Search Results

Search found 11767 results on 471 pages for 'org'.

Page 282/471 | < Previous Page | 278 279 280 281 282 283 284 285 286 287 288 289  | Next Page >

• Expertise Location [closed]

  - by Alexey Shatygin

  Is there some really working implementations of the expertise location systems exist? It is very hard to find anything about it. What sources to use, what to read, where to look? I've started with reading David W. McDonald's, Mark S. Ackerman's overview "Just talk to me" and now need just something more detailed. For those, who voting this question to be closed for off-topic: it is connected to IT sphere, if you don't know what it is - why ever vote? http://en.wikipedia.org/wiki/Expertise_finding http://citeseerx.ist.psu.edu/viewdoc/download?doi=10.1.1.40.4654&rep=rep1&type=pdf

  Read the article

• Disable passwd history feature with remember=0

  - by user1915177

  PAM version - pam-0.79 Is setting 0 allowed on "remember" option in /etc/pam.d/common-passwd file of pam.d module to disable passwd history feature? With "remember=0" in /etc/pam.d/common-passwd file, I am observing a memfault when running the passwd command as a USER. When browsed the source, the function in _set_ctrl in support.c file of pam_unix module handles wrong values of remember, but currently its not robust enough to handle 0, which is a wrong value. So the valid and only option to disable history feature, is to not include the "remember" option in /etc/pam.d/common-passwd file and not to set-up /etc/security/opasswd file? Could see in the following link mention of setting "remember" to 0 has no effect to remember value in "/etc/security/opasswd" file. =https://lists.fedorahosted.org/pipermail/linux-pam-commits/2011-June/000060.html

  Read the article

• iterm2 emacsclient keybindings

  - by Zach

  I have just switched from using Emacs.app to emacsserver and emacsclient in terminal mode using iterm2 as my terminal emulator. I am having some trouble with some keybindings though. Particularly M-left arrow prints the character D, M-right arrow prints C, M-up arrow prints A, and M-down arrow prints B. I am using the xterm defaults for keys in iterm2 and have the left and right option keys bound to +Esc. This is particularly annoying in org-mode. Am I going to have to just rebind the keys in my .emacs? How would I go about doing that?

  Read the article

• VirtualBox: Grub sees hard drive, Linux does not

  - by thabubble

  I installed Linux on my second hard drive. I can boot to it just fine. But when I try to boot it from a Windows 7 host using http://www.virtualbox.org/manual/ch09.html#rawdisk, grub sees it and can load vmlinuz and initramfs. Log: :: running early hook [udev] :: running hook [udev] :: Triggering uevents... :: running hook [plymouth] :: Loading plymouth...done. ... Waiting 10 seconds for device /dev/disk/by-uuid/{root UUID} ... ERROR: device 'UUID={root UUID}' not found. Skipping fsck. ERROR: Unable to find root device 'UUID={root UUID}' It then drops me into a recovery shell. I checked "/etc/fstab" and it's empty, there are also no sd* devices in dev, the only thing in /dev/disk/by-id is a VBox CD device. I'm not too good with these kinds of things so help would be greatly appriciated.

  Read the article

• Setting up a copy of a site with IIS 7?

  - by SJaguar13

  I have a site running on IIS with a dyndns.org domain that points to the IP of the Windows 2008 machine hosting it. I need a copy of that site for development purposes. I set up another folder with all the files, and create a new site in IIS. I don't really have a domain for it, so I was just going to use the IP address. When I go to localhost, 127.0.0.1, or the internal IP, I get bad hostname. If I use the IP address on port 80 (the same as the real version of the site), I get 404 not found. If I use a different port so I don't have them both on the same IP with the same port, I get connection timed out. How do I go about setting this up?

  Read the article

• How to move a windows machine properly from RAID 1 to raid 10? [migrated]

  - by goober

  Goal I would like to add two more hard drives to my current RAID 1 setup and create a RAID 0 setup on top of the two RAID 1 setups (which I believe is referred to as "RAID 10"). Components Involved Intel P68 Chipset Motherboard 4 SATA ports that can be configured for Raid An intel SSD cache that sits in front of the RAID, and a 64 GB SSD configured in that manner Two 1TB HDDs configured in RAID 1 OS: Windows 7 Professional Resources Consulted so far I found a great resource on LinuxQuestions.org for a good "best practices" process for Linux machines, but I'd like to develop a similar process that I know works on Windows Machines.

  Read the article

• How to run nodejs on linux platform

  - by rotem

  How to run node.js on host with linux platform? To run node.js on localhost with windows operation system is simple I download package from nodejs.org/download/ and I execute Windows Installer (.msi) I go to console command line and I type node file.js and everything fine. but in my host with linux platform I have control panel with no option to run type file exe, msi and there is no window with command line, So how can I be able to run nodejs on my host? I call to support of my hosting bluehost.com and they don't know. my Details server and control panel Thanks for any help

  Read the article

• How to get source with apt-get source in Ubuntu?

  - by Jonas

  I need to install pure-ftpd from source and need to do apt-get source pure-ftpd but I get this message: E: You must put some 'source' URIs in your sources.list I found some documentation about this for Debian on http://www.debian.org/doc/manuals/apt-howto/ch-basico.en.html#s-sources.list but what URIs should I add to sources.list for Ubuntu and if I want the source for pur-ftpd? EDIT: I found some URIs on Sources.List For Ubuntu Hardy Heron (8.04) So I added these lines to my /etc/apt/sources.list: deb-src http://archive.ubuntu.com/ubuntu/ hardy main restricted universe deb-src http://archive.ubuntu.com/ubuntu/ hardy-updates main restricted universe

  Read the article

• How to setup email server in ubuntu 12.04LTS(debian 7 wheezy/sid) running on linode vps

  - by shihon

  I am working on email server, since i tried several times to create email server on ubuntu12.04LTS with postfix + dovecote + postfixadmin + courier + clamav + spamassassin. But everytime i install these packages i face new problems, like mails send to localhost users and found in users maildir. But I can't determine how to configure/setup for send an email to external smtp like gmail, yahoo. The most worst thing i can't determine how to use sasl, because i am not using SSL so it is not worthy for my domain. This is so complicated, i search everywhere on google: links are https://help.ubuntu.com/community/PostfixCompleteVirtualMailSystemHowto http://www.starbridge.org/spip/spip.php?article1&lang=fr http://knopix.wordpress.com/2008/01/16/postfixadmin-postgresql-courier-squirrelmail-on-debian-etch-howtotutorial/ http://flurdy.com/docs/postfix/ Is there any article for install email server on ubuntu 12.04LTS. Please help me to understand these things.

  Read the article

• Installing maven on Ubuntu by manual download

  - by WebDevHobo

  To install Maven, I downloaded the latest version from the website and then followed these steps: http://maven.apache.org/download.html#Installation The last step, the version control, does not work. It says that 'mvn' is currently not installed and that I should type sudo apt-get install maven2 If I go directly to the mvn file itself, it does work: root@ubuntu:~# /usr/local/apache-maven/apache-maven-2.2.1/bin/mvn --version Apache Maven 2.2.1 (r801777; 2009-08-06 12:16:01-0700) Java version: 1.6.0_21 Java home: /usr/java/jdk1.6.0_21/jre Default locale: en_US, platform encoding: UTF-8 OS name: "linux" version: "2.6.32-25-generic" arch: "i386" Family: "unix" So, what am I doing wrong here? Or what would and apt-get install do extra that I might have forgotten?

  Read the article

• Can GnomeKeyring store passwords unencrypted?

  - by antimeme

  I have a Fedora 15 laptop with the root and home partitions encrypted using LUKS. When it boots I have to enter a pass phrase to unlock the master key, so I have it configured to automatically log me in to my account. However, GnomeKeyring remains locked, so I have to enter another pass phrase for that. This is unpleasant and completely pointless since the entire disk is encrypted. I've not been able to find a way to configure GnomeKeyring to store its pass phrases without encryption. For example, I was not able to find an answer here: http://library.gnome.org/users/seahorse-plugins/stable/index.html.en Is there a solution? If not, is there a mailing list where it would be appropriate to plead my case?

  Read the article

• How to mount a iSCSI/SAN storage drive to a stable device name (one that can't change on re-connect)?

  - by jcalfee314

  We need stable device paths for our Twinstrata SAN drives. Many guides for setting up iSCSI connectors simply say to use a device path like /dev/sda or /dev/sdb. This is far from correct, I doubt that any setup exists that would be happy to have its device name suddenly change (from /dev/sda to /dev/sdb for example). The fix I found was to install multipath and start a multipathd on boot which then provides a stable mapping between the storage's WWID to a device path like this /dev/mapper/firebird_database. This is a method described in the CentOS/RedHat here: http://www.centos.org/docs/5/html/5.1/DM_Multipath/setup_procedure.html. This seems a little complicated though. We noticed that it is common to see UUIDs appear in fstab on new installs. So, the question is, why do we need an external program (multipathd) running to provide a stable device mount? Should there be a way to provide the WWID directly in /etc/fstab?

  Read the article

• Xorg configuration file on Debian Testing

  - by nubicurio

  I cannot find the Xorg configuration file on my newly installed Debian on my tablet-pc, so I followed this tutorial http://wiki.debian.org/Xorg and ran the command "Xorg -configure", to which I got the following error messages: (EE) Failed to load module "vmwgfx" (module does not exist, 0) (EE) vmware: Please ignore the above warnings about not being able to load module/driver vmwgfx (++) Using config file: "/root/xorg.conf.new" (==) Using system config directory "/usr/share/X11/xorg.conf.d" FATAL: Module fbcon not found. Number of created screens does not match number of detected devices. Configuration failed. Dose anyone know what this means and how I should proceed? Why is there a warning about vmware, and what is this fbcon module?

  Read the article

• How to limit server to specific IP addresses with mod_authz_host?

  - by BeeDog

  Hi! I am very new to this area, so please bear with me. :) Right now I am running an Apache HTTP server on my setup, a very basic configuration. The website hosted on it is accessible from anywhere, and I want to limit the access to a specific IP address range. I've looked into this and I found that one Apache module called mod_authz_host handles this. http://httpd.apache.org/docs/2.2/mod/mod_authz_host.html The problem is, I haven't managed to find documentation that explains well how to actually do the stuff. How do I actually make sure only a certain range of IP addresses can access my site/server? The machine is running Ubuntu Server 10.10, the web files are stored in /var/www/, the apache2 daemon has its stuff stored in /etc/apache2/ and /usr/lib/apache2/modules/*. Thanks in advance, and sorry if this is a stupid question!

  Read the article

• Is there any way to properly display negative time spans in Excel?

  - by Pepor

  Is there any way to make Excel show a negative time span? If I subtract two time values (say, when subtracting the actual amount of time spent on something from the amount of time planned for it) and the result is negative, Excel just fills the result cell with hashes to notify me that the result cannot be displayed as a time value. Even OpenOffice.org Calc and Google Spreadsheets can display negative time values. Is there a way to work around that issue by using conditional formatting? I really don't want to create some workaround by calculating the hours and minutes myself or anything like that.

  Read the article

• Seeing DNS changes takes too long on my PC, can it be my router misconfiguration?

  - by Borek

  I administer a few sites and need to update their DNS entries from time to time, e.g., adding an A-record point certain subdomain to a certain IP. When I check sites like http://www.opendns.com/support/cache/, I can clearly see the DNS change taking effect throughout the world - is it just my PC that can't see this change (ping newsubdomain.example.org says it cannot resolve host name) The network "map" is like this: My PC -> my router -> my ISP's router -> internet On my PC, the DNS is set automatically which means that if I run iconfig /all, my router will be returned as the DNS server (192.168.1.1). On my router, the DNS is set to be what my ISP provided me with. Is this correct? What can I do to see new hostnames resolved quicker?

  Read the article

• debian installation without internet connection

  - by Gobliins

  Hi i want to install some Debian distributions (Grip, Crush, Lenny...) for arm / armel architectures. www.emdebian.org/ i refer to this guide www.aurel32.net/info/debian_arm_qemu.php The Problem i have is that i dont have internet connection with My Linux VM or Qemu i am behind a Proxy. I want to know is there a way where i can dl all the needed files and save them to disk that i don´t need an i.c. during the installation? I am working under Windows now. my regards

  Read the article

• Tracking down laptops Google has never heard of

  - by John

  Using MS tools to get information on PCs using our software, our customers have sent several Lenovo systems which have names we simply cannot find using Google... no search results at all. Considering these names/ids are returned by querying the system directly, not asking the customer to write it down by looking at the box, this seems odd. The ones we have so far (more than one of each) are: Lenovo 2241BL9 Lenovo 6463Y4H My guess is these are Thinkpads after Lenovo took over the brand, but can anyone help me out with this detective work? edit: the 2nd one does turn up some driver downloads and this page, but it's unclear what any of that means. Is the 6463y4h just a T61? http://smolts.org/reports/view_profile/%20ThinkPad%20T61

  Read the article

• Tagging does not work with the Subversion plugin.

  - by mark

  I have exactly the same problem as the fellow from this post - http://jenkins.361315.n4.nabble.com/Tag-this-build-not-working-subversion-td384218.html, except that I use build 1.413 Unfortunately, the post does not provide any workarounds except downgrading to 1.310 (from 1.315) I would gladly provide the logs, if I knew the logger names. Please, help. P.S. I have posted this issue both on jenkins issues site - https://issues.jenkins-ci.org/browse/JENKINS-9961 and in the respective google group - https://groups.google.com/d/topic/jenkinsci-users/4UVKFxXA9Jo/overview. To no avail. So, this site is my last hope - thanks to all in advance. EDIT Upgraded to 1.417 - still tagging does nothing.

  Read the article

• Accessing our Intranet from outside our Network - WITHOUT VPN

  - by westexasman

  We just upgraded our company intranet from an IIS based, ASP (poorly written) server/code base to a Windows Server 2008 r2 (Apache/MySQL/PHP) server. The old server allowed users to login to intranet.xxx.org using there AD user/pass which then lead them to the company Intranet from basically anywhere they had Internet access. We want to mimic that functionality (or change it to something more secure) with the new setup. This was seemingly setup for off-site employees running on a state network. The state network does not allow VPN, therefor, we needed a way to allow those employees access to the Intranet. So, how do we go about allowing users to login from the outside world and gain access to our Intranet?

  Read the article

• Link two or more text boxes in Visio

  - by Dan

  I am working on creating a template in Visio 2007 (Professional). Each page should reflect a document number and a revision number (two text boxes). I would like to make the template such that entering or changing text in one of these boxes on one page will automatically update the equivalent text boxes on all other pages. Is there an easy way to link two (or more) text boxes to show the same data (mirror each other)? I've looked into creating a ShapeData set and then using the ShapeData field in place of each box, but this will require training others to access and adjust the ShapeData field. In short - I want the issue that was attempting to be solved in Changing Text in Visio Org Chart Shape Changes Multiple Shapes' Text .

  Read the article

• Convert text to table

  - by Quattro

  I would like convert text into a table. Here is a link to the text http://www.tcdb.org/public/tcdb Short example: >gnl|TC-DB|A0CIB0|1.A.17.3.1 Chromosome undetermined scaffold_19, whole genome shotgun sequence OS=Paramecium tetraurelia GN=GSPATT00007662001 PE=4 SV=1 MDDQNQPILQEQPKPKQKKPLLNTKMVKKQKMQNKKEENLREILNFYTNQVDARKFLQKM KAVVDSNQQEKKYQDDFLNPNEYNEMQDIYEDYNMGDLVIVFPNPDADGVKNPPITYKEA PLTKTNFYSKIGNVSYENDIDELCVDEMEYLRNMRNVDGEHMDQDHVKEEI >gnl|TC-DB|A0CS82|9.B.82.1.5 Chromosome undetermined scaffold_26, whole genome shotgun sequence - Paramecium tetraurelia. MIIEEQIEEKMIYKAIHRVKVNYQKKIDRYILYKKSRWFFNLLLMLLYAYRIQNIGGFYI VTYIYCVYQLQLLIDYFTPLGLPPVNLEDEEEDDDQFQNDFSELPTTLSNKNELNDKEFR PLLRTTSEFKVWQKSVFSVIFAYFCTYIPIWDIPVYWPFLFCYFFVIVGMSIRKYIKHMK KYGYTILDFTKKK I wanted to have columns for example delimited with pipe | or ; |>gnl|TC-DB|A0CIB0|1.A.17.3.1| Chromosome undetermined scaffold_19, whole genome shotgun sequence OS=Paramecium tetraurelia GN=GSPATT00007662001 PE=4 SV=1| MDDQNQPILQEQPKPKQKKPLLNTKMVKKQKMQNKKEENLREILNFYTNQVDARKFLQKM KAVVDSNQQEKKYQDDFLNPNEYNEMQDIYEDYNMGDLVIVFPNPDADGVKNPPITYKEA PLTKTNFYSKIGNVSYENDIDELCVDEMEYLRNMRNVDGEHMDQDHVKEEI I am working with Windows and I don't know how to do it I just know every row starts with > I want to substitute the first whitespace in a row with a delimiter like | or ; after the first regular expression new line in a row, I want also a delimiter everything between the regular expression first new line and > should go into a new column (it's a sequence of a protein)

  Read the article

• Non interactive git clone (ssh fingerprint prompt)

  - by qwe

  I want to clone a repo in a non-interactive way. When cloning, git asks to confirm host's fingerprint: The authenticity of host 'bitbucket.org (207.223.240.182)' can't be established. RSA key fingerprint is 97:8c:1b:f2:6f:14:6b:5c:3b:ec:aa:46:46:74:7c:40. Are you sure you want to continue connecting (yes/no)? no How do I force "yes" every time this questions pops up? I tried using yes yes | git clone ..., but it doesn't work. EDIT: Here's a solution: Can I automatically add a new host to known_hosts? (adds entires to known_hosts with ssh-keyscan).

  Read the article

• How to configure installed Ruby and gems?

  - by NARKOZ

  My current gem env returns: RubyGems Environment: - RUBYGEMS VERSION: 1.3.6 - RUBY VERSION: 1.8.7 (2008-08-11 patchlevel 72) [x86_64-linux] - INSTALLATION DIRECTORY: /home/USERNAME/.gems - RUBYGEMS PREFIX: /home/narkoz - RUBY EXECUTABLE: /usr/bin/ruby1.8 - EXECUTABLE DIRECTORY: /home/USERNAME/.gems/bin - RUBYGEMS PLATFORMS: - ruby - x86_64-linux - GEM PATHS: - /home/USERNAME/.gems - /usr/lib/ruby/gems/1.8 - GEM CONFIGURATION: - :update_sources => true - :verbose => true - :benchmark => false - :backtrace => false - :bulk_threshold => 1000 - "gempath" => ["/home/USERNAME/.gems", "/usr/lib/ruby/gems/1.8"] - "gemhome" => "/home/USERNAME/.gems" - REMOTE SOURCES: - http://rubygems.org/ How can I change path /home/USERNAME/ to my own without uninstalling? OS: Debian Linux

  Read the article

• time on files differ by 1 sec. FAIL Robocopy sync

  - by csmba

  I am trying to use Robocopy to sync (/IMG) a folder on my PC and a shared network drive. The problem is that the file attributes differ by 1 sec on both locations (creation,modified and access). So every time I run robocopy, it syncs the file again... BTW, problem is the same if I delete the target file and robocopy it from new... still, new file has 1 sec different properties. Env Details: Source: Win 7 64 bit Target: WD My Book World Edition NAS 1TB which takes its time from online NTP pool.ntp.org (I don't know if file system is FAT or not)

  Read the article

< Previous Page | 278 279 280 281 282 283 284 285 286 287 288 289  | Next Page >