': //moves right x+=1; y+=0; series.add(x,y); break; case 'a': x+=1;y+=0; series.add(x,y); break; case 'C': //moves up x+=0; y+=1; series.add(x,y); break; case 'c': x+=0; y+=1; System.out.println(x + "," + y); series.add(x,y); break; case 'G': //move left x-=1; y+=0; series.add(x,y); System.out.println("G is: "+ x +"," +y); break; case 'g': x-=1; y+=0; System.out.println("g is: " +x + "," + y); series.add(x,y); break; case 'T': //move down x+=0; y-=1; series.add(x,y); System.out.println("T is: "+ x +"," +y); break; case 't': x+=0; y-=1; series.add(x,y); System.out.println("t is: "+ x +"," +y); break; default: // series.add(0,0); break; } } XYDataset xyDataset = new XYSeriesCollection(series); JFreeChart chart = ChartFactory.createXYLineChart ("DNA Random Walk", "", "", xyDataset, PlotOrientation.VERTICAL, true, true, false); ChartFrame frame1=new ChartFrame("DNA Random Walk",chart); frame1.setVisible(true); frame1.setSize(300,300); outputArea.setText(thetext2); } } }

    Read the article

  • Java - Tile engine changing number in array not changing texture

    - by Corey
    I draw my map from a txt file. Would I have to write to the text file to notice the changes I made? Right now it changes the number in the array but the tile texture doesn't change. Do I have to do more than just change the number in the array? public class Tiles { public Image[] tiles = new Image[5]; public int[][] map = new int[64][64]; private Image grass, dirt, fence, mound; private SpriteSheet tileSheet; public int tileWidth = 32; public int tileHeight = 32; Player player = new Player(); public void init() throws IOException, SlickException { tileSheet = new SpriteSheet("assets/tiles.png", tileWidth, tileHeight); grass = tileSheet.getSprite(0, 0); dirt = tileSheet.getSprite(7, 7); fence = tileSheet.getSprite(2, 0); mound = tileSheet.getSprite(2, 6); tiles[0] = grass; tiles[1] = dirt; tiles[2] = fence; tiles[3] = mound; int x=0, y=0; BufferedReader in = new BufferedReader(new FileReader("assets/map.dat")); String line; while ((line = in.readLine()) != null) { String[] values = line.split(","); for (String str : values) { int str_int = Integer.parseInt(str); map[x][y]=str_int; //System.out.print(map[x][y] + " "); y=y+1; } //System.out.println(""); x=x+1; y = 0; } in.close(); } public void update(GameContainer gc) { } public void render(GameContainer gc) { for(int x = 0; x < map.length; x++) { for(int y = 0; y < map.length; y ++) { int textureIndex = map[y][x]; Image texture = tiles[textureIndex]; texture.draw(x*tileWidth,y*tileHeight); } } } Mouse picking public void checkDistance(GameContainer gc) { Input input = gc.getInput(); float mouseX = input.getMouseX(); float mouseY = input.getMouseY(); double mousetileX = Math.floor((double)mouseX/tiles.tileWidth); double mousetileY = Math.floor((double)mouseY/tiles.tileHeight); double playertileX = Math.floor(playerX/tiles.tileWidth); double playertileY = Math.floor(playerY/tiles.tileHeight); double lengthX = Math.abs((float)playertileX - mousetileX); double lengthY = Math.abs((float)playertileY - mousetileY); double distance = Math.sqrt((lengthX*lengthX)+(lengthY*lengthY)); if(input.isMousePressed(Input.MOUSE_LEFT_BUTTON) && distance < 4) { System.out.println("Clicked"); if(tiles.map[(int)mousetileX][(int)mousetileY] == 1) { tiles.map[(int)mousetileX][(int)mousetileY] = 0; } } System.out.println(tiles.map[(int)mousetileX][(int)mousetileY]); }

    Read the article

  • Problems with moving 2D circle/box collision detection

    - by dario3004
    This is my first game ever and I'm a newbie in computer physics. I've got this code for the collision detection and it works fine for BOTTOM and TOP collision.It miss the collision detection with the paddle's edge and angles so I've (roughly) tried to implement it. Main method that is called for bouncing, it checks if it bounce with wall, or with top (+ right/left side) or with bottom (+ right/left side): protected void handleBounces(float px, float py) { handleWallBounce(px, py); if(mBall.y < getHeight()/4){ if (handleRedFastBounce(mRed, px, py)) return; if (handleRightSideBounce(mRed,px,py)) return; if (handleLeftSideBounce(mRed,px,py)) return; } if(mBall.y > getHeight()/4 * 3){ if (handleBlueFastBounce(mBlue, px, py)) return; if (handleRightSideBounce(mBlue,px,py)) return; if (handleLeftSideBounce(mBlue,px,py)) return; } } This is the code for the BOTTOM bounce: protected boolean handleRedFastBounce(Paddle paddle, float px, float py) { if (mBall.goingUp() == false) return false; // next position tx = mBall.x; ty = mBall.y - mBall.getRadius(); // actual position ptx = px; pty = py - mBall.getRadius(); dyp = ty - paddle.getBottom(); xc = tx + (tx - ptx) * dyp / (ty - pty); if ((ty < paddle.getBottom() && pty > paddle.getBottom() && xc > paddle.getLeft() && xc < paddle.getRight())) { mBall.x = xc; mBall.y = paddle.getBottom() + mBall.getRadius(); mBall.bouncePaddle(paddle); playSound(mPaddleSFX); increaseDifficulty(); return true; } else return false; } As long as I understood it should be something like this: So I tried to make the "left side" and "right side" bounce method: protected boolean handleLeftSideBounce(Paddle paddle, float px, float py){ // next position tx = mBall.x + mBall.getRadius(); ty = mBall.y; // actual position ptx = px + mBall.getRadius(); pty = py; dyp = tx - paddle.getLeft(); yc = ty + (pty - ty) * dyp / (ptx - tx); if (ptx < paddle.getLeft() && tx > paddle.getLeft()){ System.out.println("left side bounce1"); System.out.println("yc: " + yc + "top: " + paddle.getTop() + " bottom: " + paddle.getBottom()); if (yc > paddle.getTop() && yc < paddle.getBottom()){ System.out.println("left side bounce2"); mBall.y = yc; mBall.x = paddle.getLeft() - mBall.getRadius(); mBall.bouncePaddle(paddle); playSound(mPaddleSFX); increaseDifficulty(); return true; } } return false; } I think I'm quite near to the solution but I'm having big troubles with the new "yc" formula. I tried so many versions of it but since I don't know the theory behind it I can't adjust for the Y axis. Since the Y axis is inverted I even tried this: yc = ty - (pty - ty) * dyp / (ptx - tx); I tried Googling it but I can't seem to find a solution for it. Also this method fails when ball touches the angle and I don't think is a nice way because it just test "one" point of the ball and probably there will be many cases in which the ball won't bounce.

    Read the article

  • Java and AppStore receipt verification

    - by user1672461
    I am trying to verify a payment receipt on server side. I am getting a {"status":21002, "exception":"java.lang.IllegalArgumentException"} in return Here is the code: private final static String _sandboxUriStr = "https://sandbox.itunes.apple.com/verifyReceipt"; public static void processPayment(final String receipt) throws SystemException { final BASE64Encoder encoder = new BASE64Encoder(); final String receiptData = encoder.encode(receipt.getBytes()); final String jsonData = "{\"receipt-data\" : \"" + receiptData + "\"}"; System.out.println(receipt); System.out.println(jsonData); try { final URL url = new URL(_productionUriStr); final HttpURLConnection conn = (HttpsURLConnection) url.openConnection(); conn.setRequestMethod("POST"); conn.setDoOutput(true); final OutputStreamWriter wr = new OutputStreamWriter(conn.getOutputStream()); wr.write(jsonData); wr.flush(); // Get the response final BufferedReader rd = new BufferedReader(new InputStreamReader(conn.getInputStream())); String line; while ((line = rd.readLine()) != null) { System.out.println(line); } wr.close(); rd.close(); } catch (IOException e) { throw new SystemException("Error when trying to send request to '%s', %s", _sandboxUriStr, e.getMessage()); } } My receipt looks like this: {\n\t"signature" = "[exactly_1320_characters]";\n\t"purchase-info" = "[exactly_868_characters]";\n\t"environment" = "Sandbox";\n\t"pod" = "100";\n\t"signing-status" = "0";\n} Receipt data with a BASE64 encoded receipt looks like this: Blockquote {"receipt-data" : "[Block_of_chars_76x40+44=3084_chars_total]"} Does someone have an Idea, or sample code how can I get from receipt string to reply JSON, mentioned here: [http://developer.apple.com/library/ios/#documentation/NetworkingInternet/Conceptual/StoreKitGuide/VerifyingStoreReceipts/VerifyingStoreReceipts.html#//apple_ref/doc/uid/TP40008267-CH104-SW1]? Thank you

    Read the article

  • Google Datastore w/ JDO: Access Times?

    - by Bosh
    I'm hitting what appears (to me) strange behavior when I pull data from the google datastore over JDO. In particular, the query executes quickly (say 100 ms), but finding the size of the resulting List< takes about one second! Indeed, whatever operation I try to perform on the resulting list takes about a second. Has anybody seen this behavior? Is it expected? Unusual? Any way around it? PersistenceManager pm = PMF.getPersistenceManager(); Query q = pm.newQuery("select from " + Person.class.getName() +" order by key limit 1000 "); System.out.println("getting all at " + System.currentTimeMillis()); mcs = (List<Med>) q.execute(); System.out.println("got all at " + System.currentTimeMillis()); int size = mcs.size(); System.out.println("size was " + size + " at " + System.currentTimeMillis()); getting all at 1271549139441 got all at 1271549139578 size was 850 at 1271549141071 -B

    Read the article

  • How to get Cookies using HttpClient

    - by Sunil
    Hello I am using HttpClient to get Cookies but I am unable find any cookies.My Code is given below public class LoginTab { private Cookie[] cookies; HttpClient httpClient; HttpState httpState; HashMap postData; public LoginTab() { httpClient = new HttpClient(); httpState = new HttpState(); httpClient.getHttpConnectionManager(). getParams().setConnectionTimeout(300000); httpClient.setState(httpState); // RFC 2101 cookie management spec is used per default // to parse, validate, format & match cookies httpClient.getParams().setCookiePolicy(CookiePolicy.RFC_2109); postData= new HashMap(); } public String getMethod(String url) { GetMethod getMethod = new GetMethod(url); String pageSoure=""; try{ httpClient.executeMethod(getMethod); pageSoure=getMethod.getResponseBodyAsString(); extractUsefulPostData(pageSoure, postData); getMethod.releaseConnection(); }catch(Exception ex) { ex.printStackTrace(); } return pageSoure; } public static void main(String[]arg) { LoginTab loginTab= new LoginTab(); System.out.println(loginTab.getMethod("http://tab.com.au/")); Cookie [] cookies=loginTab.httpState.getCookies(); System.out.println(cookies.length); for(int i=0;i<cookies.length;i++) System.out.println(cookies[i]); } } Please suggest me where is the mistake. Thanks in advance

    Read the article

  • How to get Cookies using HttpClient

    - by Sunil
    Hello I am using HttpClient to get Cookies but I am unable find any cookies.My Code is given below public class LoginTab { private Cookie[] cookies; HttpClient httpClient; HttpState httpState; HashMap postData; public LoginTab() { httpClient = new HttpClient(); httpState = new HttpState(); httpClient.getHttpConnectionManager(). getParams().setConnectionTimeout(300000); httpClient.setState(httpState); // RFC 2101 cookie management spec is used per default // to parse, validate, format & match cookies httpClient.getParams().setCookiePolicy(CookiePolicy.RFC_2109); postData= new HashMap(); } public String getMethod(String url) { GetMethod getMethod = new GetMethod(url); String pageSoure=""; try{ httpClient.executeMethod(getMethod); pageSoure=getMethod.getResponseBodyAsString(); extractUsefulPostData(pageSoure, postData); getMethod.releaseConnection(); }catch(Exception ex) { ex.printStackTrace(); } return pageSoure; } public static void main(String[]arg) { LoginTab loginTab= new LoginTab(); System.out.println(loginTab.getMethod("http://tab.com.au/")); Cookie [] cookies=loginTab.httpState.getCookies(); System.out.println(cookies.length); for(int i=0;i<cookies.length;i++) System.out.println(cookies[i]); } } Please suggest me where is the mistake. Thanks in advance

    Read the article

  • Why doesn't this method print its text? (java)

    - by David
    here's the method: public static int chooseStrat () { String[] strats = new String[1] ; strats[0] = "0 - Blob" ; int n ; boolean a = false ; while (a == false) ; { System.out.println ("Which strategy should the AI use?(#)") ; printArrayS (strats) ; n = getInt () ; System.out.println ("you selected "+n+"."+" are you sure you want the computer to use the "+ strats[n]+ " ?(Y/N)") ; String c = getIns () ; while ((((!( (c.equals ("y")) || (c.equals ("Y")) )) && (!( (c.equals ("n")) || (c.equals ("N")) ) ) ))) ; { System.out.println ("try again") ; c = getIns () ; } if ( (c.equals ("Y")) || (c.equals ("y")) ) a = true ; } return n ; } When i run this it never prints "Which strategy should the AI use?(#)" it just tries to get an entry from the keyboard. why does it do this?

    Read the article

  • problems with scrolling a java TextArea

    - by Jonathan
    All, I am running into an issue using JTextArea and JScrollPane. For some reason the scroll pane appears to not recognize the last line in the document, and will only scroll down to the line before it. The scroll bar does not even change to a state where I can slide it until the lines in the document are two greater than the number of lines the textArea shows (it should happen as soon as it is one greater). Has anyone run into this before? What would be a good solution (I want to avoid having to add an extra 'blank' line to the end of the document, which I would have to remove every time I add a new line)? Here is how I instantiate the TextArea and ScrollPane: JFrame frame = new JFrame("Java Chat Program"); frame.setDefaultCloseOperation(JFrame.EXIT_ON_CLOSE); Container pane = frame.getContentPane(); if (!(pane.getLayout() instanceof BorderLayout)) { System.err.println("Error: UI Container does not implement BorderLayout."); System.exit(-1); } textArea = new JTextArea(); textArea.setPreferredSize(new Dimension(500, 100)); textArea.setEditable(false); textArea.setLineWrap(true); textArea.setWrapStyleWord(true); JScrollPane scroller = new JScrollPane(textArea); scroller.setVerticalScrollBarPolicy(ScrollPaneConstants.VERTICAL_SCROLLBAR_ALWAYS); pane.add(scroller, BorderLayout.CENTER); Here is the method I use to add a new line to textArea: public void println(String a) { textArea.append(" "+a+"\n"); textArea.setCaretPosition(textArea.getDocument().getLength()); } Thanks for your help, Jonathan EDIT: Also, as a side note, with the current code I have to manually scroll down. I assumed that setCaretPosition(doc.getLength()) in the println(line) method would automatically set the page to the bottom after a line is entered... Should that be the case, or do I need to do something differently?

    Read the article

  • HttpServletRequest#login() not working in Java.

    - by Nitesh Panchal
    Hello, j_security_check just doesn't seem enough for me to perform login process. So, instead of submitting the form to j_security_check i created my own servlet and in that i am programmatically trying to do login. This works but i am not able to redirect to my restricted resource. Can anybody tell me what can be the problem? This is processRequest method of my servlet :- protected void processRequest(HttpServletRequest request, HttpServletResponse response) throws ServletException, IOException { response.setContentType("text/html;charset=UTF-8"); PrintWriter out = response.getWriter(); try { String strUsername = request.getParameter("txtusername"); String strPassword = request.getParameter("txtpassword"); if(strUsername == null || strPassword == null || strUsername.equals("") || strPassword.equals("")) throw new Exception("Username and/or password missing."); request.login(strUsername, strPassword); System.out.println("Login succeeded!!"); if(request.isUserInRole(ROLES.ADMIN.getValue())){//enum System.out.println("Found in Admin Role"); response.sendRedirect("/Admin/home.jsf"); } else if (request.isUserInRole(ROLES.GENERAL.getValue())) response.sendRedirect("/Common/index.jsf"); else //guard throw new Exception("No role for user " + request.getRemoteUser()); }catch(Exception ex){ //patch work why there needs to be blogger here? System.out.println("Invalid username and/or password!!"); response.sendRedirect("/Common/index.jsf"); }finally { out.close(); } } Everything works fine and i can even see message "Found in Admin Role" but problem is even after authenticating i am not able to redirect my request to some other page. Please help geeks.

    Read the article

  • String assembly by StringBuilder vs StringWriter and PrintWriter

    - by CPerkins
    I recently encountered an idiom I haven't seen before: string assembly by StringWriter and PrintWriter. I mean, I know how to use them, but I've always used StringBuilder. Is there a concrete reason for preferring one over the other? The StringBuilder method seems much more natural to me, but is it just style? I've looked at several questions here (including this one which comes closest: http://stackoverflow.com/questions/602279/stringwriter-or-stringbuilder ), but none in which the answers actually address the question of whether there's a reason to prefer one over the other for simple string assembly. This is the idiom I've seen and used many many times: string assembly by StringBuilder: public static String newline = System.getProperty("line.separator"); public String viaStringBuilder () { StringBuilder builder = new StringBuilder(); builder.append("first thing" + newline); builder.append("second thing" + newline); // ... several things builder.append("last thing" + newline); return builder.toString(); } And this is the new idiom: string assembly by StringWriter and PrintWriter: public String viaWriters() { StringWriter stringWriter = new StringWriter(); PrintWriter printWriter = new PrintWriter(stringWriter); printWriter.println("first thing"); printWriter.println("second thing"); // ... several things printWriter.println("last thing"); printWriter.flush(); printWriter.close(); return stringWriter.toString(); }

    Read the article

  • Asynchronuos callback saves value but prints FAILED

    - by sprasad12
    Hi, I am using nested Asynchronous callbacks to save my front-end data to the back-end database. The data is being save into the tables the way i want them to, but it is printing that it failed. Here is the code: oksave.addClickHandler(new ClickHandler(){ public void onClick(ClickEvent event) { if(erasync == null) erasync = GWT.create(EntityRelationService.class); AsyncCallback<Void> callback = new AsyncCallback<Void>(){ public void onFailure(Throwable caught) { String msg = caught.getLocalizedMessage(); if (caught instanceof NotFoundException) { msg = ((NotFoundException) caught).getType() + ((NotFoundException) caught).getMessage(); } System.out.println("Failed" + msg); } public void onSuccess(Void result) { Label success = new Label("Name : " + pname.getText() + " was successfully saved"); Button close = new Button("close"); VerticalPanel sp = new VerticalPanel(); d1 = new DialogBox(); sp.add(success); sp.add(close); close.addClickHandler(new ClickHandler(){ @Override public void onClick(ClickEvent event) { if(erasync == null) erasync = GWT.create(EntityRelationService.class); AsyncCallback<Void> callbackOthers = new AsyncCallback<Void>(){ @Override public void onFailure(Throwable caught) { String msg = caught.getLocalizedMessage(); if (caught instanceof NotFoundException) { msg = ((NotFoundException) caught).getType() + ((NotFoundException) caught).getMessage(); } System.out.println("Failed" + msg); } @Override public void onSuccess(Void result) { System.out.println("Success"); } }; erasync.setEntityType(name, top, left, pname, callbackOthers); }); }; erasync.setProject(name, callback); }); Here it prints successful for the first callback, but for the nested one it says failed though it saves the value. Am i missing something? Any input will be of great help. Thank you.

    Read the article

< Previous Page | 23 24 25 26 27 28 29 30 31 32 33 34  | Next Page >