Search Results

Search found 40168 results on 1607 pages for 'text processing'.

Page 27/1607 | < Previous Page | 23 24 25 26 27 28 29 30 31 32 33 34  | Next Page >

  • Appcelerator Titanium - auto height table views break with shortish text

    - by ceejayoz
    I posted this on the Appcelerator Titanium dev Q&A site, but maybe someone here has had this issue... KitchenSink 1.1 illustrates this issue. In table_view_api_auto_height.js, changing row: addRow(0,'This is some long text. This is some long text. This is some long text. This is some long text. This is some long text. This is some long text. This is some long text. This is some long text. This is some long text. This is some long text. This is some long text. This is some long text. This is some long text. This is some long text. This is some long text. This is some long text. This is some long text. This is some long text.'); to something like: addRow(0,'This is some long text. This is some long text.'); results in incorrect left padding on the row. See screenshot:

    Read the article

  • apt-get is broken

    - by Amol Shinde
    I Cannot install any package in the server, As I am newbie in Server. In Morning I found that some, I am not able to install any package from command line in the server,Now every package is now manually downloaded packages and then installed in the server. Can any one Please tell me what is the issue and how could it be resolved. OS:- Ubuntu 10.04.4 LTS \n \l (64 Bit) Below is the error: iam@ubuntu$ sudo apt-get install pidgin Reading package lists... Done Building dependency tree Reading state information... Done pidgin is already the newest version. 0 upgraded, 0 newly installed, 0 to remove and 102 not upgraded. 32 not fully installed or removed. After this operation, 0B of additional disk space will be used. Traceback (most recent call last): File "/usr/bin/apt-listchanges", line 33, in <module> from ALChacks import * File "/usr/share/apt-listchanges/ALChacks.py", line 32, in <module> sys.stderr.write(_("Can't set locale; make sure $LC_* and $LANG are correct!\n")) NameError: name '_' is not defined perl: warning: Setting locale failed. perl: warning: Please check that your locale settings: LANGUAGE = (unset), LC_ALL = (unset), LC_CTYPE = "UTF-8", LANG = "en_IN" are supported and installed on your system. perl: warning: Falling back to the standard locale ("C"). locale: Cannot set LC_CTYPE to default locale: No such file or directory locale: Cannot set LC_ALL to default locale: No such file or directory Setting up shared-mime-info (0.71-1ubuntu2) ... /var/lib/dpkg/info/shared-mime-info.postinst: line 13: 21935 Segmentation fault update-mime-database.real /usr/share/mime dpkg: error processing shared-mime-info (--configure): subprocess installed post-installation script returned error exit status 139 dpkg: dependency problems prevent configuration of libgtk2.0-0: libgtk2.0-0 depends on shared-mime-info; however: Package shared-mime-info is not configured yet. dpkg: error processing libgtk2.0-0 (--configure): dependency problems - leaving unconfigured dpkg: dependency problems prevent configuration of chromium-browser: chromium-browser depends on libgtk2.0-0 (>= 2.20.0); however: Package libgtk2.0-0 is not configured yet. dpkg: error processing chromium-browser (--configure): dependency problems - leaving unconfigured dpkg: dependency problems prevent configuration of chromium-codecs-ffmpeg: chromium-codecs-ffmpeg depends on chromium-browser (>= 4.0.203.0~); however: Package chromium-browser is not configured yet. dpkg: error processing chromium-codecs-ffmpeg (--configure): dependency problems - leaving unconfigured dpkg: dependency problems prevent configuration of chromium-browser-l10n: chromium-browser-l10n depends on chromium-browser (= 18.0.1025.151~r130497-0ubuntu0.10.04.No apport report written because the error message indicates its a followup error from a previous failure. No apport report written because the error message indicates its a followup error from a previous failure. No apport report written because MaxReports is reached already No apport report written because MaxReports is reached already No apport report written because MaxReports is reached already No apport report written because MaxReports is reached already No apport report written because MaxReports is reached already No apport report written because MaxReports is reached already No apport report written because MaxReports is reached already No apport report written because MaxReports is reached already No apport report written because MaxReports is reached already No apport report written because MaxReports is reached already No apport report written because MaxReports is reached already 1); however: Package chromium-browser is not configured yet. dpkg: error processing chromium-browser-l10n (--configure): dependency problems - leaving unconfigured dpkg: dependency problems prevent configuration of libevdocument2: libevdocument2 depends on libgtk2.0-0 (>= 2.14.0); however: Package libgtk2.0-0 is not configured yet. dpkg: error processing libevdocument2 (--configure): dependency problems - leaving unconfigured dpkg: dependency problems prevent configuration of libevview2: libevview2 depends on libevdocument2 (>= 2.29.5); however: Package libevdocument2 is not configured yet. libevview2 depends on libgtk2.0-0 (>= 2.20.0); however: Package libgtk2.0-0 is not configured yet. dpkg: error processing libevview2 (--configure): dependency problems - leaving unconfigured dpkg: dependency problems prevent configuration of evince: evince depends on libevdocument2 (>= 2.29.5); however: Package libevdocument2 is not configured yet. evince depends on libevview2 (>= 2.29.No apport report written because MaxReports is reached already No apport report written because MaxReports is reached already No apport report written because MaxReports is reached already No apport report written because MaxReports is reached already No apport report written because MaxReports is reached already No apport report written because MaxReports is reached already No apport report written because MaxReports is reached already No apport report written because MaxReports is reached already 5); however: Package libevview2 is not configured yet. evince depends on libgtk2.0-0 (>= 2.16.0); however: Package libgtk2.0-0 is not configured yet. evince depends on shared-mime-info; however: Package shared-mime-info is not configured yet. dpkg: error processing evince (--configure): dependency problems - leaving unconfigured dpkg: dependency problems prevent configuration of firefox: firefox depends on libgtk2.0-0 (>= 2.20.0); however: Package libgtk2.0-0 is not configured yet. dpkg: error processing firefox (--configure): dependency problems - leaving unconfigured dpkg: dependency problems prevent configuration of gcalctool: gcalctool depends on libgtk2.0-0 (>= 2.18.0); however: Package libgtk2.0-0 is not configured yet. dpkg: error processing gcalctool (--configure): dependency problems - leaving unconfigured dpkg: dependency problems prevent configuration of libgdict-1.0-6: libgdict-1.0-6 depends on libgtk2.0-0 (>= 2.18.0); however: Package libgtk2.0-0 is not configured yet. dpkg: error processing libgdict-1.0-6 (--configure): dependency problems - leaving unconfigured dpkg: dependency problems prevent configuration of gnome-utils: gnome-utils depends on libgdict-1.0-6 (>= 2.23.90); however: Package libgdict-1.0-6 is not configured yet. gnome-utils depends on libgtk2.0-0 (>= 2.18.0); however: Package libgtk2.0-0 is not configured yet. dpkg: error processing gnome-utils (--configure): dependency problems - leaving unconfigured dpkg: dependency problems prevent configuration of gtk2-engines-pixbuf: gtk2-engines-pixbuf depends on gtk2.0-binver-2.10.0; however: Package gtk2.0-binver-2.10.0 is not installed. Package libgtk2.0-0 which provides gtk2.0-binver-2.10.0 is not configured yet. gtk2-engines-pixbuf depends on libgtk2.0-0 (= 2.20.1-0ubuntu2.1); however: Package libgtk2.0-0 is not configured yet. dpkg: error processing gtk2-engines-pixbuf (--configure): dependency problems - leaving unconfigured dpkg: dependency problems prevent configuration of libedataserverui1.2-8: libedataserverui1.2-8 depends on libgtk2.0-0 (>= 2.14.0); however: Package libgtk2.0-0 is not configured yet. dpkg: error processing libedataserverui1.2-8 (--configure): dependency problems - leaving unconfigured dpkg: dependency problems prevent configuration of libgail18: libgail18 depends on libgtk2.0-0 (= 2.20.1-0ubuntu2.1); however: Package libgtk2.0-0 is not configured yet. dpkg: error processing libgail18 (--configure): dependency problems - leaving unconfigured dpkg: dependency problems prevent configuration of libgtk2.0-bin: libgtk2.0-bin depends on libgtk2.0-0 (>= 2.20.1-0ubuntu2.1); however: Package libgtk2.0-0 is not configured yet. dpkg: error processing libgtk2.0-bin (--configure): dependency problems - leaving unconfigured dpkg: dependency problems prevent configuration of libgtk2.0-dev: libgtk2.0-dev depends on libgtk2.0-0 (= 2.20.1-0ubuntu2.1); however: Package libgtk2.0-0 is not configured yet. dpkg: error processing libgtk2.0-dev (--configure): dependency problems - leaving unconfigured dpkg: dependency problems prevent configuration of libnotify-dev: libnotify-dev depends on libgtk2.0-dev (>= 2.10); however: Package libgtk2.0-dev is not configured yet. dpkg: error processing libnotify-dev (--configure): dependency problems - leaving unconfigured dpkg: dependency problems prevent configuration of network-manager-gnome: network-manager-gnome depends on libgtk2.0-0 (>= 2.16.0); however: Package libgtk2.0-0 is not configured yet. dpkg: error processing network-manager-gnome (--configure): dependency problems - leaving unconfigured dpkg: dependency problems prevent configuration of openoffice.org-core: openoffice.org-core depends on libgtk2.0-0 (>= 2.10); however: Package libgtk2.0-0 is not configured yet. dpkg: error processing openoffice.org-core (--configure): dependency problems - leaving unconfigured dpkg: dependency problems prevent configuration of openoffice.org-draw: openoffice.org-draw depends on openoffice.org-core (= 1:3.2.0-7ubuntu4.4); however: Package openoffice.org-core is not configured yet. dpkg: error processing openoffice.org-draw (--configure): dependency problems - leaving unconfigured dpkg: dependency problems prevent configuration of openoffice.org-impress: openoffice.org-impress depends on openoffice.org-core (= 1:3.2.0-7ubuntu4.4); however: Package openoffice.org-core is not configured yet. openoffice.org-impress depends on openoffice.org-draw (= 1:3.2.0-7ubuntu4.4); however: Package openoffice.org-draw is not configured yet. dpkg: error processing openoffice.org-impress (--configure): dependency problems - leaving unconfigured dpkg: dependency problems prevent configuration of pidgin: pidgin depends on libgtk2.0-0 (>= 2.18.0); however: Package libgtk2.0-0 is not configured yet. dpkg: error processing pidgin (--configure): dependency problems - leaving unconfigured No apport report written because MaxReports is reached already Setting up update-manager (1:0.134.12.1) ... locale: Cannot set LC_CTYPE to default locale: No such file or directory dpkg: error processing update-manager (--configure): subprocess installed post-installation script returned error exit status 245 No apport report written because MaxReports is reached already dpkg: dependency problems prevent configuration of update-notifier: update-notifier depends on libgtk2.0-0 (>= 2.14.0); however: Package libgtk2.0-0 is not configured yet. update-notifier depends on update-manager; however: Package update-manager is not configured yet. dpkg: error processing update-notifier (--configure): dependency problems - leaving unconfigured No apport report written because MaxReports is reached already dpkg: dependency problems prevent configuration of xulrunner-1.9.2: xulrunner-1.9.2 depends on libgtk2.0-0 (>= 2.18.0); however: Package libgtk2.0-0 is not configured yet. dpkg: error processing xulrunner-1.9.2 (--configure): dependency problems - leaving unconfigured dpkg: dependency problems prevent configuration of xulrunner-1.9.2-dev: xulrunner-1.9.2-dev depends on xulrunner-1.9.2 (= 1.9.2.28+build1+nobinonly-0ubuntu0.10.04.1); however: Package xulrunner-1.9.2 is not configured yet. xulrunner-1.9.2-dev depends on libnotify-dev; however: Package libnotify-dev is not configured yet. dpkg: error processing xulrunner-1.9.2-dev (--configure): dependency problems - leaving unconfigured No apport report written because MaxReports is reached already No apport report written because MaxReports is reached already dpkg: dependency problems prevent configuration of icedtea6-plugin: icedtea6-plugin depends on xulrunner-1.9.2; however: Package xulrunner-1.9.2 is not configured yet. icedtea6-plugin depends on libgtk2.0-0 (>= 2.8.0); however: Package libgtk2.0-0 is not configured yet. dpkg: error processing icedtea6-plugin (--configure): dependency problems - leaving unconfigured Setting up libgweather-common (2.30.0-0ubuntu1.1) ... No apport report written because MaxReports is reached already locale: Cannot set LC_CTYPE to default locale: No such file or directory dpkg: error processing libgweather-common (--configure): subprocess installed post-installation script returned error exit status 245 No apport report written because MaxReports is reached already dpkg: dependency problems prevent configuration of libgweather1: libgweather1 depends on libgtk2.0-0 (>= 2.11.0); however: Package libgtk2.0-0 is not configured yet. libgweather1 depends on libgweather-common (>= 2.24.0); however: Package libgweather-common is not configured yet. dpkg: error processing libgweather1 (--configure): dependency problems - leaving unconfigured dpkg: dependency problems prevent configuration of openoffice.org-style-galaxy: openoffice.org-style-galaxy depends on openoffice.org-core (>= 1:3.2.0~beta); however: Package openoffice.org-core is not configured yet. No apport report written because MaxReports is reached already dpkg: error processing openoffice.org-style-galaxy (--configure): dependency problems - leaving unconfigured dpkg: dependency problems prevent configuration of openoffice.org-common: openoffice.org-common depends on openoffice.org-style-default | openoffice.org-style; however: Package openoffice.org-style-default is not installed. Package openoffice.org-style-galaxy which provides openoffice.org-style-default is not configured yet. Package openoffice.org-style is not installed. Package openoffice.org-style-galaxy which provides openoffice.org-style is not configured yet. No apport report written because MaxReports is reached already dpkg: error processing openoffice.org-common (--configure): dependency problems - leaving unconfigured No apport report written because MaxReports is reached already Errors were encountered while processing: shared-mime-info libgtk2.0-0 chromium-browser chromium-codecs-ffmpeg chromium-browser-l10n libevdocument2 libevview2 evince firefox gcalctool libgdict-1.0-6 gnome-utils gtk2-engines-pixbuf libedataserverui1.2-8 libgail18 libgtk2.0-bin libgtk2.0-dev libnotify-dev network-manager-gnome openoffice.org-core openoffice.org-draw openoffice.org-impress pidgin update-manager update-notifier xulrunner-1.9.2 xulrunner-1.9.2-dev icedtea6-plugin libgweather-common libgweather1 openoffice.org-style-galaxy openoffice.org-common E: Sub-process /usr/bin/dpkg returned an error code (1) While typing command in terminal, command is not auto-completing.

    Read the article

  • Webrat says it can't find some text, but the text is actually there

    - by Jason
    I have a webpage that has a form button on it called "delete", and a cuke scenario that has the line: And I should see "delete" When I run the scenario, I get this error: expected the following element's content to include "delete" ...and it dumps the webrat page to stdout and the "delete" is, in fact, not there. So far so good. However, when I tell webrat to show me the page before the error happens: Then show me the page And I should see "delete" ...Safari fires up and shows me the page, and in Safari there's the "delete" button, totally there. Why is webrat not finding the form button? I've also had this same problem with form fields, such as text inputs that have a value in them when the page loads, but webrat says there's nothing there. Looking at it in Safari shows, again, that the field does have the right text in it. Is this a bug, or is webrat just not suitable for checking form elements? Is there a different way to do this? Thanks!

    Read the article

  • Importing a txt file

    - by Tinkerbell
    How do I get this code to work? When I run the whole program I think it just exits because it never returns true. EDIT So, after moving the file and adding the printStacktrace(), I'm not getting any errors, although my program still won't run. So, I get these errors, what do they mean? java.io.FileNotFoundException: BoggleWords.txt (The system cannot find the file specified) at java.io.FileInputStream.open(Native Method) at java.io.FileInputStream.(Unknown Source) at Boggle.isExceptedWord(Boggle.java:62) at Boggle.wordsThatCount(Boggle.java:49) at Boggle.getWordsFound(Boggle.java:40) at Boggle.getScore(Boggle.java:131) at DiceTrayTest.testGetWordsFoundAfterPrepareResultsCalledWithSetDiceTray(DiceTrayTest.java:101) at sun.reflect.NativeMethodAccessorImpl.invoke0(Native Method) at sun.reflect.NativeMethodAccessorImpl.invoke(Unknown Source) at sun.reflect.DelegatingMethodAccessorImpl.invoke(Unknown Source) at java.lang.reflect.Method.invoke(Unknown Source) at org.junit.runners.model.FrameworkMethod$1.runReflectiveCall(FrameworkMethod.java:44) at org.junit.internal.runners.model.ReflectiveCallable.run(ReflectiveCallable.java:15) at org.junit.runners.model.FrameworkMethod.invokeExplosively(FrameworkMethod.java:41) at org.junit.internal.runners.statements.InvokeMethod.evaluate(InvokeMethod.java:20) at org.junit.runners.BlockJUnit4ClassRunner.runNotIgnored(BlockJUnit4ClassRunner.java:79) at org.junit.runners.BlockJUnit4ClassRunner.runChild(BlockJUnit4ClassRunner.java:71) at org.junit.runners.BlockJUnit4ClassRunner.runChild(BlockJUnit4ClassRunner.java:49) at org.junit.runners.ParentRunner$3.run(ParentRunner.java:193) at org.junit.runners.ParentRunner$1.schedule(ParentRunner.java:52) at org.junit.runners.ParentRunner.runChildren(ParentRunner.java:191) at org.junit.runners.ParentRunner.access$000(ParentRunner.java:42) at org.junit.runners.ParentRunner$2.evaluate(ParentRunner.java:184) at org.junit.runners.ParentRunner.run(ParentRunner.java:236) at org.eclipse.jdt.internal.junit4.runner.JUnit4TestReference.run(JUnit4TestReference.java:50) at org.eclipse.jdt.internal.junit.runner.TestExecution.run(TestExecution.java:38) at org.eclipse.jdt.internal.junit.runner.RemoteTestRunner.runTests(RemoteTestRunner.java:467) at org.eclipse.jdt.internal.junit.runner.RemoteTestRunner.runTests(RemoteTestRunner.java:683) at org.eclipse.jdt.internal.junit.runner.RemoteTestRunner.run(RemoteTestRunner.java:390) at org.eclipse.jdt.internal.junit.runner.RemoteTestRunner.main(RemoteTestRunner.java:197) java.io.FileNotFoundException: BoggleWords.txt (The system cannot find the file specified) at java.io.FileInputStream.open(Native Method) at java.io.FileInputStream.(Unknown Source) at Boggle.isExceptedWord(Boggle.java:62) at Boggle.wordsThatCount(Boggle.java:49) at Boggle.getWordsFound(Boggle.java:40) at Boggle.getScore(Boggle.java:131) at DiceTrayTest.testGetWordsFoundAfterPrepareResultsCalledWithSetDiceTray(DiceTrayTest.java:101) at sun.reflect.NativeMethodAccessorImpl.invoke0(Native Method) at sun.reflect.NativeMethodAccessorImpl.invoke(Unknown Source) at sun.reflect.DelegatingMethodAccessorImpl.invoke(Unknown Source) at java.lang.reflect.Method.invoke(Unknown Source) at org.junit.runners.model.FrameworkMethod$1.runReflectiveCall(FrameworkMethod.java:44) at org.junit.internal.runners.model.ReflectiveCallable.run(ReflectiveCallable.java:15) at org.junit.runners.model.FrameworkMethod.invokeExplosively(FrameworkMethod.java:41) at org.junit.internal.runners.statements.InvokeMethod.evaluate(InvokeMethod.java:20) at org.junit.runners.BlockJUnit4ClassRunner.runNotIgnored(BlockJUnit4ClassRunner.java:79) at org.junit.runners.BlockJUnit4ClassRunner.runChild(BlockJUnit4ClassRunner.java:71) at org.junit.runners.BlockJUnit4ClassRunner.runChild(BlockJUnit4ClassRunner.java:49) at org.junit.runners.ParentRunner$3.run(ParentRunner.java:193) at org.junit.runners.ParentRunner$1.schedule(ParentRunner.java:52) at org.junit.runners.ParentRunner.runChildren(ParentRunner.java:191) at org.junit.runners.ParentRunner.access$000(ParentRunner.java:42) at org.junit.runners.ParentRunner$2.evaluate(ParentRunner.java:184) at org.junit.runners.ParentRunner.run(ParentRunner.java:236) at org.eclipse.jdt.internal.junit4.runner.JUnit4TestReference.run(JUnit4TestReference.java:50) at org.eclipse.jdt.internal.junit.runner.TestExecution.run(TestExecution.java:38) at org.eclipse.jdt.internal.junit.runner.RemoteTestRunner.runTests(RemoteTestRunner.java:467) at org.eclipse.jdt.internal.junit.runner.RemoteTestRunner.runTests(RemoteTestRunner.java:683) at org.eclipse.jdt.internal.junit.runner.RemoteTestRunner.run(RemoteTestRunner.java:390) at org.eclipse.jdt.internal.junit.runner.RemoteTestRunner.main(RemoteTestRunner.java:197) java.io.FileNotFoundException: BoggleWords.txt (The system cannot find the file specified) at java.io.FileInputStream.open(Native Method) at java.io.FileInputStream.(Unknown Source) at Boggle.isExceptedWord(Boggle.java:62) at Boggle.wordsThatCount(Boggle.java:49) at Boggle.getWordsFound(Boggle.java:40) at Boggle.getScore(Boggle.java:131) at DiceTrayTest.testGetWordsFoundAfterPrepareResultsCalledWithSetDiceTray(DiceTrayTest.java:101) at sun.reflect.NativeMethodAccessorImpl.invoke0(Native Method) at sun.reflect.NativeMethodAccessorImpl.invoke(Unknown Source) at sun.reflect.DelegatingMethodAccessorImpl.invoke(Unknown Source) at java.lang.reflect.Method.invoke(Unknown Source) at org.junit.runners.model.FrameworkMethod$1.runReflectiveCall(FrameworkMethod.java:44) at org.junit.internal.runners.model.ReflectiveCallable.run(ReflectiveCallable.java:15) at org.junit.runners.model.FrameworkMethod.invokeExplosively(FrameworkMethod.java:41) at org.junit.internal.runners.statements.InvokeMethod.evaluate(InvokeMethod.java:20) at org.junit.runners.BlockJUnit4ClassRunner.runNotIgnored(BlockJUnit4ClassRunner.java:79) at org.junit.runners.BlockJUnit4ClassRunner.runChild(BlockJUnit4ClassRunner.java:71) at org.junit.runners.BlockJUnit4ClassRunner.runChild(BlockJUnit4ClassRunner.java:49) at org.junit.runners.ParentRunner$3.run(ParentRunner.java:193) at org.junit.runners.ParentRunner$1.schedule(ParentRunner.java:52) at org.junit.runners.ParentRunner.runChildren(ParentRunner.java:191) at org.junit.runners.ParentRunner.access$000(ParentRunner.java:42) at org.junit.runners.ParentRunner$2.evaluate(ParentRunner.java:184) at org.junit.runners.ParentRunner.run(ParentRunner.java:236) at org.eclipse.jdt.internal.junit4.runner.JUnit4TestReference.run(JUnit4TestReference.java:50) at org.eclipse.jdt.internal.junit.runner.TestExecution.run(TestExecution.java:38) at org.eclipse.jdt.internal.junit.runner.RemoteTestRunner.runTests(RemoteTestRunner.java:467) at org.eclipse.jdt.internal.junit.runner.RemoteTestRunner.runTests(RemoteTestRunner.java:683) at org.eclipse.jdt.internal.junit.runner.RemoteTestRunner.run(RemoteTestRunner.java:390) at org.eclipse.jdt.internal.junit.runner.RemoteTestRunner.main(RemoteTestRunner.java:197) java.io.FileNotFoundException: BoggleWords.txt (The system cannot find the file specified) at java.io.FileInputStream.open(Native Method) at java.io.FileInputStream.(Unknown Source) at Boggle.isExceptedWord(Boggle.java:62) at Boggle.wordsThatCount(Boggle.java:49) at Boggle.getWordsFound(Boggle.java:40) at Boggle.getScore(Boggle.java:131) at DiceTrayTest.testGetWordsFoundAfterPrepareResultsCalledWithSetDiceTray(DiceTrayTest.java:101) at sun.reflect.NativeMethodAccessorImpl.invoke0(Native Method) at sun.reflect.NativeMethodAccessorImpl.invoke(Unknown Source) at sun.reflect.DelegatingMethodAccessorImpl.invoke(Unknown Source) at java.lang.reflect.Method.invoke(Unknown Source) at org.junit.runners.model.FrameworkMethod$1.runReflectiveCall(FrameworkMethod.java:44) at org.junit.internal.runners.model.ReflectiveCallable.run(ReflectiveCallable.java:15) at org.junit.runners.model.FrameworkMethod.invokeExplosively(FrameworkMethod.java:41) at org.junit.internal.runners.statements.InvokeMethod.evaluate(InvokeMethod.java:20) at org.junit.runners.BlockJUnit4ClassRunner.runNotIgnored(BlockJUnit4ClassRunner.java:79) at org.junit.runners.BlockJUnit4ClassRunner.runChild(BlockJUnit4ClassRunner.java:71) at org.junit.runners.BlockJUnit4ClassRunner.runChild(BlockJUnit4ClassRunner.java:49) at org.junit.runners.ParentRunner$3.run(ParentRunner.java:193) at org.junit.runners.ParentRunner$1.schedule(ParentRunner.java:52) at org.junit.runners.ParentRunner.runChildren(ParentRunner.java:191) at org.junit.runners.ParentRunner.access$000(ParentRunner.java:42) at org.junit.runners.ParentRunner$2.evaluate(ParentRunner.java:184) at org.junit.runners.ParentRunner.run(ParentRunner.java:236) at org.eclipse.jdt.internal.junit4.runner.JUnit4TestReference.run(JUnit4TestReference.java:50) at org.eclipse.jdt.internal.junit.runner.TestExecution.run(TestExecution.java:38) at org.eclipse.jdt.internal.junit.runner.RemoteTestRunner.runTests(RemoteTestRunner.java:467) at org.eclipse.jdt.internal.junit.runner.RemoteTestRunner.runTests(RemoteTestRunner.java:683) at org.eclipse.jdt.internal.junit.runner.RemoteTestRunner.run(RemoteTestRunner.java:390) at org.eclipse.jdt.internal.junit.runner.RemoteTestRunner.main(RemoteTestRunner.java:197) java.io.FileNotFoundException: BoggleWords.txt (The system cannot find the file specified) at java.io.FileInputStream.open(Native Method) at java.io.FileInputStream.(Unknown Source) at Boggle.isExceptedWord(Boggle.java:62) at Boggle.wordsThatCount(Boggle.java:49) at Boggle.getWordsFound(Boggle.java:40) at Boggle.getScore(Boggle.java:131) at DiceTrayTest.testGetWordsFoundAfterPrepareResultsCalledWithSetDiceTray(DiceTrayTest.java:101) at sun.reflect.NativeMethodAccessorImpl.invoke0(Native Method) at sun.reflect.NativeMethodAccessorImpl.invoke(Unknown Source) at sun.reflect.DelegatingMethodAccessorImpl.invoke(Unknown Source) at java.lang.reflect.Method.invoke(Unknown Source) at org.junit.runners.model.FrameworkMethod$1.runReflectiveCall(FrameworkMethod.java:44) at org.junit.internal.runners.model.ReflectiveCallable.run(ReflectiveCallable.java:15) at org.junit.runners.model.FrameworkMethod.invokeExplosively(FrameworkMethod.java:41) at org.junit.internal.runners.statements.InvokeMethod.evaluate(InvokeMethod.java:20) at org.junit.runners.BlockJUnit4ClassRunner.runNotIgnored(BlockJUnit4ClassRunner.java:79) at org.junit.runners.BlockJUnit4ClassRunner.runChild(BlockJUnit4ClassRunner.java:71) at org.junit.runners.BlockJUnit4ClassRunner.runChild(BlockJUnit4ClassRunner.java:49) at org.junit.runners.ParentRunner$3.run(ParentRunner.java:193) at org.junit.runners.ParentRunner$1.schedule(ParentRunner.java:52) at org.junit.runners.ParentRunner.runChildren(ParentRunner.java:191) at org.junit.runners.ParentRunner.access$000(ParentRunner.java:42) at org.junit.runners.ParentRunner$2.evaluate(ParentRunner.java:184) at org.junit.runners.ParentRunner.run(ParentRunner.java:236) at org.eclipse.jdt.internal.junit4.runner.JUnit4TestReference.run(JUnit4TestReference.java:50) at org.eclipse.jdt.internal.junit.runner.TestExecution.run(TestExecution.java:38) at org.eclipse.jdt.internal.junit.runner.RemoteTestRunner.runTests(RemoteTestRunner.java:467) at org.eclipse.jdt.internal.junit.runner.RemoteTestRunner.runTests(RemoteTestRunner.java:683) at org.eclipse.jdt.internal.junit.runner.RemoteTestRunner.run(RemoteTestRunner.java:390) at org.eclipse.jdt.internal.junit.runner.RemoteTestRunner.main(RemoteTestRunner.java:197) java.io.FileNotFoundException: BoggleWords.txt (The system cannot find the file specified) at java.io.FileInputStream.open(Native Method) at java.io.FileInputStream.(Unknown Source) at Boggle.isExceptedWord(Boggle.java:62) at Boggle.wordsThatCount(Boggle.java:49) at Boggle.getWordsFound(Boggle.java:40) at Boggle.getScore(Boggle.java:131) at DiceTrayTest.testGetWordsFoundAfterPrepareResultsCalledWithSetDiceTray(DiceTrayTest.java:101) at sun.reflect.NativeMethodAccessorImpl.invoke0(Native Method) at sun.reflect.NativeMethodAccessorImpl.invoke(Unknown Source) at sun.reflect.DelegatingMethodAccessorImpl.invoke(Unknown Source) at java.lang.reflect.Method.invoke(Unknown Source) at org.junit.runners.model.FrameworkMethod$1.runReflectiveCall(FrameworkMethod.java:44) at org.junit.internal.runners.model.ReflectiveCallable.run(ReflectiveCallable.java:15) at org.junit.runners.model.FrameworkMethod.invokeExplosively(FrameworkMethod.java:41) at org.junit.internal.runners.statements.InvokeMethod.evaluate(InvokeMethod.java:20) at org.junit.runners.BlockJUnit4ClassRunner.runNotIgnored(BlockJUnit4ClassRunner.java:79) at org.junit.runners.BlockJUnit4ClassRunner.runChild(BlockJUnit4ClassRunner.java:71) at org.junit.runners.BlockJUnit4ClassRunner.runChild(BlockJUnit4ClassRunner.java:49) at org.junit.runners.ParentRunner$3.run(ParentRunner.java:193) at org.junit.runners.ParentRunner$1.schedule(ParentRunner.java:52) at org.junit.runners.ParentRunner.runChildren(ParentRunner.java:191) at org.junit.runners.ParentRunner.access$000(ParentRunner.java:42) at org.junit.runners.ParentRunner$2.evaluate(ParentRunner.java:184) at org.junit.runners.ParentRunner.run(ParentRunner.java:236) at org.eclipse.jdt.internal.junit4.runner.JUnit4TestReference.run(JUnit4TestReference.java:50) at org.eclipse.jdt.internal.junit.runner.TestExecution.run(TestExecution.java:38) at org.eclipse.jdt.internal.junit.runner.RemoteTestRunner.runTests(RemoteTestRunner.java:467) at org.eclipse.jdt.internal.junit.runner.RemoteTestRunner.runTests(RemoteTestRunner.java:683) at org.eclipse.jdt.internal.junit.runner.RemoteTestRunner.run(RemoteTestRunner.java:390) at org.eclipse.jdt.internal.junit.runner.RemoteTestRunner.main(RemoteTestRunner.java:197) java.io.FileNotFoundException: BoggleWords.txt (The system cannot find the file specified) at java.io.FileInputStream.open(Native Method) at java.io.FileInputStream.(Unknown Source) at Boggle.isExceptedWord(Boggle.java:62) at Boggle.wordsThatCount(Boggle.java:49) at Boggle.getWordsFound(Boggle.java:40) at Boggle.getScore(Boggle.java:131) at DiceTrayTest.testGetWordsFoundAfterPrepareResultsCalledWithSetDiceTray(DiceTrayTest.java:101) at sun.reflect.NativeMethodAccessorImpl.invoke0(Native Method) at sun.reflect.NativeMethodAccessorImpl.invoke(Unknown Source) at sun.reflect.DelegatingMethodAccessorImpl.invoke(Unknown Source) at java.lang.reflect.Method.invoke(Unknown Source) at org.junit.runners.model.FrameworkMethod$1.runReflectiveCall(FrameworkMethod.java:44) at org.junit.internal.runners.model.ReflectiveCallable.run(ReflectiveCallable.java:15) at org.junit.runners.model.FrameworkMethod.invokeExplosively(FrameworkMethod.java:41) at org.junit.internal.runners.statements.InvokeMethod.evaluate(InvokeMethod.java:20) at org.junit.runners.BlockJUnit4ClassRunner.runNotIgnored(BlockJUnit4ClassRunner.java:79) at org.junit.runners.BlockJUnit4ClassRunner.runChild(BlockJUnit4ClassRunner.java:71) at org.junit.runners.BlockJUnit4ClassRunner.runChild(BlockJUnit4ClassRunner.java:49) at org.junit.runners.ParentRunner$3.run(ParentRunner.java:193) at org.junit.runners.ParentRunner$1.schedule(ParentRunner.java:52) at org.junit.runners.ParentRunner.runChildren(ParentRunner.java:191) at org.junit.runners.ParentRunner.access$000(ParentRunner.java:42) at org.junit.runners.ParentRunner$2.evaluate(ParentRunner.java:184) at org.junit.runners.ParentRunner.run(ParentRunner.java:236) at org.eclipse.jdt.internal.junit4.runner.JUnit4TestReference.run(JUnit4TestReference.java:50) at org.eclipse.jdt.internal.junit.runner.TestExecution.run(TestExecution.java:38) at org.eclipse.jdt.internal.junit.runner.RemoteTestRunner.runTests(RemoteTestRunner.java:467) at org.eclipse.jdt.internal.junit.runner.RemoteTestRunner.runTests(RemoteTestRunner.java:683) at org.eclipse.jdt.internal.junit.runner.RemoteTestRunner.run(RemoteTestRunner.java:390) at org.eclipse.jdt.internal.junit.runner.RemoteTestRunner.main(RemoteTestRunner.java:197) java.io.FileNotFoundException: BoggleWords.txt (The system cannot find the file specified) at java.io.FileInputStream.open(Native Method) at java.io.FileInputStream.(Unknown Source) at Boggle.isExceptedWord(Boggle.java:62) at Boggle.wordsThatCount(Boggle.java:49) at Boggle.getWordsFound(Boggle.java:40) at Boggle.getScore(Boggle.java:131) at DiceTrayTest.testGetWordsFoundAfterPrepareResultsCalledWithSetDiceTray(DiceTrayTest.java:101) at sun.reflect.NativeMethodAccessorImpl.invoke0(Native Method) at sun.reflect.NativeMethodAccessorImpl.invoke(Unknown Source) at sun.reflect.DelegatingMethodAccessorImpl.invoke(Unknown Source) at java.lang.reflect.Method.invoke(Unknown Source) at org.junit.runners.model.FrameworkMethod$1.runReflectiveCall(FrameworkMethod.java:44) at org.junit.internal.runners.model.ReflectiveCallable.run(ReflectiveCallable.java:15) at org.junit.runners.model.FrameworkMethod.invokeExplosively(FrameworkMethod.java:41) at org.junit.internal.runners.statements.InvokeMethod.evaluate(InvokeMethod.java:20) at org.junit.runners.BlockJUnit4ClassRunner.runNotIgnored(BlockJUnit4ClassRunner.java:79) at org.junit.runners.BlockJUnit4ClassRunner.runChild(BlockJUnit4ClassRunner.java:71) at org.junit.runners.BlockJUnit4ClassRunner.runChild(BlockJUnit4ClassRunner.java:49) at org.junit.runners.ParentRunner$3.run(ParentRunner.java:193) at org.junit.runners.ParentRunner$1.schedule(ParentRunner.java:52) at org.junit.runners.ParentRunner.runChildren(ParentRunner.java:191) at org.junit.runners.ParentRunner.access$000(ParentRunner.java:42) at org.junit.runners.ParentRunner$2.evaluate(ParentRunner.java:184) at org.junit.runners.ParentRunner.run(ParentRunner.java:236) at org.eclipse.jdt.internal.junit4.runner.JUnit4TestReference.run(JUnit4TestReference.java:50) at org.eclipse.jdt.internal.junit.runner.TestExecution.run(TestExecution.java:38) at org.eclipse.jdt.internal.junit.runner.RemoteTestRunner.runTests(RemoteTestRunner.java:467) at org.eclipse.jdt.internal.junit.runner.RemoteTestRunner.runTests(RemoteTestRunner.java:683) at org.eclipse.jdt.internal.junit.runner.RemoteTestRunner.run(RemoteTestRunner.java:390) at org.eclipse.jdt.internal.junit.runner.RemoteTestRunner.main(RemoteTestRunner.java:197)

    Read the article

  • Change input text to regular text on blur and ability to edit jQuery

    - by eknown
    I'm creating a form where I'm eliminating the use of a save button. The form is made up of input text boxes and textareas. After the user enters data into the input field, I want to trigger an onBlur function and change the input into a span that contains the information that the user entered. I also want to have the ability to edit this information, so if the user clicks on the newly created span with text, it will turn back into the input field with the current information for their editing pleasure. For reference, I'm looking to have a functionality pretty much like on editing a photo title on Flickr. If possible, I'd also like to have the textbox show "saving..." for half a second after the blur to reflect interaction with server.

    Read the article

  • ASP.NET Conditionally Change ButtonField text at runTime

    - by Rodney Vinyard
    ASP.NET Conditionally Change ButtonField text at runTime   <asp:ButtonField CommandName="Edit" HeaderText="" Text="Edit" ButtonType="Link" />       protected void gvRequests_RowDataBound(object sender, GridViewRowEventArgs e)     {         if (e.Row.RowType == DataControlRowType.DataRow)         {             //----------------------------------------------------             // If status = "Saved", change buttonField.LinkButton.Text to "Copy"             //----------------------------------------------------             if (e.Row.Cells[(int)gCol.Status].Text == "Saved")             {                 //----------------------------------------------------                 // no !                 //----------------------------------------------------                 //string x = e.Row.Cells[(int)gCol.EditLink].Text;                 //e.Row.Cells[(int)gCol.EditLink].Text = "Copy";                   //----------------------------------------------------                 // yes !                 //----------------------------------------------------                 LinkButton linkButton = (LinkButton)e.Row.Cells[(int)gCol.EditLink].Controls[0];                 linkButton.Text = "Copy";             }         }     }

    Read the article

  • Designing status management for a file processing module

    - by bot
    The background One of the functionality of a product that I am currently working on is to process a set of compressed files ( containing XML files ) that will be made available at a fixed location periodically (local or remote location - doesn't really matter for now) and dump the contents of each XML file in a database. I have taken care of the design for a generic parsing module that should be able to accommodate the parsing of any file type as I have explained in my question linked below. There is no need to take a look at the following link to answer my question but it would definitely provide a better context to the problem Generic file parser design in Java using the Strategy pattern The Goal I want to be able to keep a track of the status of each XML file and the status of each compressed file containing the XML files. I can probably have different statuses defined for the XML files such as NEW, PROCESSING, LOADING, COMPLETE or FAILED. I can derive the status of a compressed file based on the status of the XML files within the compressed file. e.g status of the compressed file is COMPLETE if no XML file inside the compressed file is in a FAILED state or status of the compressed file is FAILED if the status of at-least one XML file inside the compressed file is FAILED. A possible solution The Model I need to maintain the status of each XML file and the compressed file. I will have to define some POJOs for holding the information about an XML file as shown below. Note that there is no need to store the status of a compressed file as the status of a compressed file can be derived from the status of its XML files. public class FileInformation { private String compressedFileName; private String xmlFileName; private long lastModifiedDate; private int status; public FileInformation(final String compressedFileName, final String xmlFileName, final long lastModified, final int status) { this.compressedFileName = compressedFileName; this.xmlFileName = xmlFileName; this.lastModifiedDate = lastModified; this.status = status; } } I can then have a class called StatusManager that aggregates a Map of FileInformation instances and provides me the status of a given file at any given time in the lifetime of the appliciation as shown below : public class StatusManager { private Map<String,FileInformation> processingMap = new HashMap<String,FileInformation>(); public void add(FileInformation fileInformation) { fileInformation.setStatus(0); // 0 will indicates that the file is in NEW state. 1 will indicate that the file is in process and so on.. processingMap.put(fileInformation.getXmlFileName(),fileInformation); } public void update(String filename,int status) { FileInformation fileInformation = processingMap.get(filename); fileInformation.setStatus(status); } } That takes care of the model for the sake of explanation. So whats my question? Edited after comments from Loki and answer from Eric : - I would like to know if there are any existing design patterns that I can refer to while coming up with a design. I would also like to know how I should go about designing the status management classes. I am more interested in understanding how I can model the status management classes. I am not interested in how other components are going to be updated about a change in status at the moment as suggested by Eric.

    Read the article

  • Issue with parsed text with HTMLCleaner - spaces at the begining of text

    - by ansol90
    Im able to get text using HTMLCleaner from website. The problem is that when I set the text to a TextView it shows the beginning of the text with a big space on it. Here is the screenshot of what im talking about. I have tried android:gravity but nothing happened. Please help. Here is my Code: private class SiteParser extends AsyncTask<String, Void, String> { protected String doInBackground(String... arg) { String output = null; try { HtmlHelper hh = new HtmlHelper(new URL(arg[0])); List<TagNode> news = hh.getnewsByClass("TextoPrint"); for (Iterator<TagNode> iterator = newss.iterator(); iterator .hasNext();) { TagNode divElement = (TagNode) iterator.next(); output = divElement.getText().toString(); } } catch (Exception e) { e.printStackTrace(); } return output; } protected void onPostExecute(String output) { Bundle bundle=new Bundle(); bundle.putString("body",output); Intent mainIntent = new Intent(act, MyView.class); mainIntent.putExtras(bundle); startActivity(mainIntent); act.finish(); } } public class HtmlHelper { TagNode rootNode; public HtmlHelper(URL htmlPage) throws IOException, XPatherException { HtmlCleaner cleaner = new HtmlCleaner(); rootNode = cleaner.clean(htmlPage); } List<TagNode> getnewsByClass(String Classname){ List<TagNode> newsList = new ArrayList<TagNode>(); TagNode divElements[] = rootNode.getElementsByName("div", true); for (int i = 0; divElements != null && i < divElements.length; i++) { String classType = divElements[i].getAttributeByName("id"); if (classType != null && classType.equals(Classname)) { newsList.add(divElements[i]); } } return newsList; } }

    Read the article

  • Send SMS text messages for FREE using Java ME

    - by hinkmond
    Here's a way to get around those nasty SMS text messages charges (and maybe a way to get around the Pakistan SMS text censors too!). Use this Java ME SMS text app for your Java ME mobile phone, called JaxtrSMS: See: JaxtrSMS free Java ME SMS Here's a quote: JaxtrSMS lets you send FREE SMS and txt messages to any mobile phone in the world. Best of all, the receiver does not have to have the JaxtrSMS app. International and local SMS/texting can be expensive but with JaxtrSMS you can text anyone in the world for FREE! Great! Now, you can send 2,000 text messages from your phone every month and not worry about a huge bill. You don't send 2,000 text message in a month? Well, get it for your teenage kids then. They certainly send 2,000 text messages in a month... Hinkmond

    Read the article

  • Efficiently separating Read/Compute/Write steps for concurrent processing of entities in Entity/Component systems

    - by TravisG
    Setup I have an entity-component architecture where Entities can have a set of attributes (which are pure data with no behavior) and there exist systems that run the entity logic which act on that data. Essentially, in somewhat pseudo-code: Entity { id; map<id_type, Attribute> attributes; } System { update(); vector<Entity> entities; } A system that just moves along all entities at a constant rate might be MovementSystem extends System { update() { for each entity in entities position = entity.attributes["position"]; position += vec3(1,1,1); } } Essentially, I'm trying to parallelise update() as efficiently as possible. This can be done by running entire systems in parallel, or by giving each update() of one system a couple of components so different threads can execute the update of the same system, but for a different subset of entities registered with that system. Problem In reality, these systems sometimes require that entities interact(/read/write data from/to) each other, sometimes within the same system (e.g. an AI system that reads state from other entities surrounding the current processed entity), but sometimes between different systems that depend on each other (i.e. a movement system that requires data from a system that processes user input). Now, when trying to parallelize the update phases of entity/component systems, the phases in which data (components/attributes) from Entities are read and used to compute something, and the phase where the modified data is written back to entities need to be separated in order to avoid data races. Otherwise the only way (not taking into account just "critical section"ing everything) to avoid them is to serialize parts of the update process that depend on other parts. This seems ugly. To me it would seem more elegant to be able to (ideally) have all processing running in parallel, where a system may read data from all entities as it wishes, but doesn't write modifications to that data back until some later point. The fact that this is even possible is based on the assumption that modification write-backs are usually very small in complexity, and don't require much performance, whereas computations are very expensive (relatively). So the overhead added by a delayed-write phase might be evened out by more efficient updating of entities (by having threads work more % of the time instead of waiting). A concrete example of this might be a system that updates physics. The system needs to both read and write a lot of data to and from entities. Optimally, there would be a system in place where all available threads update a subset of all entities registered with the physics system. In the case of the physics system this isn't trivially possible because of race conditions. So without a workaround, we would have to find other systems to run in parallel (which don't modify the same data as the physics system), other wise the remaining threads are waiting and wasting time. However, that has disadvantages Practically, the L3 cache is pretty much always better utilized when updating a large system with multiple threads, as opposed to multiple systems at once, which all act on different sets of data. Finding and assembling other systems to run in parallel can be extremely time consuming to design well enough to optimize performance. Sometimes, it might even not be possible at all because a system just depends on data that is touched by all other systems. Solution? In my thinking, a possible solution would be a system where reading/updating and writing of data is separated, so that in one expensive phase, systems only read data and compute what they need to compute, and then in a separate, performance-wise cheap, write phase, attributes of entities that needed to be modified are finally written back to the entities. The Question How might such a system be implemented to achieve optimal performance, as well as making programmer life easier? What are the implementation details of such a system and what might have to be changed in the existing EC-architecture to accommodate this solution?

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • knockout bind text label to dropdown value selected option text

    - by Adam Levitt
    Is there a simple way to bind the textbox of a div to change based on the text value of the selected option in a dropdown on the same page? <div data-bind="text: dropdownValue"></div> <select> <option value="1">Value1</option> <option value="2">Value2</option> </select> Please note, I don't want to put the values into the select element using javascript. I'd like to bind to the value straight from the HTML. I can also include jQuery to make it work.

    Read the article

  • Changing Text colour in text field by dropdown menu - Visual Studio 2008

    - by Wayne
    Hey, i'm just doing some testing on Visual Studio 2008, what i'm trying to do is to change the text colour inside the multi-textfield which isn't working and I don't know why... Public Class Form1 Dim ColourValue As Color Private Sub Form1_Load(ByVal sender As System.Object, ByVal e As System.EventArgs) Handles MyBase.Load rbBlue.Checked = False rbRed.Checked = False rbGreen.Checked = False End Sub Private Sub rbRed_CheckedChanged(ByVal sender As System.Object, ByVal e As System.EventArgs) Handles rbRed.CheckedChanged txtSpace.BackColor = Color.Red End Sub Private Sub rbBlue_CheckedChanged(ByVal sender As System.Object, ByVal e As System.EventArgs) Handles rbBlue.CheckedChanged txtSpace.BackColor = Color.Blue End Sub Private Sub rbGreen_CheckedChanged(ByVal sender As System.Object, ByVal e As System.EventArgs) Handles rbGreen.CheckedChanged txtSpace.BackColor = Color.Green End Sub Private Sub cbColours_SelectedValueChanged(ByVal sender As Object, ByVal e As System.EventArgs) Handles cbColours.SelectedValueChanged ColourValue = cbColours.SelectedValue txtSpace.BackColor = ColourValue End Sub End Class Basically i have the radio buttons that would change the background colour of the textfield, but i just need the dropdown menu to change the text colour. Many thanks :)

    Read the article

  • When page loads display 1st image text - hide all other text

    - by Jonah1289
    Hi I have created http://techavid.com/design/test3.html and when you load the page you see there are 3 images. The sun image is focused(in color), while the others are greyed out until clicked. That is how it should be for the images. Also when you load the page you see under each image it's own text(i.e. 1st: Sun, 2nd: Airplane, 3rd: Nano), but on page load I only want 1st:Sun to display and hide all other text until their respective image is clicked. Any idea how to do this? thanks :) J

    Read the article

  • What is the fastest way to find duplicates in multiple BIG txt files?

    - by user2950750
    I am really in deep water here and I need a lifeline. I have 10 txt files. Each file has up to 100.000.000 lines of data. Each line is simply a number representing something else. Numbers go up to 9 digits. I need to (somehow) scan these 10 files and find the numbers that appear in all 10 files. And here comes the tricky part. I have to do it in less than 2 seconds. I am not a developer, so I need an explanation for dummies. I have done enough research to learn that hash tables and map reduce might be something that I can make use of. But can it really be used to make it this fast, or do I need more advanced solutions? I have also been thinking about cutting up the files into smaller files. To that 1 file with 100.000.000 lines is transformed into 100 files with 1.000.000 lines. But I do not know what is best: 10 files with 100 million lines or 1000 files with 1 million lines? When I try to open the 100 million line file, it takes forever. So I think, maybe, it is just too big to be used. But I don't know if you can write code that will scan it without opening. Speed is the most important factor in this, and I need to know if it can be done as fast as I need it, or if I have to store my data in another way, for example, in a database like mysql or something. Thank you in advance to anybody that can give some good feedback.

    Read the article

  • iPhone post-processing with a single FBO with Opengl ES 2.0?

    - by Jing
    I am trying to implement post-processing (blur, bloom, etc.) on the iPhone using OpenGL ES 2.0. I am running into some issues. When rendering during my second rendering step, I end up drawing a completely black quad to the screen instead of the scene (it appears that the texture data is missing) so I am wondering if the cause is using a single FBO. Is it incorrect to use a single FBO in the following fashion? For the first pass (regular scene rendering), I attach a texture as COLOR_ATTACHMENT_0 and render to a texture. glFramebufferTexture2D(GL_FRAMEBUFFER, GL_COLOR_ATTACHMENT0, GL_TEXTURE_2D, texturebuffer, 0) For the second pass (post-processing), I attach the color renderbuffer to COLOR_ATTACHMENT_0 glFramebufferRenderbuffer(GL_FRAMEBUFFER, GL_COLOR_ATTACHMENT0, GL_RENDERBUFFER, colorRenderbuffer) Then use the texture from the first pass for rendering as a quad on the screen.

    Read the article

  • Rendering only a part of text FTGL, OpenGL

    - by Mosquito
    I'm using FTGL library to render text in my C++ project. I can easily render text by using: CFontManager::Instance().renderWrappedText(font, lineLength, position, text); Unfortunately there is a situation in which this Button which displays text, is partly hidden because of resizing container in which it is situated. I'm able without any problem to draw Button's background to fit the container, but I've got a problem with doing the same with a text. Is it possible to somehow draw only text for given width and the rest just ignore? This is a screen which presents my problem: As you can see, the Button "Click here" is being drawn properly, but I can't do the same with "Click here" text.

    Read the article

  • Rich Text Editor in javascript

    - by chanthou
    iframe .text-bold{ border:1px solid orange; background-color:#ccc; width:16px; height:16px; font-weight:bold; cursor:pointer; } .active{ border-color:#9DAECD #E8F1FF #E8F1FF #9DAECD; background-color:yellow; } function init( ) { iframe = document.createElement("iframe"); document.body.appendChild(iframe); iframe.onload = setIframeEditable; isBold=false; div=document.getElementById("bold"); } var setIframeEditable = function(){ iframe.contentDocument.designMode='on'; iframe.focus(); } function makeBold(){ if(!isBold){ //console.log(iframe.contentDocument.execCommand("bold", false, null)); iframe.contentDocument.execCommand("bold", false, null); div.className += " active"; isBold=true; iframe.focus(); }else{ //console.log(iframe.contentDocument.execCommand("bold", true, null)); iframe.contentDocument.execCommand("bold", false, null); div.className ="text-bold"; isBold=false iframe.focus(); } } </script> </head> <body onload="init()"> <div id="bold" class="text-bold" onclick="makeBold()">B</div> </body>

    Read the article

  • Normalize whitespace and other plain-text formatting routines

    - by dreftymac
    Background: The language is JavaScript. The goal is to find a library or pre-existing code to do low-level plain-text formatting. I can write it myself, but why re-invent the wheel. The issue is: it is tough to determine if a "wheel" is out there, since any search for JavaScript libraries pulls up an ocean of HTML-centric stuff. I am not interested in HTML necessarily, just text. Example: I need a JavaScript function that changes this: BEFORE: nisi ut aliquip | ex ea commodo consequat duis |aute irure dolor in esse cillum dolore | eu fugiat nulla pariatur |excepteur sint occa in culpa qui | officia deserunt mollit anim id |est laborum ... into this ... AFTER: nisi ut aliquip | ex ea commodo consequat duis | aute irure dolor in esse cillum dolore | eu fugiat nulla pariatur | excepteur sint occa in culpa qui | officia deserunt mollit anim id | est laborum Question: Does it exist, a JavaScript library that is non-html-web-development-centric that has functions for normalizing spaces in delimited plain text, justifying and spacing plain text? Rationale: Investigating JavaScript for use in a programmer's text editor.

    Read the article

  • Search implementation dilemma: full text vs. plain SQL

    - by Ethan
    I have a MySQL/Rails app that needs search. Here's some info about the data: Users search within their own data only, so searches are narrowed down by user_id to begin with. Each user will have up to about five thousand records (they accumulate over time). I wrote out a typical user's records to a text file. The file size is 2.9 MB. Search has to cover two columns: title and body. title is a varchar(255) column. body is column type text. This will be lightly used. If I average a few searches per second that would be surprising. It's running an a 500 MB CentOS 5 VPS machine. I don't want relevance ranking or any kind of fuzziness. Searches should be for exact strings and reliably return all records containing the string. Simple date order -- newest to oldest. I'm using the InnoDB table type. I'm looking at plain SQL search (through the searchlogic gem) or full text search using Sphinx and the Thinking Sphinx gem. Sphinx is very fast and Thinking Sphinx is cool, but it adds complexity, a daemon to maintain, cron jobs to maintain the index. Can I get away with plain SQL search for a small scale app?

    Read the article

  • How to get user input before saving a file in Sublime Text

    - by EddieJessup
    I'm making a plugin in Sublime Text that prompts the user for a password to encrypt a file before it's saved. There's a hook in the API that's executed before a save is executed, so my naïve implementation is: class TranscryptEventListener(sublime_plugin.EventListener): def on_pre_save(self, view): # If document is set to encode on save if view.settings().get('ON_SAVE'): self.view = view # Prompt user for password message = "Create a Password:" view.window().show_input_panel(message, "", self.on_done, None, None) def on_done(self, password): self.view.run_command("encode", {password": password}) The problem with this is, by the time the input panel appears for the user to enter their password, the document has already been saved (despite the trigger being 'on_pre_save'). Then once the user hits enter, the document is encrypted fine, but the situation is that there's a saved plaintext file, and a modified buffer filled with the encrypted text. So I need to make Sublime Text wait until the user's input the password before carrying out the save. Is there a way to do this? At the moment I'm just manually re-saving once the encryption has been done: def on_pre_save(self, view, encode=False): if view.settings().get('ON_SAVE') and not view.settings().get('ENCODED'): self.view = view message = "Create a Password:" view.window().show_input_panel(message, "", self.on_done, None, None) def on_done(self, password): self.view.run_command("encode", {password": password}) self.view.settings().set('ENCODED', True) self.view.run_command('save') self.view.settings().set('ENCODED', False) but this is messy and if the user cancels the encryption then the plaintext file gets saved, which isn't ideal. Any thoughts? Edit: I think I could do it cleanly by overriding the default save command. I hoped to do this by using the on_text_command or on_window_command triggers, but it seems that the save command doesn't trigger either of these (maybe it's an application command? But there's no on_application_command). Is there just no way to override the save function?

    Read the article

  • Creating a smart text generator

    - by royrules22
    I'm doing this for fun (or as 4chan says "for teh lolz") and if I learn something on the way all the better. I took an AI course almost 2 years ago now and I really enjoyed it but I managed to forget everything so this is a way to refresh that. Anyway I want to be able to generate text given a set of inputs. Basically this will read forum inputs (or maybe Twitter tweets) and then generate a comment based on the learning. Now the simplest way would be to use a Markov Chain Text Generator but I want something a little bit more complex than that as the MKC basically only learns by word order (which word is more likely to appear after word x given the input text). I'm trying to see if there's something I can do to make it a little bit more smarter. For example I want it to do something like this: Learn from a large selection of posts in a message board but don't weight it too much For each post: Learn from the other comments in that post and weigh these inputs higher Generate comment and post See what other users' reaction to your post was. If good weigh it positively so you make more posts that are similar to the one made, and vice versa if negative. It's the weighing and learning from mistakes part that I'm not sure how to implement. I thought about Artificial Neural Networks (mainly because I remember enjoying that chapter) but as far as I can tell that's mainly used to classify things (i.e. given a finite set of choices [x1...xn] which x is this given input) not really generate anything. I'm not even sure if this is possible or if it is what should I go about learning/figuring out. What algorithm is best suited for this? To those worried that I will use this as a bot to spam or provide bad answers to SO, I promise that I will not use this to provide (bad) advice or to spam for profit. I definitely will not post it's nonsensical thoughts on SO. I plan to use it for my own amusement. Thanks!

    Read the article

  • Concatenate 2 text elements on a line with full-width border using CSS only

    - by Michael Horne
    Okay, I'm a newbie to CSS3, so please be gentle. ;-) I'm working with some Wordpress code (Woocommerce plugin, to be exact), and I'm trying to format a line of code in a sidebar so that 2 separate text items (one in an <a, the other in a <span are all on the same line, the full width of the column, and with a bottom border. It looks something like this (except the bottom border on each text do not go all the way across the enclosing sidebar box): http://www.dalluva.com/temp/browse-catalog.JPG (sorry, I'm new and can't post inline images yet) Here's the code fragment I'm trying to live with (i.e. I don't want to change it): <div class="widget"> ... <ul class="product-categories"> <li class="cat-item"> <a href="http://localhost/dalluva/shop/product-category/books/">Books</a> <span class="count">(5)</span> </li> ... And here's the CSS I have now: .widget ul li a { border-bottom: 1px solid #e9e9e9; line-height:1.0; padding: 5px 0 5px 22px; display: inline-block; } .widget ul li span { border-bottom: 1px solid #e9e9e9; line-height: 1.0; padding: 5px 0 5px 0; display: inline-block; } The output in the image above looks right for this CSS code, but when I change the 'span' CSS to include a width:100%, it causes the span element to wrap to the next line, looking like this: http://www.dalluva.com/temp/browse-catalog-2.JPG I've played with white-space:nowrap, overflow:hidden, etc, but I can't seem to find a way to have both the <a and the <span text on the same line with the border extending the full width of the column. Any suggestions on getting the desired effect through CSS only? Thanks. Michael

    Read the article

  • Full Text Search like Google

    - by Eduardo
    I would like to implement full-text-search in my off-line (android) application to search the user generated list of notes. I would like it to behave just like Google (since most people are already used to querying to Google) My initial requirements are: Fast: like Google or as fast as possible, having 100000 documents with 200 hundred words each. Searching for two words should only return documents that contain both words (not just one word) (unless the OR operator is used) Case insensitive (aka: normalization): If I have the word 'Hello' and I search for 'hello' it should match. Diacritical mark insensitive: If I have the word 'así' a search for 'asi' should match. In Spanish, many people, incorrectly, either do not put diacritical marks or fail in correctly putting them. Stop word elimination: To not have a huge index meaningless words like 'and', 'the' or 'for' should not be indexed at all. Dictionary substitution (aka: stem words): Similar words should be indexed as one. For example, instances of 'hungrily' and 'hungry' should be replaced with 'hunger'. Phrase search: If I have the text 'Hello world!' a search of '"world hello"' should not match it but a search of '"hello world"' should match. Search all fields (in multifield documents) if no field specified (not just a default field) Auto-completion in search results while typing to give popular searches. (just like Google Suggest) How may I configure a full-text-search engine to behave as much as possible as Google? (I am mostly interested in Open Source, Java and in particular Lucene)

    Read the article

  • C# ...extract email address from inside 100's of text files

    - by Developer
    My SMTP server got 100's of errors when sending lots of emails. Now have lots of .BAD files each one containing an error message and somewhere in the middle, the actual email address it was supposed to be sent to. What is the easiest way to extract from each file "just" the "email address", so that I can have a list of the actual failed emails? I can code in C# and any suggestion will be truly welcomed. BAD SAMPLE TEXT: From: [email protected] To: [email protected] Date: Tue, 25 Sep 2012 12:12:09 -0700 MIME-Version: 1.0 Content-Type: multipart/report; report-type=delivery-status; boundary="9B095B5ADSN=_01CD9B35032DF58000000066my.server.co" X-DSNContext: 7ce717b1 - 1386 - 00000002 - C00402D1 Message-ID: Subject: Delivery Status Notification (Failure) This is a MIME-formatted message. Portions of this message may be unreadable without a MIME-capable mail program. --9B095B5ADSN=_01CD9B35032DF58000000066my.server.co Content-Type: text/plain; charset=unicode-1-1-utf-7 This is an automatically generated Delivery Status Notification. Unable to deliver message to the following recipients, due to being unable to connect successfully to the destination mail server. [email protected] --9B095B5ADSN=_01CD9B35032DF58000000066my.server.com Content-Type: message/delivery-status Reporting-MTA: dns;my.server.com Received-From-MTA: dns;Social Arrival-Date: Tue, 25 Sep 2012 11:45:15 -0700 Final-Recipient: rfc822;[email protected] Action: failed Status: 4.4.7 --9B095B5ADSN=_01CD9B35032DF58000000066my.server.com Content-Type: message/rfc822 Received: from Social ([127.0.0.1]) by my.server.com with Microsoft SMTPSVC(7.5.7601.17514); Tue, 25 Sep 2012 11:45:15 -0700 ====================================== ...and lots more text after ===================== Mainly I want to find the "[email protected]" email right in the middle...

    Read the article

< Previous Page | 23 24 25 26 27 28 29 30 31 32 33 34  | Next Page >