Search Results

Search found 99595 results on 3984 pages for 'file type'.

Page 28/3984 | < Previous Page | 24 25 26 27 28 29 30 31 32 33 34 35  | Next Page >

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • Copy mdf file and use it in run time

    - by Anibas
    After I copy mdf file (and his log file) I tries to Insert data. I receive the following message: "An attempt to attach an auto-named database for file [fileName].mdf failed. A database with the same name exists, or specified file cannot be opened, or it is located on UNC share. When I copied the file manual everything worked normally. Is it correct the order File.Copy leaves the file engaged?

    Read the article

  • Designing a database file format

    - by RoliSoft
    I would like to design my own database engine for educational purposes, for the time being. Designing a binary file format is not hard nor the question, I've done it in the past, but while designing a database file format, I have come across a very important question: How to handle the deletion of an item? So far, I've thought of the following two options: Each item will have a "deleted" bit which is set to 1 upon deletion. Pro: relatively fast. Con: potentially sensitive data will remain in the file. 0x00 out the whole item upon deletion. Pro: potentially sensitive data will be removed from the file. Con: relatively slow. Recreating the whole database. Pro: no empty blocks which makes the follow-up question void. Con: it's a really good idea to overwrite the whole 4 GB database file because a user corrected a typo. I will sell this method to Twitter ASAP! Now let's say you already have a few empty blocks in your database (deleted items). The follow-up question is how to handle the insertion of a new item? Append the item to the end of the file. Pro: fastest possible. Con: file will get huge because of all the empty blocks that remain because deleted items aren't actually deleted. Search for an empty block exactly the size of the one you're inserting. Pro: may get rid of some blocks. Con: you may end up scanning the whole file at each insert only to find out it's very unlikely to come across a perfectly fitting empty block. Find the first empty block which is equal or larger than the item you're inserting. Pro: you probably won't end up scanning the whole file, as you will find an empty block somewhere mid-way; this will keep the file size relatively low. Con: there will still be lots of leftover 0x00 bytes at the end of items which were inserted into bigger empty blocks than they are. Rigth now, I think the first deletion method and the last insertion method are probably the "best" mix, but they would still have their own small issues. Alternatively, the first insertion method and scheduled full database recreation. (Probably not a good idea when working with really large databases. Also, each small update in that method will clone the whole item to the end of the file, thus accelerating file growth at a potentially insane rate.) Unless there is a way of deleting/inserting blocks from/to the middle of the file in a file-system approved way, what's the best way to do this? More importantly, how do databases currently used in production usually handle this?

    Read the article

  • Doctrine generate models - problem with relation type

    - by mrok
    I am trying generate doctrine models from yaml schema I have schema like that: Product: columns: id: type: integer(5) primary: true unsigned: true autoincrement: true activation_time: type: datetime notnull: true enduser_id: type: integer(5) unsigned: true notnull: true relations: Enduser: foreignType: one type: one foreignAlias: Product Hostid: columns: id: type: integer(5) primary: true unsigned: true autoincrement: true value: type: string(32) fixed: true notnull: true Order: columns: id: type: integer(5) primary: true autoincrement: true unsigned: true expire_date: type: datetime description: type: clob Enduser: columns: id: type: integer(5) primary: true unsigned: true autoincrement: true hostid_id: type: integer(5) unsigned: true notnull: true order_id: type: integer(5) unsigned: true notnull: true relations: Order: foreignAlias: Endusers Hostid: foreignAlias: Endusers and the problem is that models generated by doctrine generate-models-yaml are wrong in BaseEnduser $Product is defined as Doctrine_Collection $this-hasMany('Product', array( 'local' = 'id', 'foreign' = 'enduser_id')); instead just Product object what did I wrong? relation is defined as foreignType: one type: one

    Read the article

  • opening and viewing a file in php

    - by Christian Burgos
    how do i open/view for editing an uploaded file in php? i have tried this but it doesn't open the file. $my_file = 'file.txt'; $handle = fopen($my_file, 'r'); $data = fread($handle,filesize($my_file)); i've also tried this but it wont work. $my_file = 'file.txt'; $handle = fopen($my_file, 'w') or die('Cannot open file: '.$my_file); $data = 'This is the data'; fwrite($handle, $data); what i have in mind is like when you want to view an uploaded resume,documents or any other ms office files like .docx,.xls,.pptx and be able to edit them, save and close the said file. edit: latest tried code... <?php // Connects to your Database include "configdb.php"; //Retrieves data from MySQL $data = mysql_query("SELECT * FROM employees") or die(mysql_error()); //Puts it into an array while($info = mysql_fetch_array( $data )) { //Outputs the image and other data //Echo "<img src=localhost/uploadfile/images".$info['photo'] ."> <br>"; Echo "<b>Name:</b> ".$info['name'] . "<br> "; Echo "<b>Email:</b> ".$info['email'] . " <br>"; Echo "<b>Phone:</b> ".$info['phone'] . " <hr>"; //$file=fopen("uploadfile/images/".$info['photo'],"r+"); $file=fopen("Applications/XAMPP/xamppfiles/htdocs/uploadfile/images/file.odt","r") or exit("unable to open file");; } ?> i am getting the error: Warning: fopen(Applications/XAMPP/xamppfiles/htdocs/uploadfile/images/file.odt): failed to open stream: No such file or directory in /Applications/XAMPP/xamppfiles/htdocs/uploadfile/view.php on line 17 unable to open file the file is in that folder, i don't know it wont find it.

    Read the article

  • Reading data from text file in C

    - by themake
    I have a text file which contains words separated by space. I want to take each word from the file and store it. So i have opened the file but am unsure how to assign the word to a char. FILE *fp; fp = fopen("file.txt", "r"); //then i want char one = the first word in the file char two = the second word in the file

    Read the article

  • Copied a file with winscp; only winscp can see it

    - by nilbus
    I recently copied a 25.5GB file from another machine using WinSCP. I copied it to C:\beth.tar.gz, and WinSCP can still see the file. However no other app (including Explorer) can see the file. What might cause this, and how can I fix it? The details that might or might not matter WinSCP shows the size of the file (C:\beth.tar.gz) correctly as 27,460,124,080 bytes, which matches the filesize on the remote host Neither explorer, cmd (command line prompt w/ dir C:\), the 7Zip archive program, nor any other File Open dialog can see the beth.tar.gz file under C:\ I have configured Explorer to show hidden files I can move the file to other directories using WinSCP If I try to move the file to Users/, UAC prompts me for administrative rights, which I grant, and I get this error: Could not find this item The item is no longer located in C:\ When I try to transfer the file back to the remote host in a new directory, the transfer starts successfully and transfers data The transfer had about 30 minutes remaining when I left it for the night The morning after the file transfer, I was greeted with a message saying that the connection to the server had been lost. I don't think this is relevant, since I did not tell it to disconnect after the file was done transferring, and it likely disconnected after the file transfer finished. I'm using an old version of WinSCP - v4.1.8 from 2008 I can view the file properties in WinSCP: Type of file: 7zip (.gz) Location: C:\ Attributes: none (Ready-only, Hidden, Archive, or Ready for indexing) Security: SYSTEM, my user, and Administrators group have full permissions - everything other than "special permissions" is checked under Allow for all 3 users/groups (my user, Administrators, SYSTEM) What's going on?!

    Read the article

  • How do I open a file in such a way that if the file doesn't exist it will be created and opened automatically?

    - by snakile
    Here's how I open a file for writing+ : if( fopen_s( &f, fileName, "w+" ) !=0 ) { printf("Open file failed\n"); return; } fprintf_s(f, "content"); If the file doesn't exist the open operation fails. What's the right way to fopen if I want to create the file automatically if the file doesn't already exist? EDIT: If the file does exist, I would like fprintf to overwrite the file, not to append to it.

    Read the article

  • C++, Ifstream opens local file but not file on HTTP Server

    - by fammi
    Hi, I am using ifstream to open a file and then read from it. My program works fine when i give location of the local file on my system. for eg /root/Desktop/abc.xxx works fine But once the location is on the http server the file fails to open. for eg http://192.168.0.10/abc.xxx fails to open. Is there any alternate for ifstream when using a URL address? thanks. part of the code where having problem: bool readTillEof = (endIndex == -1) ? true : false; // Open the file in binary mode and seek to the end to determine file size ifstream file ( fileName.c_str ( ), ios::in|ios::ate|ios::binary ); if ( file.is_open ( ) ) { long size = (long) file.tellg ( ); long numBytesRead; if ( readTillEof ) { numBytesRead = size - startIndex; } else { numBytesRead = endIndex - startIndex + 1; } // Allocate a new buffer ptr to read in the file data BufferSptr buf (new Buffer ( numBytesRead ) ); mpStreamingClientEngine->SetResponseBuffer ( nextRequest, buf ); // Seek to the start index of the byte range // and read the data file.seekg ( startIndex, ios::beg ); file.read ( (char *)buf->GetData(), numBytesRead ); // Pass on the data to the SCE // and signal completion of request mpStreamingClientEngine->HandleDataReceived( nextRequest, numBytesRead); mpStreamingClientEngine->MarkRequestCompleted( nextRequest ); // Close the file file.close ( ); } else { // Report error to the Streaming Client Engine // as unable to open file AHS_ERROR ( ConnectionManager, " Error while opening file \"%s\"\n", fileName.c_str ( ) ); mpStreamingClientEngine->HandleRequestFailed( nextRequest, CONNECTION_FAILED ); } }

    Read the article

  • Problem with File uplolad in javascript.

    - by Nikhil
    I have used javascript to upload more than one file. when user clicks on 'add more' javascript appends new object to older div using innerHTML. Now the problem is if I select a file and then click on "add more" then new file button exist but older selected file removes and two blank file buttons display. I want this old file must be selected when user add new file button. If anybody can, Help Plz!!! tnX.

    Read the article

  • Reflect.Emit Dynamic Type Memory Blowup

    - by Firestrand
    Using C# 3.5 I am trying to generate dynamic types at runtime using reflection emit. I used the Dynamic Query Library sample from Microsoft to create a class generator. Everything works, my problem is that 100 generated types inflate the memory usage by approximately 25MB. This is a completely unacceptable memory profile as eventually I want to support having several hundred thousand types generated in memory. Memory profiling shows that the memory is apparently being held by various System.Reflection.Emit types and methods though I can't figure out why. I haven't found others talking about this problem so I am hoping someone in this community either knows what I am doing wrong or if this is expected behavior. Contrived Example below: using System; using System.Collections.Generic; using System.Text; using System.Reflection; using System.Reflection.Emit; namespace SmallRelfectExample { class Program { static void Main(string[] args) { int typeCount = 100; int propCount = 100; Random rand = new Random(); Type dynType = null; for (int i = 0; i < typeCount; i++) { List<DynamicProperty> dpl = new List<DynamicProperty>(propCount); for (int j = 0; j < propCount; j++) { dpl.Add(new DynamicProperty("Key" + rand.Next().ToString(), typeof(String))); } SlimClassFactory scf = new SlimClassFactory(); dynType = scf.CreateDynamicClass(dpl.ToArray(), i); //Optionally do something with the type here } Console.WriteLine("SmallRelfectExample: {0} Types generated.", typeCount); Console.ReadLine(); } } public class SlimClassFactory { private readonly ModuleBuilder module; public SlimClassFactory() { AssemblyName name = new AssemblyName("DynamicClasses"); AssemblyBuilder assembly = AppDomain.CurrentDomain.DefineDynamicAssembly(name, AssemblyBuilderAccess.Run); module = assembly.DefineDynamicModule("Module"); } public Type CreateDynamicClass(DynamicProperty[] properties, int Id) { string typeName = "DynamicClass" + Id.ToString(); TypeBuilder tb = module.DefineType(typeName, TypeAttributes.Class | TypeAttributes.Public, typeof(DynamicClass)); FieldInfo[] fields = GenerateProperties(tb, properties); GenerateEquals(tb, fields); GenerateGetHashCode(tb, fields); Type result = tb.CreateType(); return result; } static FieldInfo[] GenerateProperties(TypeBuilder tb, DynamicProperty[] properties) { FieldInfo[] fields = new FieldBuilder[properties.Length]; for (int i = 0; i < properties.Length; i++) { DynamicProperty dp = properties[i]; FieldBuilder fb = tb.DefineField("_" + dp.Name, dp.Type, FieldAttributes.Private); PropertyBuilder pb = tb.DefineProperty(dp.Name, PropertyAttributes.HasDefault, dp.Type, null); MethodBuilder mbGet = tb.DefineMethod("get_" + dp.Name, MethodAttributes.Public | MethodAttributes.SpecialName | MethodAttributes.HideBySig, dp.Type, Type.EmptyTypes); ILGenerator genGet = mbGet.GetILGenerator(); genGet.Emit(OpCodes.Ldarg_0); genGet.Emit(OpCodes.Ldfld, fb); genGet.Emit(OpCodes.Ret); MethodBuilder mbSet = tb.DefineMethod("set_" + dp.Name, MethodAttributes.Public | MethodAttributes.SpecialName | MethodAttributes.HideBySig, null, new Type[] { dp.Type }); ILGenerator genSet = mbSet.GetILGenerator(); genSet.Emit(OpCodes.Ldarg_0); genSet.Emit(OpCodes.Ldarg_1); genSet.Emit(OpCodes.Stfld, fb); genSet.Emit(OpCodes.Ret); pb.SetGetMethod(mbGet); pb.SetSetMethod(mbSet); fields[i] = fb; } return fields; } static void GenerateEquals(TypeBuilder tb, FieldInfo[] fields) { MethodBuilder mb = tb.DefineMethod("Equals", MethodAttributes.Public | MethodAttributes.ReuseSlot | MethodAttributes.Virtual | MethodAttributes.HideBySig, typeof(bool), new Type[] { typeof(object) }); ILGenerator gen = mb.GetILGenerator(); LocalBuilder other = gen.DeclareLocal(tb); Label next = gen.DefineLabel(); gen.Emit(OpCodes.Ldarg_1); gen.Emit(OpCodes.Isinst, tb); gen.Emit(OpCodes.Stloc, other); gen.Emit(OpCodes.Ldloc, other); gen.Emit(OpCodes.Brtrue_S, next); gen.Emit(OpCodes.Ldc_I4_0); gen.Emit(OpCodes.Ret); gen.MarkLabel(next); foreach (FieldInfo field in fields) { Type ft = field.FieldType; Type ct = typeof(EqualityComparer<>).MakeGenericType(ft); next = gen.DefineLabel(); gen.EmitCall(OpCodes.Call, ct.GetMethod("get_Default"), null); gen.Emit(OpCodes.Ldarg_0); gen.Emit(OpCodes.Ldfld, field); gen.Emit(OpCodes.Ldloc, other); gen.Emit(OpCodes.Ldfld, field); gen.EmitCall(OpCodes.Callvirt, ct.GetMethod("Equals", new Type[] { ft, ft }), null); gen.Emit(OpCodes.Brtrue_S, next); gen.Emit(OpCodes.Ldc_I4_0); gen.Emit(OpCodes.Ret); gen.MarkLabel(next); } gen.Emit(OpCodes.Ldc_I4_1); gen.Emit(OpCodes.Ret); } static void GenerateGetHashCode(TypeBuilder tb, FieldInfo[] fields) { MethodBuilder mb = tb.DefineMethod("GetHashCode", MethodAttributes.Public | MethodAttributes.ReuseSlot | MethodAttributes.Virtual | MethodAttributes.HideBySig, typeof(int), Type.EmptyTypes); ILGenerator gen = mb.GetILGenerator(); gen.Emit(OpCodes.Ldc_I4_0); foreach (FieldInfo field in fields) { Type ft = field.FieldType; Type ct = typeof(EqualityComparer<>).MakeGenericType(ft); gen.EmitCall(OpCodes.Call, ct.GetMethod("get_Default"), null); gen.Emit(OpCodes.Ldarg_0); gen.Emit(OpCodes.Ldfld, field); gen.EmitCall(OpCodes.Callvirt, ct.GetMethod("GetHashCode", new Type[] { ft }), null); gen.Emit(OpCodes.Xor); } gen.Emit(OpCodes.Ret); } } public abstract class DynamicClass { public override string ToString() { PropertyInfo[] props = GetType().GetProperties(BindingFlags.Instance | BindingFlags.Public); StringBuilder sb = new StringBuilder(); sb.Append("{"); for (int i = 0; i < props.Length; i++) { if (i > 0) sb.Append(", "); sb.Append(props[i].Name); sb.Append("="); sb.Append(props[i].GetValue(this, null)); } sb.Append("}"); return sb.ToString(); } } public class DynamicProperty { private readonly string name; private readonly Type type; public DynamicProperty(string name, Type type) { if (name == null) throw new ArgumentNullException("name"); if (type == null) throw new ArgumentNullException("type"); this.name = name; this.type = type; } public string Name { get { return name; } } public Type Type { get { return type; } } } }

    Read the article

  • excel cannot open the file xxx.xlsx' because the file format is not valid error

    - by Yavuz
    I have difficulty open opening word and excel files suddenly. Only particular office file give me the problem. These files were previously scanned by combo fix and I believe they were damaged. The error response that I from office is Excel cannot open the file xxx.xlsx because the file format is not valid. Verify that the file has not been corrupted and that the file extension matches the format of the file. This is for excel and a similar kind of error response comes for word. The file looks fine. I mean the size vise... Please help me with this problem. I really appreciate your help and time....

    Read the article

  • Upon clicking on a file, excel opens but not the file itself

    - by william
    Platform: Windows XP SP2, Excel 2007 Problem description: Upon clicking on a file in Windows Explorer (file is either .xls or .xlsx) Excel 2007 opens, but does not open the file itself. I need either to click on a file again in Windows Explorer or open it manually with File/Open ... from Excel. Does anyone know what could cause this rather strange behaviour ? The old versions of Excel worked "normally" ... i.e. upon clicking on a file, an Excel would open along with the file. Please, help !

    Read the article

  • How to write files in specific order?

    - by Bernie
    Okay, here's a weird problem -- My wife just bought a 2014 Nissan Altima. So, I took her iTunes library and converted the .m4a files to .mp3, since the car audio system only supports .mp3 and .wma. So far so good. Then I copied the files to a DOS FAT-32 formatted USB thumb drive, and connected the drive to the car's USB port, only to find all of the tracks were out of sequence. All tracks begin with a two digit numeric prefix, i.e., 01, 02, 03, etc. So you would think they would be in order. So I called Nissan Connect support and the rep told me that there is a known problem with reading files in the correct order. He said the files are read in the same order they are written. So, I manually copied a few albums with the tracks in a predetermined order, and sure enough he was correct. So I copied about 6 albums for testing, then changed to the top level directory and did a "find . music.txt". Then I passed this file to rsync like this: rsync -av --files-from=music.txt . ../Marys\ Music\ Sequenced/ The files looked like they were copied in order, but when I listed the files in order of modified time, they were in the same sequence as the original files: ../Marys Music Sequenced/Air Supply/Air Supply Greatest Hits ls -1rt 01 Lost In Love.mp3 04 Every Woman In The World.mp3 03 Chances.mp3 02 All Out Of Love.mp3 06 Here I Am (Just When I Thought I Was Over You).mp3 05 The One That You Love.mp3 08 I Want To Give It All.mp3 07 Sweet Dreams.mp3 11 Young Love.mp3 So the question is, how can I copy files listed in a file named music.txt, and copy them to a destination, and ensure the modification times are in the same sequence as the files are listed?

    Read the article

  • QFileDialog filter from mime-types

    - by Mathias
    I want the filter in a QFileDialog to match all audio file types supported by Phonon on the platform in question. 1 - However I am not able to find a way in Qt to use mime types in a filter. How can I do that? 2 - Or how can I find the corresponding file extensions for the mimetypes manually? The solution should be Qt based, or at least be cross platform and supported everywhere Qt is. Following is a short code describing my problem: #include <QApplication> #include <QFileDialog> #include <QStringList> #include <phonon/backendcapabilities.h> QString mime_to_ext(QString mime) { // WHAT TO REALLY DO ?? // NEEDLESS TO SAY; THIS IS WRONG... return mime.split("/").back().split('-').back(); } int main(int argc, char **argv) { QApplication app(argc, argv); QStringList p_audio_exts; QStringList p_mime_types = Phonon::BackendCapabilities::availableMimeTypes(); for(QStringList::iterator i = p_mime_types.begin(), ie = p_mime_types.end(); i != ie; i++) { if((*i).startsWith("audio")) p_audio_exts << mime_to_ext(*i); } QString filter = QString("All Files(*)"); if(!p_audio_exts.isEmpty()) { QString p_audio_filter = QString("Audio Files (*.%1)").arg(p_audio_exts.join(" *.")); filter = QString("%1;;%2").arg(p_audio_filter).arg(filter); } QFileDialog dialog(NULL, "Open Audio File", QString::null, filter); dialog.exec(); }

    Read the article

  • rename files with the same name

    - by snorpey
    Hi. I use the following function to rename thumbnails. For example, if I upload a file called "image.png" to an upload folder, and this folder already has a file named "image.png" in it, the new file automatically gets renamed to "image-copy-1.png". If there also is a file called "image-copy-1.png" it gets renamed to "image-copy-2.png" and so on. The following function returns the new filename. At least that's what it is supposed to do... The renaming doesn't seeem to work correctly, though. Sometimes it produces strange results, like: 1.png 1-copy-1.png 1-copy-2.png 1-copy-2-copy-1.png 1-copy-2-copy-3.png I hope you understand my problem, despite my description being somewhat complex... Can you tell me what went wrong here? (bonus question: Is regular expressions the right tool for doing this kind of stuff?) <?php function renameDuplicates($path, $file) { $fileName = pathinfo($path . $file, PATHINFO_FILENAME); $fileExtension = "." . pathinfo($path . $file, PATHINFO_EXTENSION); if(file_exists($path . $file)) { $fileCopy = $fileName . "-copy-1"; if(file_exists($path . $fileCopy . $fileExtension)) { if ($contains = preg_match_all ("/.*?(copy)(-)(\\d+)/is", $fileCopy, $matches)) { $copyIndex = $matches[3][0]; $fileName = substr($fileCopy, 0, -(strlen("-copy-" . $copyIndex))) . "-copy-" . ($copyIndex + 1); } } else { $fileName .= "-copy-1"; } } $returnValue = $fileName . $fileExtension; return $returnValue; }?>

    Read the article

  • No resource type specified (at 'id' with value '@+id\st')

    - by Refaat
    I'm new at android programming, I'm now trying to make some buttons, I configured these buttons using the following code: The MainActivity class : public class MainActivity extends Activity { /** Called when the activity is first created. */ Button st,nd,center; @Override public void onCreate(Bundle savedInstanceState) { super.onCreate(savedInstanceState); setContentView(R.layout.main); st = (Button)findViewById(R.id.st); st = (Button)findViewById(R.id.center); st = (Button)findViewById(R.id.nd); } } and the XML Layout: <?xml version="1.0" encoding="utf-8"?> <LinearLayout xmlns:android="http://schemas.android.com/apk/res/android" android:orientation="vertical" android:layout_width="fill_parent" android:layout_height="fill_parent" android:background="@drawable/background" > <TextView android:layout_width="fill_parent" android:layout_height="wrap_content" android:text="Hello from animation!!" /> <button android:layout_width="100dp" android:layout_height="50dp" android:text="1st half" android:id="@+id\st" /> // and the other two points defined the same way </LinearLayout> And i got that syntax error: error: Error: No resource type specified (at 'id' with value '@+id\st'). // and the same error with the other two buttons HINT: The R class is imported and accessible from the MainActivity class but it can't read R.id.

    Read the article

  • Flex SDK 3.5 - Check file mimetype

    - by Fernando
    Is there a way to get a file's mimetype in Flex SDK 3.5 without using its extension? I need to validate if an uploaded file is of a certain kind. This is for images, or documents (PDF, ODT, etc.) All the solutions I've found are by checking its extension. What if I rename a .odt file as a .jpg? Then I can upload it as an image... I should add, we are using an AIR desktop client and a Java EE server. File checking is solved on the Java side, but the idea is not to go to the server, validate the file so if it's not valid, there's no network traffic at all.

    Read the article

  • Setting up a local AI server - easy with Solaris 11

    - by Stefan Hinker
    Many things are new in Solaris 11, Autoinstall is one of them.  If, like me, you've known Jumpstart for the last 2 centuries or so, you'll have to start from scratch.  Well, almost, as the concepts are similar, and it's not all that difficult.  Just new. I wanted to have an AI server that I could use for demo purposes, on the train if need be.  That answers the question of hardware requirements: portable.  But let's start at the beginning. First, you need an OS image, of course.  In the new world of Solaris 11, it is now called a repository.  The original can be downloaded from the Solaris 11 page at Oracle.   What you want is the "Oracle Solaris 11 11/11 Repository Image", which comes in two parts that can be combined using cat.  MD5 checksums for these (and all other downloads from that page) are available closer to the top of the page. With that, building the repository is quick and simple: # zfs create -o mountpoint=/export/repo rpool/ai/repo # zfs create rpool/ai/repo/s11 # mount -o ro -F hsfs /tmp/sol-11-1111-repo-full.iso /mnt # rsync -aP /mnt/repo /export/repo/s11 # umount /mnt # pkgrepo rebuild -s /export/repo/sol11/repo # zfs snapshot rpool/ai/repo/sol11@fcs # pkgrepo info -s /export/repo/sol11/repo PUBLISHER PACKAGES STATUS UPDATED solaris 4292 online 2012-03-12T20:47:15.378639Z That's all there's to it.  Let's make a snapshot, just to be on the safe side.  You never know when one will come in handy.  To use this repository, you could just add it as a file-based publisher: # pkg set-publisher -g file:///export/repo/sol11/repo solaris In case I'd want to access this repository through a (virtual) network, i'll now quickly activate the repository-service: # svccfg -s application/pkg/server \ setprop pkg/inst_root=/export/repo/sol11/repo # svccfg -s application/pkg/server setprop pkg/readonly=true # svcadm refresh application/pkg/server # svcadm enable application/pkg/server That's all you need - now point your browser to http://localhost/ to view your beautiful repository-server. Step 1 is done.  All of this, by the way, is nicely documented in the README file that's contained in the repository image. Of course, we already have updates to the original release.  You can find them in MOS in the Oracle Solaris 11 Support Repository Updates (SRU) Index.  You can simply add these to your existing repository or create separate repositories for each SRU.  The individual SRUs are self-sufficient and incremental - SRU4 includes all updates from SRU2 and SRU3.  With ZFS, you can also get both: A full repository with all updates and at the same time incremental ones up to each of the updates: # mount -o ro -F hsfs /tmp/sol-11-1111-sru4-05-incr-repo.iso /mnt # pkgrecv -s /mnt/repo -d /export/repo/sol11/repo '*' # umount /mnt # pkgrepo rebuild -s /export/repo/sol11/repo # zfs snapshot rpool/ai/repo/sol11@sru4 # zfs set snapdir=visible rpool/ai/repo/sol11 # svcadm restart svc:/application/pkg/server:default The normal repository is now updated to SRU4.  Thanks to the ZFS snapshots, there is also a valid repository of Solaris 11 11/11 without the update located at /export/repo/sol11/.zfs/snapshot/fcs . If you like, you can also create another repository service for each update, running on a separate port. But now lets continue with the AI server.  Just a little bit of reading in the dokumentation makes it clear that we will need to run a DHCP server for this.  Since I already have one active (for my SunRay installation) and since it's a good idea to have these kinds of services separate anyway, I decided to create this in a Zone.  So, let's create one first: # zfs create -o mountpoint=/export/install rpool/ai/install # zfs create -o mountpoint=/zones rpool/zones # zonecfg -z ai-server zonecfg:ai-server> create create: Using system default template 'SYSdefault' zonecfg:ai-server> set zonepath=/zones/ai-server zonecfg:ai-server> add dataset zonecfg:ai-server:dataset> set name=rpool/ai/install zonecfg:ai-server:dataset> set alias=install zonecfg:ai-server:dataset> end zonecfg:ai-server> commit zonecfg:ai-server> exit # zoneadm -z ai-server install # zoneadm -z ai-server boot ; zlogin -C ai-server Give it a hostname and IP address at first boot, and there's the Zone.  For a publisher for Solaris packages, it will be bound to the "System Publisher" from the Global Zone.  The /export/install filesystem, of course, is intended to be used by the AI server.  Let's configure it now: #zlogin ai-server root@ai-server:~# pkg install install/installadm root@ai-server:~# installadm create-service -n x86-fcs -a i386 \ -s pkg://solaris/install-image/[email protected],5.11-0.175.0.0.0.2.1482 \ -d /export/install/fcs -i 192.168.2.20 -c 3 With that, the core AI server is already done.  What happened here?  First, I installed the AI server software.  IPS makes that nice and easy.  If necessary, it'll also pull in the required DHCP-Server and anything else that might be missing.  Watch out for that DHCP server software.  In Solaris 11, there are two different versions.  There's the one you might know from Solaris 10 and earlier, and then there's a new one from ISC.  The latter is the one we need for AI.  The SMF service names of both are very similar.  The "old" one is "svc:/network/dhcp-server:default". The ISC-server comes with several SMF-services. We at least need "svc:/network/dhcp/server:ipv4".  The command "installadm create-service" creates the installation-service. It's called "x86-fcs", serves the "i386" architecture and gets its boot image from the repository of the system publisher, using version 5.11,5.11-0.175.0.0.0.2.1482, which is Solaris 11 11/11.  (The option "-a i386" in this example is optional, since the installserver itself runs on a x86 machine.) The boot-environment for clients is created in /export/install/fcs and the DHCP-server is configured for 3 IP-addresses starting at 192.168.2.20.  This configuration is stored in a very human readable form in /etc/inet/dhcpd4.conf.  An AI-service for SPARC systems could be created in the very same way, using "-a sparc" as the architecture option. Now we would be ready to register and install the first client.  It would be installed with the default "solaris-large-server" using the publisher "http://pkg.oracle.com/solaris/release" and would query it's configuration interactively at first boot.  This makes it very clear that an AI-server is really only a boot-server.  The true source of packets to install can be different.  Since I don't like these defaults for my demo setup, I did some extra config work for my clients. The configuration of a client is controlled by manifests and profiles.  The manifest controls which packets are installed and how the filesystems are layed out.  In that, it's very much like the old "rules.ok" file in Jumpstart.  Profiles contain additional configuration like root passwords, primary user account, IP addresses, keyboard layout etc.  Hence, profiles are very similar to the old sysid.cfg file. The easiest way to get your hands on a manifest is to ask the AI server we just created to give us it's default one.  Then modify that to our liking and give it back to the installserver to use: root@ai-server:~# mkdir -p /export/install/configs/manifests root@ai-server:~# cd /export/install/configs/manifests root@ai-server:~# installadm export -n x86-fcs -m orig_default \ -o orig_default.xml root@ai-server:~# cp orig_default.xml s11-fcs.small.local.xml root@ai-server:~# vi s11-fcs.small.local.xml root@ai-server:~# more s11-fcs.small.local.xml <!DOCTYPE auto_install SYSTEM "file:///usr/share/install/ai.dtd.1"> <auto_install> <ai_instance name="S11 Small fcs local"> <target> <logical> <zpool name="rpool" is_root="true"> <filesystem name="export" mountpoint="/export"/> <filesystem name="export/home"/> <be name="solaris"/> </zpool> </logical> </target> <software type="IPS"> <destination> <image> <!-- Specify locales to install --> <facet set="false">facet.locale.*</facet> <facet set="true">facet.locale.de</facet> <facet set="true">facet.locale.de_DE</facet> <facet set="true">facet.locale.en</facet> <facet set="true">facet.locale.en_US</facet> </image> </destination> <source> <publisher name="solaris"> <origin name="http://192.168.2.12/"/> </publisher> </source> <!-- By default the latest build available, in the specified IPS repository, is installed. If another build is required, the build number has to be appended to the 'entire' package in the following form: <name>pkg:/[email protected]#</name> --> <software_data action="install"> <name>pkg:/[email protected],5.11-0.175.0.0.0.2.0</name> <name>pkg:/group/system/solaris-small-server</name> </software_data> </software> </ai_instance> </auto_install> root@ai-server:~# installadm create-manifest -n x86-fcs -d \ -f ./s11-fcs.small.local.xml root@ai-server:~# installadm list -m -n x86-fcs Manifest Status Criteria -------- ------ -------- S11 Small fcs local Default None orig_default Inactive None The major points in this new manifest are: Install "solaris-small-server" Install a few locales less than the default.  I'm not that fluid in French or Japanese... Use my own package service as publisher, running on IP address 192.168.2.12 Install the initial release of Solaris 11:  pkg:/[email protected],5.11-0.175.0.0.0.2.0 Using a similar approach, I'll create a default profile interactively and use it as a template for a few customized building blocks, each defining a part of the overall system configuration.  The modular approach makes it easy to configure numerous clients later on: root@ai-server:~# mkdir -p /export/install/configs/profiles root@ai-server:~# cd /export/install/configs/profiles root@ai-server:~# sysconfig create-profile -o default.xml root@ai-server:~# cp default.xml general.xml; cp default.xml mars.xml root@ai-server:~# cp default.xml user.xml root@ai-server:~# vi general.xml mars.xml user.xml root@ai-server:~# more general.xml mars.xml user.xml :::::::::::::: general.xml :::::::::::::: <!DOCTYPE service_bundle SYSTEM "/usr/share/lib/xml/dtd/service_bundle.dtd.1"> <service_bundle type="profile" name="sysconfig"> <service version="1" type="service" name="system/timezone"> <instance enabled="true" name="default"> <property_group type="application" name="timezone"> <propval type="astring" name="localtime" value="Europe/Berlin"/> </property_group> </instance> </service> <service version="1" type="service" name="system/environment"> <instance enabled="true" name="init"> <property_group type="application" name="environment"> <propval type="astring" name="LANG" value="C"/> </property_group> </instance> </service> <service version="1" type="service" name="system/keymap"> <instance enabled="true" name="default"> <property_group type="system" name="keymap"> <propval type="astring" name="layout" value="US-English"/> </property_group> </instance> </service> <service version="1" type="service" name="system/console-login"> <instance enabled="true" name="default"> <property_group type="application" name="ttymon"> <propval type="astring" name="terminal_type" value="vt100"/> </property_group> </instance> </service> <service version="1" type="service" name="network/physical"> <instance enabled="true" name="default"> <property_group type="application" name="netcfg"> <propval type="astring" name="active_ncp" value="DefaultFixed"/> </property_group> </instance> </service> <service version="1" type="service" name="system/name-service/switch"> <property_group type="application" name="config"> <propval type="astring" name="default" value="files"/> <propval type="astring" name="host" value="files dns"/> <propval type="astring" name="printer" value="user files"/> </property_group> <instance enabled="true" name="default"/> </service> <service version="1" type="service" name="system/name-service/cache"> <instance enabled="true" name="default"/> </service> <service version="1" type="service" name="network/dns/client"> <property_group type="application" name="config"> <property type="net_address" name="nameserver"> <net_address_list> <value_node value="192.168.2.1"/> </net_address_list> </property> </property_group> <instance enabled="true" name="default"/> </service> </service_bundle> :::::::::::::: mars.xml :::::::::::::: <!DOCTYPE service_bundle SYSTEM "/usr/share/lib/xml/dtd/service_bundle.dtd.1"> <service_bundle type="profile" name="sysconfig"> <service version="1" type="service" name="network/install"> <instance enabled="true" name="default"> <property_group type="application" name="install_ipv4_interface"> <propval type="astring" name="address_type" value="static"/> <propval type="net_address_v4" name="static_address" value="192.168.2.100/24"/> <propval type="astring" name="name" value="net0/v4"/> <propval type="net_address_v4" name="default_route" value="192.168.2.1"/> </property_group> <property_group type="application" name="install_ipv6_interface"> <propval type="astring" name="stateful" value="yes"/> <propval type="astring" name="stateless" value="yes"/> <propval type="astring" name="address_type" value="addrconf"/> <propval type="astring" name="name" value="net0/v6"/> </property_group> </instance> </service> <service version="1" type="service" name="system/identity"> <instance enabled="true" name="node"> <property_group type="application" name="config"> <propval type="astring" name="nodename" value="mars"/> </property_group> </instance> </service> </service_bundle> :::::::::::::: user.xml :::::::::::::: <!DOCTYPE service_bundle SYSTEM "/usr/share/lib/xml/dtd/service_bundle.dtd.1"> <service_bundle type="profile" name="sysconfig"> <service version="1" type="service" name="system/config-user"> <instance enabled="true" name="default"> <property_group type="application" name="root_account"> <propval type="astring" name="login" value="root"/> <propval type="astring" name="password" value="noIWillNotTellYouMyPasswordNotEvenEncrypted"/> <propval type="astring" name="type" value="role"/> </property_group> <property_group type="application" name="user_account"> <propval type="astring" name="login" value="stefan"/> <propval type="astring" name="password" value="noIWillNotTellYouMyPasswordNotEvenEncrypted"/> <propval type="astring" name="type" value="normal"/> <propval type="astring" name="description" value="Stefan Hinker"/> <propval type="count" name="uid" value="12345"/> <propval type="count" name="gid" value="10"/> <propval type="astring" name="shell" value="/usr/bin/bash"/> <propval type="astring" name="roles" value="root"/> <propval type="astring" name="profiles" value="System Administrator"/> <propval type="astring" name="sudoers" value="ALL=(ALL) ALL"/> </property_group> </instance> </service> </service_bundle> root@ai-server:~# installadm create-profile -n x86-fcs -f general.xml root@ai-server:~# installadm create-profile -n x86-fcs -f user.xml root@ai-server:~# installadm create-profile -n x86-fcs -f mars.xml \ -c ipv4=192.168.2.100 root@ai-server:~# installadm list -p Service Name Profile ------------ ------- x86-fcs general.xml mars.xml user.xml root@ai-server:~# installadm list -n x86-fcs -p Profile Criteria ------- -------- general.xml None mars.xml ipv4 = 192.168.2.100 user.xml None Here's the idea behind these files: "general.xml" contains settings valid for all my clients.  Stuff like DNS servers, for example, which in my case will always be the same. "user.xml" only contains user definitions.  That is, a root password and a primary user.Both of these profiles will be valid for all clients (for now). "mars.xml" defines network settings for an individual client.  This profile is associated with an IP-Address.  For this to work, I'll have to tweak the DHCP-settings in the next step: root@ai-server:~# installadm create-client -e 08:00:27:AA:3D:B1 -n x86-fcs root@ai-server:~# vi /etc/inet/dhcpd4.conf root@ai-server:~# tail -5 /etc/inet/dhcpd4.conf host 080027AA3DB1 { hardware ethernet 08:00:27:AA:3D:B1; fixed-address 192.168.2.100; filename "01080027AA3DB1"; } This completes the client preparations.  I manually added the IP-Address for mars to /etc/inet/dhcpd4.conf.  This is needed for the "mars.xml" profile.  Disabling arbitrary DHCP-replies will shut up this DHCP server, making my life in a shared environment a lot more peaceful ;-)Now, I of course want this installation to be completely hands-off.  For this to work, I'll need to modify the grub boot menu for this client slightly.  You can find it in /etc/netboot.  "installadm create-client" will create a new boot menu for every client, identified by the client's MAC address.  The template for this can be found in a subdirectory with the name of the install service, /etc/netboot/x86-fcs in our case.  If you don't want to change this manually for every client, modify that template to your liking instead. root@ai-server:~# cd /etc/netboot root@ai-server:~# cp menu.lst.01080027AA3DB1 menu.lst.01080027AA3DB1.org root@ai-server:~# vi menu.lst.01080027AA3DB1 root@ai-server:~# diff menu.lst.01080027AA3DB1 menu.lst.01080027AA3DB1.org 1,2c1,2 < default=1 < timeout=10 --- > default=0 > timeout=30 root@ai-server:~# more menu.lst.01080027AA3DB1 default=1 timeout=10 min_mem64=0 title Oracle Solaris 11 11/11 Text Installer and command line kernel$ /x86-fcs/platform/i86pc/kernel/$ISADIR/unix -B install_media=htt p://$serverIP:5555//export/install/fcs,install_service=x86-fcs,install_svc_addre ss=$serverIP:5555 module$ /x86-fcs/platform/i86pc/$ISADIR/boot_archive title Oracle Solaris 11 11/11 Automated Install kernel$ /x86-fcs/platform/i86pc/kernel/$ISADIR/unix -B install=true,inst all_media=http://$serverIP:5555//export/install/fcs,install_service=x86-fcs,inst all_svc_address=$serverIP:5555,livemode=text module$ /x86-fcs/platform/i86pc/$ISADIR/boot_archive Now just boot the client off the network using PXE-boot.  For my demo purposes, that's a client from VirtualBox, of course.  That's all there's to it.  And despite the fact that this blog entry is a little longer - that wasn't that hard now, was it?

    Read the article

< Previous Page | 24 25 26 27 28 29 30 31 32 33 34 35  | Next Page >