Search Results

Search found 47210 results on 1889 pages for 'text input'.

facebook twitter digg google delicious technorati stumbleupon myspace wordpress linkedin gmail igoogle windows live tumblr viadeo yahoo buzz yahoo mail yahoo bookmarks favorites email print

Page 27/1889 | < Previous Page | 23 24 25 26 27 28 29 30 31 32 33 34  | Next Page >

  • predict location of single-line text from a UITextView

    - by William Jockusch
    Is this possible? Specifically, I have a UITextView, and the text is short enough that it will fit on a single line. I want to predict where it will appear, so that (for example) if I wanted to, I could set up a UILabel that rendered the text in exactly the same location. Once I get that figured out, what I really want to do is pick contentInset and/or contentOffset so that the text of the UITextView and the left-justified UILabel will render in the same location. But I figure the above will let me do that. EDIT: In response to a comment, the fundamental problem I am trying to get around is that UITextField does not let you set the location of the cursor. It appears a lot of people have tried to get around this without success. I need to be able to move the cursor -- inserting/deleting text there is not enough. Control cursor position in UITextField Insert string at cursor position of UITextField Moving the cursor to the beginning of UITextField iOS -- dealing with the inability to set the cursor position in a UITextField

    Read the article

  • how can i return a string with jQuery from an input and write it to a different html element

    - by user1865231
    I am using this: var title = $('#input').val(); $('#titleset').click(function (){ $('#title').html('<h1>' + title + '</h1>'); alert(title); }); to try to get the value of an input box and then when the user clicks the button #titleset, overwrite the value from the input box to the <h1> element that is already there. i have been able to get the click to overwrite the <h1> element, but there is nothing in the title variable to write into the element. so how could i return a string from the #input id and write it to the #title id which is an <h1> element here is my html <h1 id="title">This Title Changes To What You Want It To Be</h1> <ul class="menu1"> <li>menu one <ul> <li id='inputbox'><input type ="text" id="input"/></li> <li id="titleset1"><input type="button" value="set title" id="titleset"/></li> </ul> </li> </ul>

    Read the article

  • Replacement Text Syntax for JavaScript’s String.replace()

    - by Jan Goyvaerts
    A RegexBuddy user told me that he couldn’t easily find a detailed explanation of the replacement text syntax supported by the String.replace() function in JavaScript. I had to admin that my own web page about JavaScript’s regular expression support was also lacking. I’ve now added a new Replacement Syntax section that has all the details. I’ll summarize it here: $1: Text matched by the first capturing group or the literal text $1 if the regex has no capturing groups. $99: Text matched by the 99th capturing group if the regex has 99 or more groups. Text matched by the 9th capturing group followed by a literal 9 if the regex has 9 or more but less than 99 groups. The literal text $99 if the regex has fewer than 9 groups. $+: Text matched by the highest-numbered capturing group. Replaced with nothing if the highest-numbered group didn’t participate in the match. $&: Text matched by the entire regex. You cannot use $0 for this. $` (backtick): Text to the left of the regex match. $' (single quote): Text to the right of the regex match. $_: The entire subject string.

    Read the article

  • WYSIWYG editor for structured text (suitable for SVN versioning)

    - by chris_l
    I'm looking for an open source cross platform WYSIWYG editor that I can use to write documentation. I'm not looking for a web based solution - i.e. it should work without a web server, and I want to save my files directly to disk. The result could be any structured format, like Wiki markup, ReStructuredText, DocBook, or a small subset of HTML, ... But it's important, that Subversion diff can be used to see differences between the versions easily (this wouldn't work with .odt or .rtf files for example) I'm currently thinking about using Open Office, and saving the files as HTML, but is there a better solution?

    Read the article

  • Good text editors or viewers for large log files

    - by Kristopher Johnson
    Log files and other textual data files are often tens or hundreds of megabytes in size, and some editors choke when you try to open something so large. What are some good applications for viewing large files? Bonus points for apps that can open compressed files, search for things with regular expressions, parse output lines, etc.

    Read the article

  • Looking for Linux text editor

    - by Daniel
    I'm looking for VIM replacement. My key points are: Extensible in sane language (such as Python, Ruby, or even Lua, after vimscript everything will do). Also GUI part should be extensible too, so no SublimeText2. GUI. Preferrably GTK+. Lightweight. I don't understand IDEs like Eclipse/NetBeans consuming up to 1G of RAM. File browser panel. Splits, tabs and windows. There should be ability to split views tabs infinite number of times (or while they fit to screen). VCS support (optional: especially Git) Snippets & autocompletion (not mandatory, but I would very love to have those) Any ideas?

    Read the article

  • Modify Sublime Text 2 whitespace representation?

    - by Mike Grace
    Is there a way to modify the whitespace representation characters so I can change it from dots and dashes to something else? Because I currently have whitespace characters being drawn always, it looks like this. I don't need it turned off, just interested in changing how it's represented. I like how TextMate shows invisible characters but I would be ok with just being able to change the spaces to show a blank space instead of a dot.

    Read the article

  • Recovering text files in terminal using grep on Mac OS X Snow Leopard

    - by littlejim84
    I foolishly removed some source code from my Mac OS X Snow Leopard machine with rm -rf when doing something with buildout. I want to try and recover these files again. I haven't touched the system since to try and seek an answer. I found this article and it seems like the grep method is the way to go, but when running it on my machine I'm getting 'Resource busy' when trying to run it on the disk. I'm using this command: sudo grep -a -B1000 -A1000 'video_output' /dev/disk0s2 > file.txt Where 'dev/disk0s2' is what came up when I ran df. I get this when running: grep: /dev/disk0s2: Resource busy I'm not an expert with this stuff, I'm trying my best. Please can anyone help me further? I'm on the verge of losing two days of source code work! Thank you

    Read the article

  • Indexing text file content with command line query

    - by Drew Carlton
    I take daily notes in a plaintext file labeled with date in the YYYYMMDD format. These files are no more than 100 lines long, and are written in a blog style format. I'd like to be able search these files as if they were blog posts indexed by google, with some phrase query returning the most relevant/recent date filenames, with a snippet containing the relevant part. Ideally it would be something like this: #searchindex "laptop no sound" returns: 20100909.txt: ... laptop sound isn't working... 20100101.txt ... sound is too loud... debating what laptop to buy... and so on and so forth. I'm working on a linux platform (Debian with GNOME). I've looked at beagle and tracker, but they just seem complete overkill for what I want.

    Read the article

  • Textwrangler (OS X) -- Simple Text Macro Help Needed

    - by bobber205
    I often, when parsing log/error files, need to replace < and < and > with in order to be able to efficiently understand what's going on in the files. I know TextWrangler has a macro ability but I can't figure out a efficient way to do this. Since I have to do it so often I'd love to just have a simple keybinding or menu item to do this simple replace/find all for me. Anyone know how to do this? ^_^

    Read the article

  • Rich Text Editor (YUI Simple Text Editor used) not sending data to next page

    - by Aman Chhabra
    I am using a simple text editor from YUI, but when I click submit the code in the textarea/editor is not sent to the next page. I want to be able to receive it on the subsequent page and then store it in a DB(MySql). I have wasted lot of time already. Please help. HTML FILE: <html> <head> <script type="text/javascript" src="http://yui.yahooapis.com/combo?2.9.0/build/yahoo-dom-event/yahoo-dom-event.js&2.9.0/build/container/container_core-min.js&2.9.0/build/element/element-min.js&2.9.0/build/editor/simpleeditor-min.js"></script> <link rel="stylesheet" type="text/css" href="http://yui.yahooapis.com/2.9.0/build/editor/assets/skins/sam/simpleeditor.css" /> <link rel="stylesheet" type="text/css" href="http://yui.yahooapis.com/2.8.2r1/build/assets/skins/sam/skin.css"> <!-- Utility Dependencies --> <script src="http://yui.yahooapis.com/2.8.2r1/build/yahoo-dom-event/yahoo-dom-event.js"></script> <script src="http://yui.yahooapis.com/2.8.2r1/build/element/element-min.js"></script> <!-- Needed for Menus, Buttons and Overlays used in the Toolbar --> <script src="http://yui.yahooapis.com/2.8.2r1/build/container/container_core-min.js"></script> <script src="http://yui.yahooapis.com/2.8.2r1/build/menu/menu-min.js"></script> <script src="http://yui.yahooapis.com/2.8.2r1/build/button/button-min.js"></script> <!-- Source file for Rich Text Editor--> <script src="http://yui.yahooapis.com/2.8.2r1/build/editor/editor-min.js"></script> <script> YAHOO.util.Event.on('submit', 'click', function() { myEditor.saveHTML(); var html = myEditor.get('element').value; }); (function() { var Dom = YAHOO.util.Dom, Event = YAHOO.util.Event; var myConfig = { height: '200px', width: '900px', dompath: true, }; myEditor = new YAHOO.widget.SimpleEditor('msgpost', myConfig); myEditor.render(); })(); </script> </head> <body class="yui-skin-sam"> <form action="submit.php" method="post"> <textarea name="msgpost" id="msgpost" cols="50" rows="10"></textarea> <input type="submit" value="Submit" onsubmit="return myDoSubmit()"/> </form> </body> </html>

    Read the article

  • Text Decoding Problem

    - by Jason Miesionczek
    So given this input string: =?ISO-8859-1?Q?TEST=2C_This_Is_A_Test_of_Some_Encoding=AE?= And this function: private string DecodeSubject(string input) { StringBuilder sb = new StringBuilder(); MatchCollection matches = Regex.Matches(inputText.Text, @"=\?(?<encoding>[\S]+)\?.\?(?<data>[\S]+[=]*)\?="); foreach (Match m in matches) { string encoding = m.Groups["encoding"].Value; string data = m.Groups["data"].Value; Encoding enc = Encoding.GetEncoding(encoding.ToLower()); if (enc == Encoding.UTF8) { byte[] d = Convert.FromBase64String(data); sb.Append(Encoding.ASCII.GetString(d)); } else { byte[] bytes = Encoding.Default.GetBytes(data); string decoded = enc.GetString(bytes); sb.Append(decoded); } } return sb.ToString(); } The result is the same as the data extracted from the input string. What am i doing wrong that this text is not getting decoded properly?

    Read the article

  • [SOLVED] flash 10, as3 - save text of textarea and reuse it to replace text in textarea

    - by user427969
    hi everyone Is it possible to save text of textarea (flash 10, as3, cs5) in some variable or so and with its textformat (more than one color) and then reuse it to replace text in textarea? I tried saving htmlText of textarea but the problem is when i replace it in textarea tags causes problem. There will always be another extra line. If anyone wants to view p tags problem try following. Just click on text and then move your down arrow key, cursor will go to next line. import fl.controls.TextArea; var txtHTML:TextArea = new TextArea(); txtHTML.move(0,0); var default_format:TextFormat = new TextFormat(); default_format.font = "Arial"; default_format.bold = false; default_format.align = "center"; default_format.color = 0xFFFF00; default_format.size = 14; var field:TextField = txtHTML.textField; field.defaultTextFormat = default_format; field.setTextFormat(default_format); field.alwaysShowSelection = true; field.background = true; field.type = 'input'; field.multiline = true; field.backgroundColor = 0x777777; field.embedFonts = true; txtHTML.htmlText = '<P ALIGN="CENTER"><FONT FACE="_sans" SIZE="14" COLOR="#FFFF00" LETTERSPACING="0" KERNING="0">ASDF</FONT></P>'; field.x = 0; field.y = 0; field.width = 400; field.height = 200; field.text = ""; addChild(txtHTML); Is there a way to do this? Thanks alot for any help. Regards

    Read the article

  • Rails3 renders a js.erb template with a text/html content-type instead of text/javascript

    - by Yannis
    Hi, I'm building a new app with 3.0.0.beta3. I simply try to render a js.erb template to an Ajax request for the following action (in publications_controller.rb): def get_pubmed_data entry = Bio::PubMed.query(params[:pmid])# searches PubMed and get entry @publication = Bio::MEDLINE.new(entry) # creates Bio::MEDLINE object from entry text flash[:warning] = "No publication found."if @publication.title.blank? and @publication.authors.blank? and @publication.journal.blank? respond_to do |format| format.js end end Currently, my get_pubmed_data.js.erb template is simply alert('<%= @publication.title %>') The server is responding with the following alert('Evidence for a herpes simplex virus-specific factor controlling the transcription of deoxypyrimidine kinase.') which is perfectly fine except that nothing happen in the browser, probably because the content-type of the response is 'text/html' instead of 'text/javascript' as shown by the response header partially reproduced here: Status 200 Keep-Alive timeout=5, max=100 Connection Keep-Alive Transfer-Encoding chunked Content-Type text/html; charset=utf-8 Is this a bug or am I missing something? Thanks for your help!

    Read the article

  • How to bring an application from Sublime Text to a web IDE for sharing?

    - by Kyle Pennell
    I generally work on my projects locally in Sublime Text but sometimes need to share them with others using things like Jsfiddle, codepen, or plunker. This is usually so I can get unstuck. Is there an easier way to share code that doesn't involve purely copy pasting and the hassle of getting all the dependencies right in a new environment? It's taking me hours to get some of my angular apps working in plunker and I'm wondering if there's a better way.

    Read the article

  • What options are out there for an embeddable WYSIWIG text editor?

    - by Evan Plaice
    I'm thinking something along the lines of TinyMCE Please include a list of features. Examples include: supports text formatting supports links supports images syntax types (markdown/wiki/etc) licensing and/or pricing customizibility plugin support browser compatibility Note: Please limit the answers to one editor per answer to preserve cleanliness Update: Forgot to add browser compatibility to the list

    Read the article

  • Webcam microphone input in Gnome/pulseaudio

    - by sdaau
    Just got a "Trust" webcam, which gets recognized on my Ubuntu Lucid. It has a built in microphone - which also gets recognized - however, I cannot really get it to act as the system microphone input? Here are some screenshots of what is shown by gnome-volume-control: The default window shows Trust webcam - which has two profiles: "Analog Mono Input" and "Off" - of course, I have it on "Analog Mono Input": However, on the "Input" tab - there is no matching "device for sound input" - neither a matching connector: Then I installed pavucontrol - but that doesn't show that much more; it tells first that gnome-volume-control reads from "Internal Audio Analog Stereo": Then in "Input devices" tab, there is again nothing resembling the mic input from webcam: Finally, under "Configuration" tab, the "Trust" webcam shows, but even if its profile is on "Analog Mono Input", nothing much happens:   So, does anyone know how I could get this webcam microphone to be recognized as the system input? Many thanks in advance for any answers, Cheers!

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • How can you track mouse input using the fewest libraries in c.

    - by TimE
    I'm not sure where to look to find this information, but I'd like to know how to get mouse input (or any hid input) using the fewest non standard libraries in c. Basically, is there an stdio equivalent for mouse (and other input) input in c? Or is there a library that is minimal and cross compatible on multiple platforms. Just being able to print mouse coordinates to a terminal window would be enough.

    Read the article

  • Python SQLite FTS3 alternatives?

    - by Mike Cialowicz
    Are there any good alternatives to SQLite + FTS3 for python? I'm iterating over a series of text documents, and would like to categorize them according to some text queries. For example, I might want to know if a document mentions the words "rating" or "upgraded" within three words of "buy." The FTS3 syntax for this query is the following: (rating OR upgraded) NEAR/3 buy That's all well and good, but if I use FTS3, this operation seems rather expensive. The process goes something like this: # create an SQLite3 db in memory conn = sqlite3.connect(':memory:') c = conn.cursor() c.execute('CREATE VIRTUAL TABLE fts USING FTS3(content TEXT)') conn.commit() Then, for each document, do something like this: #insert the document text into the fts table, so I can run a query c.execute('insert into fts(content) values (?)', content) conn.commit() # execute my FTS query here, look at the results, etc # remove the document text from the fts table before working on the next document c.execute('delete from fts') conn.commit() This seems rather expensive to me. The other problem I have with SQLite FTS is that it doesn't appear to work with Python 2.5.4. The 'CREATE VIRTUAL TABLE' syntax is unrecognized. This means that I'd have to upgrade to Python 2.6, which means re-testing numerous existing scripts and programs to make sure they work under 2.6. Is there a better way? Perhaps a different library? Something faster? Thank you.

    Read the article

  • Linux standard input issue

    - by George2
    Hello everyone, I am new to Linux. And I am using Red Hat Enterprise Version 5. There is a ruby program which use standard input as its input (e.g. the Ruby program process input from standard input). I think standard input should be keyboard, correct? So, I think other kinds of input (non-standard input) should not work (i.e. the ruby program should not be able to read input from such non-standard input), but actually I have tried using pipe works, I am so confused because I think pipe should be some other kinds of input -- other than standard input, why it could work? i.e. put text "123" in abc.txt with pipe, could achieve the same result as using keyboard as input to type "123" for the ruby program. Here is the sample which works and makes me confused, cat abc.txt | ~/test/rubysrc/foo.rb thanks in advance, George

    Read the article

facebook twitter digg google delicious technorati stumbleupon myspace wordpress linkedin gmail igoogle windows live tumblr viadeo yahoo buzz yahoo mail yahoo bookmarks favorites email print

< Previous Page | 23 24 25 26 27 28 29 30 31 32 33 34  | Next Page >