Search Results

Search found 89549 results on 3582 pages for 'large file support'.

facebook twitter digg google delicious technorati stumbleupon myspace wordpress linkedin gmail igoogle windows live tumblr viadeo yahoo buzz yahoo mail yahoo bookmarks favorites email print

Page 28/3582 | < Previous Page | 24 25 26 27 28 29 30 31 32 33 34 35  | Next Page >

  • Avoid an "out of memory error" in Java(eclipse), when using large data structure?

    - by gnomed
    OK, so I am writing a program that unfortunately needs to use a huge data structure to complete its work, but it is failing with a "out of memory error" during its initialization. While I understand entirely what that means and why it is a problem, I am having trouble overcoming it, since my program needs to use this large structure and I don't know any other way to store it. The program first indexes a large corpus of text files that I provide. This works fine. Then it uses this index to initialize a large 2D array. This array will have nXn entries, where "n" is the number of unique words in the corpus of text. For the relatively small chunk I am testing it on(about 60 files) it needs to make approximately 30,000x30,000 entries. this will probably be bigger once I run it on my full intended corpus too. It consistently fails every time, after it indexes, while it is initializing the data structure(to be worked on later). Things I have done include: revamp my code to use a primitive "int[]" instead of a "TreeMap" eliminate redundant structures, etc... Also, I have run eclipse with "eclipse -vmargs -Xmx2g" to max out my allocated memory I am fairly confident this is not going to be a simple line of code solution, but is most likely going to require a very new approach. I am looking for what that approach is, any ideas? Thanks, B.

    Read the article

  • Adding multiple data importers support to web applications

    - by DigiMortal
    I’m building web application for customer and there is requirement that users must be able to import data in different formats. Today we will support XLSX and ODF as import formats and some other formats are waiting. I wanted to be able to add new importers on the fly so I don’t have to deploy web application again when I add new importer or change some existing one. In this posting I will show you how to build generic importers support to your web application. Importer interface All importers we use must have something in common so we can easily detect them. To keep things simple I will use interface here. public interface IMyImporter {     string[] SupportedFileExtensions { get; }     ImportResult Import(Stream fileStream, string fileExtension); } Our interface has the following members: SupportedFileExtensions – string array of file extensions that importer supports. This property helps us find out what import formats are available and which importer to use with given format. Import – method that does the actual importing work. Besides file we give in as stream we also give file extension so importer can decide how to handle the file. It is enough to get started. When building real importers I am sure you will switch over to abstract base class. Importer class Here is sample importer that imports data from Excel and Word documents. Importer class with no implementation details looks like this: public class MyOpenXmlImporter : IMyImporter {     public string[] SupportedFileExtensions     {         get { return new[] { "xlsx", "docx" }; }     }     public ImportResult Import(Stream fileStream, string extension)     {         // ...     } } Finding supported import formats in web application Now we have importers created and it’s time to add them to web application. Usually we have one page or ASP.NET MVC controller where we need importers. To this page or controller we add the following method that uses reflection to find all classes that implement our IMyImporter interface. private static string[] GetImporterFileExtensions() {     var types = from a in AppDomain.CurrentDomain.GetAssemblies()                 from t in a.GetTypes()                 where t.GetInterfaces().Contains(typeof(IMyImporter))                 select t;       var extensions = new Collection<string>();     foreach (var type in types)     {         var instance = (IMyImporter)type.InvokeMember(null,                        BindingFlags.CreateInstance, null, null, null);           foreach (var extension in instance.SupportedFileExtensions)         {             if (extensions.Contains(extension))                 continue;               extensions.Add(extension);         }     }       return extensions.ToArray(); } This code doesn’t look nice and is far from optimal but it works for us now. It is possible to improve performance of web application if we cache extensions and their corresponding types to some static dictionary. We have to fill it only once because our application is restarted when something changes in bin folder. Finding importer by extension When user uploads file we need to detect the extension of file and find the importer that supports given extension. We add another method to our page or controller that uses reflection to return us importer instance or null if extension is not supported. private static IMyImporter GetImporterForExtension(string extensionToFind) {     var types = from a in AppDomain.CurrentDomain.GetAssemblies()                 from t in a.GetTypes()                 where t.GetInterfaces().Contains(typeof(IMyImporter))                 select t;     foreach (var type in types)     {         var instance = (IMyImporter)type.InvokeMember(null,                        BindingFlags.CreateInstance, null, null, null);           if (instance.SupportedFileExtensions.Contains(extensionToFind))         {             return instance;         }     }       return null; } Here is example ASP.NET MVC controller action that accepts uploaded file, finds importer that can handle file and imports data. Again, this is sample code I kept minimal to better illustrate how things work. public ActionResult Import(MyImporterModel model) {     var file = Request.Files[0];     var extension = Path.GetExtension(file.FileName).ToLower();     var importer = GetImporterForExtension(extension.Substring(1));     var result = importer.Import(file.InputStream, extension);     if (result.Errors.Count > 0)     {         foreach (var error in result.Errors)             ModelState.AddModelError("file", error);           return Import();     }     return RedirectToAction("Index"); } Conclusion That’s it. Using couple of ugly methods and one simple interface we were able to add importers support to our web application. Example code here is not perfect but it works. It is possible to cache mappings between file extensions and importer types to some static variable because changing of these mappings means that something is changed in bin folder of web application and web application is restarted in this case anyway.

    Read the article

  • Copy mdf file and use it in run time

    - by Anibas
    After I copy mdf file (and his log file) I tries to Insert data. I receive the following message: "An attempt to attach an auto-named database for file [fileName].mdf failed. A database with the same name exists, or specified file cannot be opened, or it is located on UNC share. When I copied the file manual everything worked normally. Is it correct the order File.Copy leaves the file engaged?

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • Designing a database file format

    - by RoliSoft
    I would like to design my own database engine for educational purposes, for the time being. Designing a binary file format is not hard nor the question, I've done it in the past, but while designing a database file format, I have come across a very important question: How to handle the deletion of an item? So far, I've thought of the following two options: Each item will have a "deleted" bit which is set to 1 upon deletion. Pro: relatively fast. Con: potentially sensitive data will remain in the file. 0x00 out the whole item upon deletion. Pro: potentially sensitive data will be removed from the file. Con: relatively slow. Recreating the whole database. Pro: no empty blocks which makes the follow-up question void. Con: it's a really good idea to overwrite the whole 4 GB database file because a user corrected a typo. I will sell this method to Twitter ASAP! Now let's say you already have a few empty blocks in your database (deleted items). The follow-up question is how to handle the insertion of a new item? Append the item to the end of the file. Pro: fastest possible. Con: file will get huge because of all the empty blocks that remain because deleted items aren't actually deleted. Search for an empty block exactly the size of the one you're inserting. Pro: may get rid of some blocks. Con: you may end up scanning the whole file at each insert only to find out it's very unlikely to come across a perfectly fitting empty block. Find the first empty block which is equal or larger than the item you're inserting. Pro: you probably won't end up scanning the whole file, as you will find an empty block somewhere mid-way; this will keep the file size relatively low. Con: there will still be lots of leftover 0x00 bytes at the end of items which were inserted into bigger empty blocks than they are. Rigth now, I think the first deletion method and the last insertion method are probably the "best" mix, but they would still have their own small issues. Alternatively, the first insertion method and scheduled full database recreation. (Probably not a good idea when working with really large databases. Also, each small update in that method will clone the whole item to the end of the file, thus accelerating file growth at a potentially insane rate.) Unless there is a way of deleting/inserting blocks from/to the middle of the file in a file-system approved way, what's the best way to do this? More importantly, how do databases currently used in production usually handle this?

    Read the article

  • Reading data from text file in C

    - by themake
    I have a text file which contains words separated by space. I want to take each word from the file and store it. So i have opened the file but am unsure how to assign the word to a char. FILE *fp; fp = fopen("file.txt", "r"); //then i want char one = the first word in the file char two = the second word in the file

    Read the article

  • opening and viewing a file in php

    - by Christian Burgos
    how do i open/view for editing an uploaded file in php? i have tried this but it doesn't open the file. $my_file = 'file.txt'; $handle = fopen($my_file, 'r'); $data = fread($handle,filesize($my_file)); i've also tried this but it wont work. $my_file = 'file.txt'; $handle = fopen($my_file, 'w') or die('Cannot open file: '.$my_file); $data = 'This is the data'; fwrite($handle, $data); what i have in mind is like when you want to view an uploaded resume,documents or any other ms office files like .docx,.xls,.pptx and be able to edit them, save and close the said file. edit: latest tried code... <?php // Connects to your Database include "configdb.php"; //Retrieves data from MySQL $data = mysql_query("SELECT * FROM employees") or die(mysql_error()); //Puts it into an array while($info = mysql_fetch_array( $data )) { //Outputs the image and other data //Echo "<img src=localhost/uploadfile/images".$info['photo'] ."> <br>"; Echo "<b>Name:</b> ".$info['name'] . "<br> "; Echo "<b>Email:</b> ".$info['email'] . " <br>"; Echo "<b>Phone:</b> ".$info['phone'] . " <hr>"; //$file=fopen("uploadfile/images/".$info['photo'],"r+"); $file=fopen("Applications/XAMPP/xamppfiles/htdocs/uploadfile/images/file.odt","r") or exit("unable to open file");; } ?> i am getting the error: Warning: fopen(Applications/XAMPP/xamppfiles/htdocs/uploadfile/images/file.odt): failed to open stream: No such file or directory in /Applications/XAMPP/xamppfiles/htdocs/uploadfile/view.php on line 17 unable to open file the file is in that folder, i don't know it wont find it.

    Read the article

  • Copied a file with winscp; only winscp can see it

    - by nilbus
    I recently copied a 25.5GB file from another machine using WinSCP. I copied it to C:\beth.tar.gz, and WinSCP can still see the file. However no other app (including Explorer) can see the file. What might cause this, and how can I fix it? The details that might or might not matter WinSCP shows the size of the file (C:\beth.tar.gz) correctly as 27,460,124,080 bytes, which matches the filesize on the remote host Neither explorer, cmd (command line prompt w/ dir C:\), the 7Zip archive program, nor any other File Open dialog can see the beth.tar.gz file under C:\ I have configured Explorer to show hidden files I can move the file to other directories using WinSCP If I try to move the file to Users/, UAC prompts me for administrative rights, which I grant, and I get this error: Could not find this item The item is no longer located in C:\ When I try to transfer the file back to the remote host in a new directory, the transfer starts successfully and transfers data The transfer had about 30 minutes remaining when I left it for the night The morning after the file transfer, I was greeted with a message saying that the connection to the server had been lost. I don't think this is relevant, since I did not tell it to disconnect after the file was done transferring, and it likely disconnected after the file transfer finished. I'm using an old version of WinSCP - v4.1.8 from 2008 I can view the file properties in WinSCP: Type of file: 7zip (.gz) Location: C:\ Attributes: none (Ready-only, Hidden, Archive, or Ready for indexing) Security: SYSTEM, my user, and Administrators group have full permissions - everything other than "special permissions" is checked under Allow for all 3 users/groups (my user, Administrators, SYSTEM) What's going on?!

    Read the article

  • C++, Ifstream opens local file but not file on HTTP Server

    - by fammi
    Hi, I am using ifstream to open a file and then read from it. My program works fine when i give location of the local file on my system. for eg /root/Desktop/abc.xxx works fine But once the location is on the http server the file fails to open. for eg http://192.168.0.10/abc.xxx fails to open. Is there any alternate for ifstream when using a URL address? thanks. part of the code where having problem: bool readTillEof = (endIndex == -1) ? true : false; // Open the file in binary mode and seek to the end to determine file size ifstream file ( fileName.c_str ( ), ios::in|ios::ate|ios::binary ); if ( file.is_open ( ) ) { long size = (long) file.tellg ( ); long numBytesRead; if ( readTillEof ) { numBytesRead = size - startIndex; } else { numBytesRead = endIndex - startIndex + 1; } // Allocate a new buffer ptr to read in the file data BufferSptr buf (new Buffer ( numBytesRead ) ); mpStreamingClientEngine->SetResponseBuffer ( nextRequest, buf ); // Seek to the start index of the byte range // and read the data file.seekg ( startIndex, ios::beg ); file.read ( (char *)buf->GetData(), numBytesRead ); // Pass on the data to the SCE // and signal completion of request mpStreamingClientEngine->HandleDataReceived( nextRequest, numBytesRead); mpStreamingClientEngine->MarkRequestCompleted( nextRequest ); // Close the file file.close ( ); } else { // Report error to the Streaming Client Engine // as unable to open file AHS_ERROR ( ConnectionManager, " Error while opening file \"%s\"\n", fileName.c_str ( ) ); mpStreamingClientEngine->HandleRequestFailed( nextRequest, CONNECTION_FAILED ); } }

    Read the article

  • How do I open a file in such a way that if the file doesn't exist it will be created and opened automatically?

    - by snakile
    Here's how I open a file for writing+ : if( fopen_s( &f, fileName, "w+" ) !=0 ) { printf("Open file failed\n"); return; } fprintf_s(f, "content"); If the file doesn't exist the open operation fails. What's the right way to fopen if I want to create the file automatically if the file doesn't already exist? EDIT: If the file does exist, I would like fprintf to overwrite the file, not to append to it.

    Read the article

  • Problem with File uplolad in javascript.

    - by Nikhil
    I have used javascript to upload more than one file. when user clicks on 'add more' javascript appends new object to older div using innerHTML. Now the problem is if I select a file and then click on "add more" then new file button exist but older selected file removes and two blank file buttons display. I want this old file must be selected when user add new file button. If anybody can, Help Plz!!! tnX.

    Read the article

  • Split large file, have arbitrary start index number

    - by nEJC
    I do a lot of file manipulation on my system and in one particular batch job I end up with around 16 Gb file. I need to prepare this data into smaller chunks for another process. I split it into 10k lines per file and numeric index, padded to 5 digits split -a 5 -d -l 10000 large_input_file /out_path/out. This way I end up with files named out.00000 out.00001 ... The problem is that this way indexing always starts with 0. Is there a way to set it to arbitrary starting index? man reveals nothing ...

    Read the article

  • excel cannot open the file xxx.xlsx' because the file format is not valid error

    - by Yavuz
    I have difficulty open opening word and excel files suddenly. Only particular office file give me the problem. These files were previously scanned by combo fix and I believe they were damaged. The error response that I from office is Excel cannot open the file xxx.xlsx because the file format is not valid. Verify that the file has not been corrupted and that the file extension matches the format of the file. This is for excel and a similar kind of error response comes for word. The file looks fine. I mean the size vise... Please help me with this problem. I really appreciate your help and time....

    Read the article

  • Upon clicking on a file, excel opens but not the file itself

    - by william
    Platform: Windows XP SP2, Excel 2007 Problem description: Upon clicking on a file in Windows Explorer (file is either .xls or .xlsx) Excel 2007 opens, but does not open the file itself. I need either to click on a file again in Windows Explorer or open it manually with File/Open ... from Excel. Does anyone know what could cause this rather strange behaviour ? The old versions of Excel worked "normally" ... i.e. upon clicking on a file, an Excel would open along with the file. Please, help !

    Read the article

  • How to write files in specific order?

    - by Bernie
    Okay, here's a weird problem -- My wife just bought a 2014 Nissan Altima. So, I took her iTunes library and converted the .m4a files to .mp3, since the car audio system only supports .mp3 and .wma. So far so good. Then I copied the files to a DOS FAT-32 formatted USB thumb drive, and connected the drive to the car's USB port, only to find all of the tracks were out of sequence. All tracks begin with a two digit numeric prefix, i.e., 01, 02, 03, etc. So you would think they would be in order. So I called Nissan Connect support and the rep told me that there is a known problem with reading files in the correct order. He said the files are read in the same order they are written. So, I manually copied a few albums with the tracks in a predetermined order, and sure enough he was correct. So I copied about 6 albums for testing, then changed to the top level directory and did a "find . music.txt". Then I passed this file to rsync like this: rsync -av --files-from=music.txt . ../Marys\ Music\ Sequenced/ The files looked like they were copied in order, but when I listed the files in order of modified time, they were in the same sequence as the original files: ../Marys Music Sequenced/Air Supply/Air Supply Greatest Hits ls -1rt 01 Lost In Love.mp3 04 Every Woman In The World.mp3 03 Chances.mp3 02 All Out Of Love.mp3 06 Here I Am (Just When I Thought I Was Over You).mp3 05 The One That You Love.mp3 08 I Want To Give It All.mp3 07 Sweet Dreams.mp3 11 Young Love.mp3 So the question is, how can I copy files listed in a file named music.txt, and copy them to a destination, and ensure the modification times are in the same sequence as the files are listed?

    Read the article

  • rename files with the same name

    - by snorpey
    Hi. I use the following function to rename thumbnails. For example, if I upload a file called "image.png" to an upload folder, and this folder already has a file named "image.png" in it, the new file automatically gets renamed to "image-copy-1.png". If there also is a file called "image-copy-1.png" it gets renamed to "image-copy-2.png" and so on. The following function returns the new filename. At least that's what it is supposed to do... The renaming doesn't seeem to work correctly, though. Sometimes it produces strange results, like: 1.png 1-copy-1.png 1-copy-2.png 1-copy-2-copy-1.png 1-copy-2-copy-3.png I hope you understand my problem, despite my description being somewhat complex... Can you tell me what went wrong here? (bonus question: Is regular expressions the right tool for doing this kind of stuff?) <?php function renameDuplicates($path, $file) { $fileName = pathinfo($path . $file, PATHINFO_FILENAME); $fileExtension = "." . pathinfo($path . $file, PATHINFO_EXTENSION); if(file_exists($path . $file)) { $fileCopy = $fileName . "-copy-1"; if(file_exists($path . $fileCopy . $fileExtension)) { if ($contains = preg_match_all ("/.*?(copy)(-)(\\d+)/is", $fileCopy, $matches)) { $copyIndex = $matches[3][0]; $fileName = substr($fileCopy, 0, -(strlen("-copy-" . $copyIndex))) . "-copy-" . ($copyIndex + 1); } } else { $fileName .= "-copy-1"; } } $returnValue = $fileName . $fileExtension; return $returnValue; }?>

    Read the article

  • Getting developers and support to work together

    - by Matt Watson
    Agile development has ushered in the norm of rapid iterations and change within products. One of the biggest challenges for agile development is educating the rest of the company. At my last company our biggest challenge was trying to continually train 100 employees in our customer support and training departments. It's easy to write release notes and email them to everyone. But for complex software products, release notes are not usually enough detail. You really have to educate your employees on the WHO, WHAT, WHERE, WHY, WHEN of every item. If you don't do this, you end up with customer service people who know less about your product than your users do. Ever call a company and feel like you know more about their product than their customer service people do? Yeah. I'm talking about that problem.WHO does the change effect?WHAT was the actual change?WHERE do I find the change in the product?WHY was the change made? (It's hard to support something if you don't know why it was done.)WHEN will the change be released?One thing I want to stress is the importance of the WHY something was done. For customer support people to be really good at their job, they need to understand the product and how people use it. Knowing how to enable a feature is one thing. Knowing why someone would want to enable it, is a whole different thing and the difference in good customer service. Another challenge is getting support people to better test and document potential bugs before escalating them to development. Trying to fix bugs without examples is always fun... NOT. They might as well say "The sky is falling, please fix it!"We need to over train the support staff about product changes and continually stress how they document and test potential product bugs. You also have to train the sales staff and the marketing team. Then there is updating sales materials, your website, product documentation and other items there are always out of date. Every product release causes this vicious circle of trying to educate the rest of the company about the changes.Do we need to record a simple video explaining the changes and email it to everyone? Maybe we should  use a simple online training type app to help with this problem. Ultimately the struggle is taking the time to do the training, but it is time well spent. It may save you a lot of time answering questions and fixing bugs later. How do we efficiently transfer key product knowledge from developers and product owners to the rest of the company? How have you solved these issues at your company?

    Read the article

  • Why does DataInputStream not support integers?

    - by Jason
    I need to read in a list of numbers from a file, none of which are larger than 32767. Originally I was going to use the Scanner class to pull in the data, then I read about DataInputStream. This would work well for me, except that according to the API, it supports all primitive variables EXCEPT ints! Listed are longs, shorts, bytes, chars, booleans, ect, but no ints. I have no need for double precision from the incoming data. Is this a deliberate or unintentional oversight?

    Read the article

  • How to Configure Windows Machine to Allow File Sharing with DNS Alias

    - by Michael Ferrante
    I have not seen a single article posted anywhere online that brings together all the settings one would need to do to make this work properly on Windows, so I thought I would post it here. To facilitate failover schemes, a common technique is to use DNS CNAME records (DNS Aliases) for different machine roles. Then instead of changing the Windows computername of the actual machine name, one can switch a DNS record to point to a new host. This can work on Microsoft Windows machines, but to make it work with file sharing the following configuration steps need to be taken. Outline The Problem The Solution Allowing other machines to use filesharing via the DNS Alias (DisableStrictNameChecking) Allowing server machine to use filesharing with itself via the DNS Alias (BackConnectionHostNames) Providing browse capabilities for multiple NetBIOS names (OptionalNames) Register the Kerberos service principal names (SPNs) for other Windows functions like Printing (setspn) References 1. The Problem On Windows machines, file sharing can work via the computer name, with or without full qualification, or by the IP Address. By default, however, filesharing will not work with arbitrary DNS aliases. To enable filesharing and other Windows services to work with DNS aliases, you must make registry changes as detailed below and reboot the machine. 2. The Solution Allowing other machines to use filesharing via the DNS Alias (DisableStrictNameChecking) This change alone will allow other machines on the network to connect to the machine using any arbitrary hostname. (However this change will not allow a machine to connect to itself via a hostname, see BackConnectionHostNames below). Edit the registry key HKEY_LOCAL_MACHINE\SYSTEM\CurrentControlSet\Services\lanmanserver\parameters and add a value DisableStrictNameChecking of type DWORD set to 1. Allowing server machine to use filesharing with itself via the DNS Alias (BackConnectionHostNames) This change is necessary for a DNS alias to work with filesharing from a machine to find itself. This creates the Local Security Authority host names that can be referenced in an NTLM authentication request. To do this, follow these steps for all the nodes on the client computer: To the registry subkey HKEY_LOCAL_MACHINE\SYSTEM\CurrentControlSet\Control\Lsa\MSV1_0, add new Multi-String Value BackConnectionHostNames In the Value data box, type the CNAME or the DNS alias, that is used for the local shares on the computer, and then click OK. Note: Type each host name on a separate line. Providing browse capabilities for multiple NetBIOS names (OptionalNames) Allows ability to see the network alias in the network browse list. Edit the registry key HKEY_LOCAL_MACHINE\SYSTEM\CurrentControlSet\Services\lanmanserver\parameters and add a value OptionalNames of type Multi-String Add in a newline delimited list of names that should be registered under the NetBIOS browse entries Names should match NetBIOS conventions (i.e. not FQDN, just hostname) Register the Kerberos service principal names (SPNs) for other Windows functions like Printing (setspn) NOTE: Should not need to do this for basic functions to work, documented here for completeness. We had one situation in which the DNS alias was not working because there was an old SPN record interfering, so if other steps aren't working check if there are any stray SPN records. You must register the Kerberos service principal names (SPNs), the host name, and the fully-qualified domain name (FQDN) for all the new DNS alias (CNAME) records. If you do not do this, a Kerberos ticket request for a DNS alias (CNAME) record may fail and return the error code KDC_ERR_S_SPRINCIPAL_UNKNOWN. To view the Kerberos SPNs for the new DNS alias records, use the Setspn command-line tool (setspn.exe). The Setspn tool is included in Windows Server 2003 Support Tools. You can install Windows Server 2003 Support Tools from the Support\Tools folder of the Windows Server 2003 startup disk. How to use the tool to list all records for a computername: setspn -L computername To register the SPN for the DNS alias (CNAME) records, use the Setspn tool with the following syntax: setspn -A host/your_ALIAS_name computername setspn -A host/your_ALIAS_name.company.com computername 3. References All the Microsoft references work via: http://support.microsoft.com/kb/ Connecting to SMB share on a Windows 2000-based computer or a Windows Server 2003-based computer may not work with an alias name Covers the basics of making file sharing work properly with DNS alias records from other computers to the server computer. KB281308 Error message when you try to access a server locally by using its FQDN or its CNAME alias after you install Windows Server 2003 Service Pack 1: "Access denied" or "No network provider accepted the given network path" Covers how to make the DNS alias work with file sharing from the file server itself. KB926642 How to consolidate print servers by using DNS alias (CNAME) records in Windows Server 2003 and in Windows 2000 Server Covers more complex scenarios in which records in Active Directory may need to be updated for certain services to work properly and for browsing for such services to work properly, how to register the Kerberos service principal names (SPNs). KB870911 Distributed File System update to support consolidation roots in Windows Server 2003 Covers even more complex scenarios with DFS (discusses OptionalNames). KB829885

    Read the article

facebook twitter digg google delicious technorati stumbleupon myspace wordpress linkedin gmail igoogle windows live tumblr viadeo yahoo buzz yahoo mail yahoo bookmarks favorites email print

< Previous Page | 24 25 26 27 28 29 30 31 32 33 34 35  | Next Page >