Search Results

Search found 7251 results on 291 pages for 'pdf parsing'.

Page 282/291 | < Previous Page | 278 279 280 281 282 283 284 285 286 287 288 289  | Next Page >

  • Mono-LibreOffice System.TypeLoadException

    - by Marco
    In the past I wrote a C# library to work with OpenOffice and this worked fine both in Windows than under Ubuntu with Mono. Part of this library is published here as accepted answer. In these days I discovered that Ubuntu decided to move to LibreOffice, so I tried my library with LibreOffice latest stable release. While under Windows it's working perfectly, under Linux I receive this error: Unhandled Exception: System.TypeLoadException: A type load exception has occurred. [ERROR] FATAL UNHANDLED EXCEPTION: System.TypeLoadException: A type load exception has occurred. Usually Mono tells us which library can't load, so I can install correct package and everything is OK, but in this case I really don't know what's going bad. I'm using Ubuntu oneiric and my library is compiled with Framework 4.0. Under Windows I had to write this into app.config: <?xml version="1.0"?> <configuration> <startup useLegacyV2RuntimeActivationPolicy="true"> <supportedRuntime version="v4.0" sku=".NETFramework,Version=v4.0,Profile=Client"/> </startup> </configuration> because LibreOffice assemblies uses Framework 2.0 (I think). How can I find the reason of this error to solve it? Thanks UPDATE: Even compiling with Framework 2.0 problem (as expected) is the same. Problem (I think) is that Mono is not finding cli-uno-bridge package (installable on previous Ubuntu releases and now marked as superseded), but I cannot be sure. UPDATE 2: I created a test console application referencing cli-uno dlls on Windows (they are registered in GAC_32 and GAC_MSIL). CONSOLE app static void Main(string[] args) { Console.WriteLine("Starting"); string dir = Path.GetDirectoryName(Assembly.GetExecutingAssembly().Location); string doc = Path.Combine(dir, "Liberatoria siti web.docx"); using (QOpenOffice.OpenOffice oo = new QOpenOffice.OpenOffice()) { if (!oo.Init()) return; oo.Load(doc, true); oo.ExportToPdf(Path.ChangeExtension(doc, ".pdf")); } } LIBRARY: using unoidl.com.sun.star.lang; using unoidl.com.sun.star.uno; using unoidl.com.sun.star.container; using unoidl.com.sun.star.frame; using unoidl.com.sun.star.beans; using unoidl.com.sun.star.view; using unoidl.com.sun.star.document; using System.Collections.Generic; using System.IO; using System; namespace QOpenOffice { class OpenOffice : IDisposable { private XComponentContext context; private XMultiServiceFactory service; private XComponentLoader component; private XComponent doc; public bool Init() { Console.WriteLine("Entering Init()"); try { context = uno.util.Bootstrap.bootstrap(); service = (XMultiServiceFactory)context.getServiceManager(); component = (XComponentLoader)service.createInstance("com.sun.star.frame.Desktop"); XNameContainer filters = (XNameContainer)service.createInstance("com.sun.star.document.FilterFactory"); return true; } catch (System.Exception ex) { Console.WriteLine(ex.Message); if (ex.InnerException != null) Console.WriteLine(ex.InnerException.Message); return false; } } } } but I'm not able to see "Starting" !!! If I comment using(...) on application, I see line on console... so I think it's something wrong in DLL. There I'm not able to see "Entering Init()" message on Init(). Behaviour is the same when LibreOffice is not installed and when it is !!! try..catch block is not executed...

    Read the article

  • Jasper report always showing no content, why?

    - by spderosso
    Hi, I have the following code: InputStream reportFile = MyPage.this.getClass().getResourceAsStream("test.jrxml"); HashMap<String, String> parameters = new HashMap<String, String>(); parameters.put("StringParameterName", "show me"); try { JasperReport report = JasperCompileManager.compileReport(reportFile); JasperPrint print = JasperFillManager.fillReport(report, parameters); return JasperExportManager.exportReportToPdf(print); } catch (JRException e) { // TODO Auto-generated catch block e.printStackTrace(); return null; } And the test.jrxml looks like this (I generated part of it with the iReport, the only thing I did was to remove the language="groovy" attribute): <?xml version="1.0" encoding="UTF-8"?> <jasperReport xmlns="http://jasperreports.sourceforge.net/jasperreports" xmlns:xsi="http://www.w3.org/2001/XMLSchema-instance" xsi:schemaLocation="http://jasperreports.sourceforge.net/jasperreports http://jasperreports.sourceforge.net/xsd/jasperreport.xsd" name="test" pageWidth="595" pageHeight="842" columnWidth="555" leftMargin="20" rightMargin="20" topMargin="20" bottomMargin="20"> <property name="ireport.zoom" value="1.0"/> <property name="ireport.x" value="0"/> <property name="ireport.y" value="0"/> <parameter name="StringParameterName" isForPrompting="false" class="java.lang.String"/> <background> <band splitType="Stretch"/> </background> <title> <band height="20"> <staticText> <reportElement x="180" y="0" width="200" height="20"/> <text><![CDATA[Hello World!]]></text> </staticText> </band> </title> <pageHeader> <band height="35" splitType="Stretch"/> </pageHeader> <columnHeader> <band height="61" splitType="Stretch"/> </columnHeader> <detail> <band height="125" splitType="Stretch"> <textField> <reportElement x="243" y="77" width="100" height="20"/> <textElement/> <textFieldExpression class="java.lang.String"><![CDATA[$P{StringParameterName}]]></textFieldExpression> </textField> </band> </detail> <columnFooter> <band height="45" splitType="Stretch"/> </columnFooter> <pageFooter> <band height="54" splitType="Stretch"/> </pageFooter> <summary> <band height="42" splitType="Stretch"/> </summary> </jasperReport> As a result I always get a blank pdf file. What could be the reason?

    Read the article

  • Problem with XML parser

    - by zp26
    Hi, I have a problem with parsing XML. I have created a program which write a file xml in the project directory. The file XML are correct. (i checked). When i try to read this XML the program crash and return 1 status. I have controlled my 2 path and they are equals. Can you help me please? Thanks so much. #import "PositionIdentifierViewController.h" #import "WriterXML.h" @implementation PositionIdentifierViewController - (void)parser:(NSXMLParser *)parser foundCharacters:(NSString *)string { NSString *stringa = [NSString stringWithFormat:@"%@",string]; textArea.text = [textArea.text stringByAppendingString:@"\n"]; textArea.text = [textArea.text stringByAppendingString:stringa]; } -(IBAction)startParsing { NSURL *xmlURL = [NSURL fileURLWithPath:path]; NSXMLParser *parser = [[NSXMLParser alloc] initWithContentsOfURL:xmlURL]; [parser setDelegate:self]; BOOL success = [parser parse]; if(success == YES){ // } [parser release]; } // Implement viewDidLoad to do additional setup after loading the view, typically from a nib. - (void)viewDidLoad { [super viewDidLoad]; NSArray *tempPaths = NSSearchPathForDirectoriesInDomains(NSDocumentDirectory, NSUserDomainMask, YES); NSString *documentsDirectoryPath = [tempPaths objectAtIndex:0]; path = [documentsDirectoryPath stringByAppendingPathComponent:@"filePosizioni.xml"]; WriterXML *newWriter; newWriter = [[WriterXML alloc]init]; [newWriter saveXML:(NSString*)@"ciao":(float)10:(float)40:(float)70]; [newWriter saveXML:(NSString*)@"pippo":(float)20:(float)50:(float)80]; [newWriter saveXML:(NSString*)@"pluto":(float)30:(float)60:(float)90]; NSLog(path); } - (void)didReceiveMemoryWarning { // Releases the view if it doesn't have a superview. [super didReceiveMemoryWarning]; // Release any cached data, images, etc that aren't in use. } - (void)viewDidUnload { // Release any retained subviews of the main view. // e.g. self.myOutlet = nil; } - (void)dealloc { [super dealloc]; } @end #import "WriterXML.h" @implementation WriterXML -(void)saveXML:(NSString*)name:(float)x:(float)y:(float)z{ NSArray *paths = NSSearchPathForDirectoriesInDomains(NSDocumentDirectory, NSUserDomainMask, YES); NSString *documentsDirectoryPath = [paths objectAtIndex:0]; NSString *filePath = [documentsDirectoryPath stringByAppendingPathComponent:@"filePosizioni.xml"]; NSFileHandle *myHandle; NSFileManager *fileManager = [NSFileManager defaultManager]; NSString *titoloXML = [NSString stringWithFormat:@"<?xml version=1.0 encoding=UTF-8 ?>"]; NSString *inizioTag = [NSString stringWithFormat:@"\n\n\n<position>"]; NSString *tagName = [NSString stringWithFormat:@"\n <name>%@</name>", name]; NSString *tagX = [NSString stringWithFormat:@"\n <x>%f</x>", x]; NSString *tagY = [NSString stringWithFormat:@"\n <y>%f</y>", y]; NSString *tagZ = [NSString stringWithFormat:@"\n <z>%f</z>", z]; NSString *fineTag= [NSString stringWithFormat:@"\n</position>"]; NSData* dataTitoloXML = [titoloXML dataUsingEncoding: NSASCIIStringEncoding]; NSData* dataInizioTag = [inizioTag dataUsingEncoding: NSASCIIStringEncoding]; NSData* dataName = [tagName dataUsingEncoding: NSASCIIStringEncoding]; NSData* dataX = [tagX dataUsingEncoding: NSASCIIStringEncoding]; NSData* dataY = [tagY dataUsingEncoding: NSASCIIStringEncoding]; NSData* dataZ = [tagZ dataUsingEncoding: NSASCIIStringEncoding]; NSData* dataFineTag = [fineTag dataUsingEncoding: NSASCIIStringEncoding]; if(![fileManager fileExistsAtPath:filePath]) [fileManager createFileAtPath:filePath contents:dataTitoloXML attributes:nil]; myHandle = [NSFileHandle fileHandleForUpdatingAtPath:filePath]; [myHandle seekToEndOfFile]; [myHandle writeData:dataInizioTag]; NSLog(@"writeok"); [myHandle seekToEndOfFile]; [myHandle writeData:dataName]; NSLog(@"writeok"); [myHandle seekToEndOfFile]; [myHandle writeData:dataX]; NSLog(@"writeok"); [myHandle seekToEndOfFile]; [myHandle writeData:dataY]; NSLog(@"writeok"); [myHandle seekToEndOfFile]; [myHandle writeData:dataZ]; NSLog(@"writeok"); [myHandle seekToEndOfFile]; [myHandle writeData:dataFineTag]; NSLog(@"writeok"); [myHandle seekToEndOfFile]; NSLog(@"zp26 %@",filePath); } @end

    Read the article

  • Google Web Toolkit Deferred Binding Issue

    - by snctln
    I developed a web app using GWT about 2 years ago, since then the application has evolved. In its current state it relies on fetching a single XML file and parsing the information from it. Overall this works great. A requirement of this app is that it needs to be able to be ran from the filesystem (file:///..) as well as the traditional model of running from a webserver (http://...) Fetching this file from a webserver works exactly as expected using a RequestBuilder object. When running the app from the filesystem Firefox, Opera, Safari, and Chrome all behave as expected. When running the app from the filesystem using IE7 or IE8 the RequestBuilder.send() call fails, the information about the error suggests that there is a problem accessing the file due to violating the same origin policy. The app worked as expected in IE6 but not in IE7 or IE8. So I looked at the source code of RequestBuilder.java and saw that the actual request was being executed with an XMLHttpRequest GWT object. So I looked at the source code for XMLHttpRequest.java and found out some information. Here is the code (starts at line 83 in XMLHttpRequest.java) public static native XMLHttpRequest create() /*-{ if ($wnd.XMLHttpRequest) { return new XMLHttpRequest(); } else { try { return new ActiveXObject('MSXML2.XMLHTTP.3.0'); } catch (e) { return new ActiveXObject("Microsoft.XMLHTTP"); } } }-*/; So basically if an XMLHttpRequest cannot be created (like in IE6 because it is not available) an ActiveXObject is used instead. I read up a little bit more on the IE implementation of XMLHttpRequest, and it appears that it is only supported for interacting with files on a webserver. I found a setting in IE8 (Tools-Internet Options-Advanced-Security-Enable native XMLHTTP support), when I uncheck this box my app works. I assume this is because I am more of less telling IE to not use their implementation of XmlHttpRequest, so GWT just uses an ActiveXObject because it doesn't think the native XmlHttpRequest is available. This fixes the problem, but is hardly a long term solution. I can currently catch a failed send request and verify that it was trying to fetch the XML file from the filesystem using normal GWT. What I would like to do in this case is catch the IE7 and IE8 case and have them use a ActiveXObject instead of a native XmlHttpRequest object. There was a posting on the GWT google group that had a supposed solution for this problem (link). Looking at it I can tell that it was created for an older version of GWT. I am using the latest release and think that this is more or less what I would like to do (use GWT deferred binding to detect a specific browser type and run my own implementation of XMLHttpRequest.java in place of the built in GWT implementation). Here is the code that I am trying to use package com.mycompany.myapp.client; import com.google.gwt.xhr.client.XMLHttpRequest; public class XMLHttpRequestIE7or8 extends XMLHttpRequest { // commented out the "override" so that eclipse and the ant build script don't throw errors //@Override public static native XMLHttpRequest create() /*-{ try { return new ActiveXObject('MSXML2.XMLHTTP.3.0'); } catch (e) { return new ActiveXObject("Microsoft.XMLHTTP"); } }-*/; // have an empty protected constructor so the ant build script doesn't throw errors // the actual XMLHttpRequest constructor is empty as well so this shouldn't cause any problems protected XMLHttpRequestIE7or8() { } }; And here are the lines that I added to my module xml <replace-with class="com.mycompany.myapp.client.XMLHttpRequestIE7or8"> <when-type-is class="com.google.gwt.xhr.client.XMLHttpRequest"/> <any> <when-property-is name="user.agent" value="ie7" /> <when-property-is name="user.agent" value="ie8" /> </any> </replace-with> From what I can tell this should work, but my code never runs. Does anyone have any idea of what I am doing wrong? Should I not do this via deferred binding and just use native javascript when I catch the fail case instead? Is there a different way of approaching this problem that I have not mentioned? All replies are welcome.

    Read the article

  • Bypass cache for mobile user agents, VARNISH+NGINX+W3CACHE

    - by Mike McGhee
    Right now I'm running Wordpress w/ W3 Cache on nginx with varnish front end. I'm trying to use the WP Touch Pro plugin for wordpress to display mobile sites, but it is not working. Shows the desktop theme still. I've put the mobile user agents in the rejected user agents box in w3 cache. Here is the nginx config w3 cache spit out: BEGIN W3TC Page Cache cache location ~ /wp-content/w3tc/pgcache.*html$ { expires modified 3600s; add_header X-Powered-By "W3 Total Cache/0.9.2.4"; add_header Vary "Accept-Encoding, Cookie"; } location ~ /wp-content/w3tc/pgcache.*gzip$ { gzip off; types {} default_type text/html; expires modified 3600s; add_header X-Powered-By "W3 Total Cache/0.9.2.4"; add_header Vary "Accept-Encoding, Cookie"; add_header Content-Encoding gzip; } # END W3TC Page Cache cache # BEGIN W3TC Browser Cache gzip on; gzip_types text/css application/x-javascript text/x-component text/richtext image/svg+xml text/plain text/xsd text/xsl text/xml image/x-icon; location ~ \.(css|js|htc)$ { expires 31536000s; add_header X-Powered-By "W3 Total Cache/0.9.2.4"; } location ~ \.(html|htm|rtf|rtx|svg|svgz|txt|xsd|xsl|xml)$ { expires 3600s; add_header X-Powered-By "W3 Total Cache/0.9.2.4"; } location ~ \.(asf|asx|wax|wmv|wmx|avi|bmp|class|divx|doc|docx|eot|exe|gif|gz|gzip|ico|jpg|jpeg|jpe|mdb|mid|midi|mov|qt|mp3|m4a|mp4|m4v|mpeg|mpg|mpe|mpp|otf|odb|odc|odf|odg|odp|ods|odt|ogg|pdf|png|pot|pps|ppt|pptx|ra|ram|svg|svgz|swf|tar|tif|tiff|ttf|ttc|wav|wma|wri|xla|xls|xlsx|xlt|xlw|zip)$ { expires 31536000s; add_header X-Powered-By "W3 Total Cache/0.9.2.4"; } # END W3TC Browser Cache # BEGIN W3TC Minify core rewrite ^/wp-content/w3tc/min/w3tc_rewrite_test$ /wp-content/w3tc/min/index.php?w3tc_rewrite_test=1 last; rewrite ^/wp-content/w3tc/min/(.+\.(css|js))$ /wp-content/w3tc/min/index.php?file=$1 last; # END W3TC Minify core # BEGIN W3TC Page Cache core rewrite ^(.*\/)?w3tc_rewrite_test$ $1?w3tc_rewrite_test=1 last; set $w3tc_rewrite 1; if ($request_method = POST) { set $w3tc_rewrite 0; } if ($query_string != "") { set $w3tc_rewrite 0; } if ($http_host != "mysite.com") { set $w3tc_rewrite 0; } set $w3tc_rewrite2 1; if ($request_uri !~ \/$) { set $w3tc_rewrite2 0; } if ($request_uri ~* "(sitemap(_index)?\.xml(\.gz)?|[a-z0-9_\-]+-sitemap([0-9]+)?\.xml(\.gz)?)") { set $w3tc_rewrite2 1; } if ($w3tc_rewrite2 != 1) { set $w3tc_rewrite 0; } set $w3tc_rewrite3 1; if ($request_uri ~* "(\/wp-admin\/|\/xmlrpc.php|\/wp-(app|cron|login|register|mail)\.php|\/feed\/|wp-.*\.php|index\.php)") { set $w3tc_rewrite3 0; } if ($request_uri ~* "(wp\-comments\-popup\.php|wp\-links\-opml\.php|wp\-locations\.php)") { set $w3tc_rewrite3 1; } if ($w3tc_rewrite3 != 1) { set $w3tc_rewrite 0; } if ($http_cookie ~* "(comment_author|wp\-postpass|wordpress_\[a\-f0\-9\]\+|wordpress_logged_in)") { set $w3tc_rewrite 0; } if ($http_user_agent ~* "(W3\ Total\ Cache/0\.9\.2\.4|iphone|ipod|ipad|aspen|incognito|webmate|android|dream|cupcake|froyo|blackberry9500|blackberry9520|blackberry9530|blackberry9550|blackberry\ 9800|blackberry\ 9780|webos|s8000|bada)") { set $w3tc_rewrite 0; } set $w3tc_ua ""; if ($http_user_agent ~* "(acer\ s100|android|archos5|blackberry9500|blackberry9530|blackberry9550|blackberry\ 9800|cupcake|docomo\ ht\-03a|dream|htc\ hero|htc\ magic|htc_dream|htc_magic|incognito|ipad|iphone|ipod|kindle|lg\-gw620|liquid\ build|maemo|mot\-mb200|mot\-mb300|nexus\ one|opera\ mini|samsung\-s8000|series60.*webkit|series60/5\.0|sonyericssone10|sonyericssonu20|sonyericssonx10|t\-mobile\ mytouch\ 3g|t\-mobile\ opal|tattoo|webmate|webos)") { set $w3tc_ua _high; } set $w3tc_ref ""; set $w3tc_ssl ""; set $w3tc_enc ""; if ($http_accept_encoding ~ gzip) { set $w3tc_enc _gzip; } set $w3tc_ext ""; if (-f "$document_root/wp-content/w3tc/pgcache/$request_uri/_index$w3tc_ua$w3tc_ref$w3tc_ssl.html$w3tc_enc") { set $w3tc_ext .html; } if ($w3tc_ext = "") { set $w3tc_rewrite 0; } if ($w3tc_rewrite = 1) { rewrite .* "/wp- content/w3tc/pgcache/$request_uri/_index$w3tc_ua$w3tc_ref$w3tc_ssl$w3tc_ext$w3tc_enc" last; } # END W3TC Page Cache core And here is what I have in my varnish vcl.. sub vcl_recv { # Add a unique header containing the client address remove req.http.X-Forwarded-For; set req.http.X-Forwarded-For = client.ip; # Device detection set req.http.X-Device = "desktop"; if ( req.http.User-Agent ~ "iP(hone|od|ad)" || req.http.User-Agent ~ "Android" ) { set req.http.X-Device = "smart"; } elseif ( req.http.User-Agent ~ "(SymbianOS|BlackBerry|SonyEricsson|Nokia|SAMSUNG|^LG)" ) { set req.http.X-Device = "cell"; } Any help is greatly appreciated, I've been banging my head against this for 2 days..

    Read the article

  • Telerik RadGrid doesn't seem to export Grouped data

    - by SlackGadget
    Hi I've got a DNN application using Telerik RadGrid. We're exporting some data from the Grid but when we drill down on the grid control and export the data we only see the initial top level data, never the updated Grid. Here's my table tag and supporting code. I'm not an expert in ASPX/C#so please forgive my newbie-ness. <mastertableview autogeneratecolumns="False" datakeynames="AccountId" datasourceid="SqlDataSource1" groupsdefaultexpanded="False"> <DetailTables> <telerik:GridTableView runat="server" DataKeyNames="StatementId" DataSourceID="SqlDataSource2" Font-Bold="False" Font-Italic="False" Font-Overline="False" Font-Strikeout="False" Font-Underline="False" > <DetailTables> <telerik:GridTableView runat="server" DataSourceID="SqlDataSource3" Font-Bold="False" Font-Italic="False" Font-Overline="False" Font-Strikeout="False" Font-Underline="False" GroupsDefaultExpanded="False" ShowFooter="True" ShowGroupFooter="True" AllowMultiColumnSorting="True" GridLines="None"> <ParentTableRelation> <telerik:GridRelationFields DetailKeyField="StatementId" MasterKeyField="StatementId" /> </ParentTableRelation> <AlternatingItemStyle BackColor="White" Font-Bold="False" Font-Italic="False" Font-Overline="False" Font-Strikeout="False" Font-Underline="False" Wrap="True" /> <HeaderStyle Font-Bold="False" Font-Italic="False" Font-Overline="False" Font-Strikeout="False" Font-Underline="False" Wrap="True" /> <FooterStyle BackColor="Yellow" Font-Bold="False" Font-Italic="False" Font-Overline="False" Font-Strikeout="False" Font-Underline="False" Wrap="True" /> </telerik:GridTableView> </DetailTables> <ParentTableRelation> <telerik:GridRelationFields DetailKeyField="AccountId" MasterKeyField="AccountId" /> </ParentTableRelation> <CommandItemSettings ExportToPdfText="Export to Pdf" /> <ExpandCollapseColumn Visible="True"> </ExpandCollapseColumn> </telerik:GridTableView> </DetailTables> <ParentTableRelation> <telerik:GridRelationFields DetailKeyField="AccountId" MasterKeyField="AccountId" /> </ParentTableRelation> <ExpandCollapseColumn Visible="True"> </ExpandCollapseColumn> <Columns> <telerik:GridBoundColumn DataField="ACCOUNTID" DataType="System.Int32" HeaderText="ACCOUNTID" SortExpression="ACCOUNTID" UniqueName="ACCOUNTID"> </telerik:GridBoundColumn> <telerik:GridBoundColumn DataField="ACCOUNTREF" HeaderText="ACCOUNTREF" SortExpression="ACCOUNTREF" UniqueName="ACCOUNTREF"> </telerik:GridBoundColumn> <telerik:GridBoundColumn DataField="CUSTOMERID" DataType="System.Int32" HeaderText="CUSTOMERID" SortExpression="CUSTOMERID" UniqueName="CUSTOMERID"> </telerik:GridBoundColumn> </Columns> </mastertableview> The exports are registered with the script manager on load : protected void Page_Load(object sender, EventArgs e) { Button2.Enabled = Session[UserSelection.SelectedValue] != null ? true : false; ScriptManager.GetCurrent(Page).RegisterPostBackControl(Button3); ScriptManager.GetCurrent(Page).RegisterPostBackControl(Button4); } and I' calling the Export with the following : protected void Button3_Click(object sender, System.EventArgs e) { //ConfigureExport(); RadGrid1.Rebind(); RadGrid1.ExportSettings.FileName = "RadGridExportToExcel"; RadGrid1.ExportSettings.ExportOnlyData = true; RadGrid1.ExportSettings.OpenInNewWindow = true; RadGrid1.MasterTableView.ExportToExcel(); } Can anyone see what I'm missing, apart from DNN/ASPX experience and the will to live :)

    Read the article

  • Where do I start ?

    - by Panthe
    Brief History: Just graduated high school, learned a bit of python and C++, have no friends with any helpful computer knowledge at all. Out of anyone i met in my school years I was probably the biggest nerd, but no one really knew. I consider my self to have a vast amount of knowledge on computers and tech then the average person. built/fixed tons of computers, and ability to troubleshoot pretty much any problem I came across. Now that high school is over, Ive really been thinking about my career. Loving, living computers for the past 15 years of my life I decided to take my ability's and try to learn computer programming, why I didn't start earlier I don't know, seems to be big mistake on my part... Doing some research I concluded that Python was the first programming language I should learn, since it was high level and easier to understand then C++ and Java. I also knew that to become good at what I did I needed to know more then just 2 or 3 languages, which didn't seem like a big problem considering once I learned the way Python worked, mainly syntax changed, and the rest would come naturally. I watched a couple of youtube videos, downloaded some book pdf's and snooped around from some tutorials here and there to get the hang of what to do. A two solid weeks had passed of trying to understand the syntax, create small programs that used the basic functions and understanding how it worked, I think i have got the hang of it. It breaks down into what ive been dealing with all this time (although i kinda knew) is that, input,output, loops, functions and other things derived from 0's and 1's storing data and recalling it, ect. (A VERY BASIC IDEA). Ive been able to create small programs, Hangman, file storing, temperature conversion, Caeser Cipher decode/encoding, Fibonacci Sequence and more, which i can create and understand how each work. Being 2 weeks into this, I have learned alot. Nothing at all compared to what i should be learning in the years to come if i get a grip on what I'm doing. While doing these programs I wont stop untill I've done doing a practice problem on a book, which embarresing enough will take me a couple hour depending on the complexity of it. I absolutly will not put aside the challenge until its complete, WHICH CAN BE EXTREMELY DRAINING, ive tried most problems without cheating and reached success, which makes me feel extremely proud of my self after completing something after much trial and error. After all this I have met the demon, alogrithm's which seem to be key to effiecent code. I cant seem to rap my head around some of the computer codes people put out there using numbers, and sometimes even basic functions, I have been able to understand them after a while but i know there are alot more complex things to come, considering my self smart, functions that require complex codes, actually hurt my brain. NOTHING EVER IN LIFE HURT MY BRAIN....... not even math classes in highschool, trying to understand some of the stuff people put out there makes me feel like i have a mental disadvantage lol... i still walk forward though, crossing my fingers that the understanding will come with time. Sorry if is this is long i just wish someone takes all these things into consideration when answering my question. even through all these downsides im still pushing through and continuing to try and get good at this, i know reading these tutorials wont make me any good unless i can become creative and make my own, understand other peoples programs, so this leads me to the simple question i could have asked in the beginning..... WHERE IN THE WORLD DO I START ? Ive been trying to find out how to understand some of the open source projects, how i can work with experianced coders to learn from them and help them, but i dont think thats even possible by the way how far people's knowledge is compared to me, i have no freinds who i can learn from, can someone help me and guide me into the right direction.. i have a huge motivation to get good at coding, anything information would be extremely helpful

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • Making nginx withstand flood attacks

    - by Tiffany Walker
    How can I make it stand stand against attacks better? Are their plugins. Looking for a way to RATE LIMIT and remain up and not slow down. My Setup: user nobody; # no need for more workers in the proxy mode worker_processes 4; worker_cpu_affinity 0001 0010 0100 1000; worker_priority -2; error_log /var/log/nginx/error.log info; worker_rlimit_nofile 40480; events { worker_connections 5120; # increase for busier servers use epoll; # you should use epoll here for Linux kernels 2.6.x } http { server_name_in_redirect off; server_names_hash_max_size 10240; server_names_hash_bucket_size 1024; include mime.types; default_type application/octet-stream; server_tokens off; disable_symlinks if_not_owner; sendfile on; tcp_nopush on; tcp_nodelay on; keepalive_timeout 5; gzip on; gzip_vary on; gzip_disable "MSIE [1-6]\."; gzip_proxied any; gzip_http_version 1.1; gzip_min_length 1000; gzip_comp_level 9; gzip_buffers 16 8k; # You can remove image/png image/x-icon image/gif image/jpeg if you have slow CPU gzip_types text/plain text/xml text/css application/x-javascript application/xml image/png image/x-icon image/gif image/jpeg application/xml+rss text/javascript application/atom+xml; ignore_invalid_headers on; client_header_timeout 3m; client_body_timeout 3m; send_timeout 3m; reset_timedout_connection on; connection_pool_size 256; client_header_buffer_size 256k; large_client_header_buffers 4 256k; client_max_body_size 200M; client_body_buffer_size 128k; request_pool_size 32k; output_buffers 4 32k; postpone_output 1460; proxy_temp_path /tmp/nginx_proxy/; client_body_in_file_only on; log_format bytes_log "$msec $bytes_sent ."; include "/etc/nginx/vhosts/*"; } vhost file: server { error_log /var/log/nginx/vhost-error_log warn; listen 194.145.208.19:80; server_name ipxnow.in www.ipxnow.in; access_log /usr/local/apache/domlogs/ipxnow.in-bytes_log bytes_log; access_log /usr/local/apache/domlogs/ipxnow.in combined; root /home/ipxnowin/public_html; location / { location ~.*\.(3gp|gif|jpg|jpeg|png|ico|wmv|avi|asf|asx|mpg|mpeg|mp4|pls|mp3|mid|wav|swf|flv|html|htm|txt|js|css|exe|zip|tar|rar|gz|tgz|bz2|uha|7z|doc|docx|xls|xlsx|pdf|iso)$ { expires 7d; try_files $uri @backend; } error_page 405 = @backend; add_header X-Cache "HIT from Backend"; proxy_pass http://194.145.208.19:8081; include proxy.inc; } location @backend { internal; proxy_pass http://194.145.208.19:8081; include proxy.inc; } location ~ .*\.(php|jsp|cgi|pl|py)?$ { proxy_pass http://194.145.208.19:8081; include proxy.inc; } location ~ /\.ht { deny all; } } and proxy.inc: proxy_connect_timeout 59s; proxy_send_timeout 600; proxy_read_timeout 600; proxy_buffer_size 64k; proxy_buffers 16 32k; proxy_busy_buffers_size 64k; proxy_temp_file_write_size 64k; proxy_pass_header Set-Cookie; proxy_redirect off; proxy_hide_header Vary; proxy_set_header Accept-Encoding ''; proxy_ignore_headers Cache-Control Expires; proxy_set_header Referer $http_referer; proxy_set_header Host $host; proxy_set_header Cookie $http_cookie; proxy_set_header X-Real-IP $remote_addr; proxy_set_header X-Forwarded-Host $host; proxy_set_header X-Forwarded-Server $host; proxy_set_header X-Forwarded-For $proxy_add_x_forwarded_for;

    Read the article

  • [Android] Force close when trying to parse JSON with AsyncTask in the background

    - by robs
    Hello everyone, i'm new to android development and i'm playing around with json data. I managed to get the parsing to work. I want to show a ProgressDialog and i read that i need to use AsyncTask that. But for some reason i get a force close as soon as i put the same working code inside doInBackground() eventhough eclipse says everything is fine. Here is the source code: public class HomeActivity extends Activity { public class BackgroundAsyncTask extends AsyncTask<Void, Integer, Void> { ProgressDialog dialog = new ProgressDialog (HomeActivity.this); @Override protected void onPreExecute() { dialog.setMessage("Loading...please wait"); dialog.setIndeterminate(true); dialog.setCancelable(false); dialog.show(); } protected void onPostExecute() { dialog.dismiss(); } @Override protected Void doInBackground(Void... params) { try { URL json = new URL("http://www.corps-marchia.de/jsontest.php"); URLConnection tc = json.openConnection(); BufferedReader in = new BufferedReader(new InputStreamReader(tc.getInputStream())); String line; while ((line = in.readLine()) != null) { JSONArray ja = new JSONArray(line); JSONObject jo = (JSONObject) ja.get(0); TextView txtView = (TextView)findViewById(R.id.TextView01); txtView.setText(jo.getString("text")); } } catch (MalformedURLException e) { e.printStackTrace(); } catch (IOException e) { e.printStackTrace(); } catch (JSONException e) { e.printStackTrace(); } return null; } } @Override public void onCreate(Bundle savedInstanceState) { super.onCreate(savedInstanceState); setContentView(R.layout.main); new BackgroundAsyncTask().execute(); } } Here is the error log: 01-08 12:33:48.225: ERROR/AndroidRuntime(815): FATAL EXCEPTION: AsyncTask #1 01-08 12:33:48.225: ERROR/AndroidRuntime(815): java.lang.RuntimeException: An error occured while executing doInBackground() 01-08 12:33:48.225: ERROR/AndroidRuntime(815): at android.os.AsyncTask$3.done(AsyncTask.java:200) 01-08 12:33:48.225: ERROR/AndroidRuntime(815): at java.util.concurrent.FutureTask$Sync.innerSetException(FutureTask.java:274) 01-08 12:33:48.225: ERROR/AndroidRuntime(815): at java.util.concurrent.FutureTask.setException(FutureTask.java:125) 01-08 12:33:48.225: ERROR/AndroidRuntime(815): at java.util.concurrent.FutureTask$Sync.innerRun(FutureTask.java:308) 01-08 12:33:48.225: ERROR/AndroidRuntime(815): at java.util.concurrent.FutureTask.run(FutureTask.java:138) 01-08 12:33:48.225: ERROR/AndroidRuntime(815): at java.util.concurrent.ThreadPoolExecutor.runWorker(ThreadPoolExecutor.java:1088) 01-08 12:33:48.225: ERROR/AndroidRuntime(815): at java.util.concurrent.ThreadPoolExecutor$Worker.run(ThreadPoolExecutor.java:581) 01-08 12:33:48.225: ERROR/AndroidRuntime(815): at java.lang.Thread.run(Thread.java:1019) 01-08 12:33:48.225: ERROR/AndroidRuntime(815): Caused by: android.view.ViewRoot$CalledFromWrongThreadException: Only the original thread that created a view hierarchy can touch its views. 01-08 12:33:48.225: ERROR/AndroidRuntime(815): at android.view.ViewRoot.checkThread(ViewRoot.java:2932) 01-08 12:33:48.225: ERROR/AndroidRuntime(815): at android.view.ViewRoot.requestLayout(ViewRoot.java:629) 01-08 12:33:48.225: ERROR/AndroidRuntime(815): at android.view.View.requestLayout(View.java:8267) 01-08 12:33:48.225: ERROR/AndroidRuntime(815): at android.view.View.requestLayout(View.java:8267) 01-08 12:33:48.225: ERROR/AndroidRuntime(815): at android.view.View.requestLayout(View.java:8267) 01-08 12:33:48.225: ERROR/AndroidRuntime(815): at android.view.View.requestLayout(View.java:8267) 01-08 12:33:48.225: ERROR/AndroidRuntime(815): at android.view.View.requestLayout(View.java:8267) 01-08 12:33:48.225: ERROR/AndroidRuntime(815): at android.widget.TextView.checkForRelayout(TextView.java:5521) 01-08 12:33:48.225: ERROR/AndroidRuntime(815): at android.widget.TextView.setText(TextView.java:2724) 01-08 12:33:48.225: ERROR/AndroidRuntime(815): at android.widget.TextView.setText(TextView.java:2592) 01-08 12:33:48.225: ERROR/AndroidRuntime(815): at android.widget.TextView.setText(TextView.java:2567) 01-08 12:33:48.225: ERROR/AndroidRuntime(815): at net.ajzele.demo.andy1.HomeActivity$BackgroundAsyncTask.doInBackground(HomeActivity.java:52) 01-08 12:33:48.225: ERROR/AndroidRuntime(815): at net.ajzele.demo.andy1.HomeActivity$BackgroundAsyncTask.doInBackground(HomeActivity.java:1) 01-08 12:33:48.225: ERROR/AndroidRuntime(815): at android.os.AsyncTask$2.call(AsyncTask.java:185) 01-08 12:33:48.225: ERROR/AndroidRuntime(815): at java.util.concurrent.FutureTask$Sync.innerRun(FutureTask.java:306) 01-08 12:33:48.225: ERROR/AndroidRuntime(815): ... 4 more 01-08 12:33:51.605: ERROR/WindowManager(815): Activity net.ajzele.demo.andy1.HomeActivity has leaked window com.android.internal.policy.impl.PhoneWindow$DecorView@4051d0c0 that was originally added here 01-08 12:33:51.605: ERROR/WindowManager(815): android.view.WindowLeaked: Activity net.ajzele.demo.andy1.HomeActivity has leaked window com.android.internal.policy.impl.PhoneWindow$DecorView@4051d0c0 that was originally added here 01-08 12:33:51.605: ERROR/WindowManager(815): at android.view.ViewRoot.<init>(ViewRoot.java:258) 01-08 12:33:51.605: ERROR/WindowManager(815): at android.view.WindowManagerImpl.addView(WindowManagerImpl.java:148) 01-08 12:33:51.605: ERROR/WindowManager(815): at android.view.WindowManagerImpl.addView(WindowManagerImpl.java:91) 01-08 12:33:51.605: ERROR/WindowManager(815): at android.view.Window$LocalWindowManager.addView(Window.java:424) 01-08 12:33:51.605: ERROR/WindowManager(815): at android.app.Dialog.show(Dialog.java:241) 01-08 12:33:51.605: ERROR/WindowManager(815): at net.ajzele.demo.andy1.HomeActivity$BackgroundAsyncTask.onPreExecute(HomeActivity.java:33) 01-08 12:33:51.605: ERROR/WindowManager(815): at android.os.AsyncTask.execute(AsyncTask.java:391) 01-08 12:33:51.605: ERROR/WindowManager(815): at net.ajzele.demo.andy1.HomeActivity.onCreate(HomeActivity.java:72) 01-08 12:33:51.605: ERROR/WindowManager(815): at android.app.Instrumentation.callActivityOnCreate(Instrumentation.java:1047) 01-08 12:33:51.605: ERROR/WindowManager(815): at android.app.ActivityThread.performLaunchActivity(ActivityThread.java:1586) 01-08 12:33:51.605: ERROR/WindowManager(815): at android.app.ActivityThread.handleLaunchActivity(ActivityThread.java:1638) 01-08 12:33:51.605: ERROR/WindowManager(815): at android.app.ActivityThread.access$1500(ActivityThread.java:117) 01-08 12:33:51.605: ERROR/WindowManager(815): at android.app.ActivityThread$H.handleMessage(ActivityThread.java:928) 01-08 12:33:51.605: ERROR/WindowManager(815): at android.os.Handler.dispatchMessage(Handler.java:99) 01-08 12:33:51.605: ERROR/WindowManager(815): at android.os.Looper.loop(Looper.java:123) 01-08 12:33:51.605: ERROR/WindowManager(815): at android.app.ActivityThread.main(ActivityThread.java:3647) 01-08 12:33:51.605: ERROR/WindowManager(815): at java.lang.reflect.Method.invokeNative(Native Method) 01-08 12:33:51.605: ERROR/WindowManager(815): at java.lang.reflect.Method.invoke(Method.java:507) 01-08 12:33:51.605: ERROR/WindowManager(815): at com.android.internal.os.ZygoteInit$MethodAndArgsCaller.run(ZygoteInit.java:839) 01-08 12:33:51.605: ERROR/WindowManager(815): at com.android.internal.os.ZygoteInit.main(ZygoteInit.java:597) 01-08 12:33:51.605: ERROR/WindowManager(815): at dalvik.system.NativeStart.main(Native Method) Any hints? I hope you can help me out ive searched the net and didnt find any working solution...Thanks in advance

    Read the article

  • Java List to Excel Columns

    - by Nitin
    Correct me where I'm going wrong. I'm have written a program in Java which will get list of files from two different directories and make two (Java list) with the file names. I want to transfer the both the list (downloaded files list and Uploaded files list) to an excel. What the result i'm getting is those list are transferred row wise. I want them in column wise. Given below is the code: public class F { static List<String> downloadList = new ArrayList<>(); static List<String> dispatchList = new ArrayList<>(); public static class FileVisitor extends SimpleFileVisitor<Path> { @Override public FileVisitResult visitFile(Path file, BasicFileAttributes attrs) throws IOException { String name = file.toRealPath().getFileName().toString(); if (name.endsWith(".pdf") || name.endsWith(".zip")) { downloadList.add(name); } if (name.endsWith(".xml")) { dispatchList.add(name); } return FileVisitResult.CONTINUE; } } public static void main(String[] args) throws IOException { try { Path downloadPath = Paths.get("E:\\report\\02_Download\\10252013"); Path dispatchPath = Paths.get("E:\\report\\01_Dispatch\\10252013"); FileVisitor visitor = new FileVisitor(); Files.walkFileTree(downloadPath, visitor); Files.walkFileTree(downloadPath, EnumSet.of(FileVisitOption.FOLLOW_LINKS), 1, visitor); Files.walkFileTree(dispatchPath, visitor); Files.walkFileTree(dispatchPath, EnumSet.of(FileVisitOption.FOLLOW_LINKS), 1, visitor); System.out.println("Download File List" + downloadList); System.out.println("Dispatch File List" + dispatchList); F f = new F(); f.UpDown(downloadList, dispatchList); } catch (Exception ex) { Logger.getLogger(F.class.getName()).log(Level.SEVERE, null, ex); } } int rownum = 0; int colnum = 0; HSSFSheet firstSheet; Collection<File> files; HSSFWorkbook workbook; File exactFile; { workbook = new HSSFWorkbook(); firstSheet = workbook.createSheet("10252013"); Row headerRow = firstSheet.createRow(rownum); headerRow.setHeightInPoints(40); } public void UpDown(List<String> download, List<String> upload) throws Exception { List<String> headerRow = new ArrayList<>(); headerRow.add("Downloaded"); headerRow.add("Uploaded"); List<List> recordToAdd = new ArrayList<>(); recordToAdd.add(headerRow); recordToAdd.add(download); recordToAdd.add(upload); F f = new F(); f.CreateExcelFile(recordToAdd); f.createExcelFile(); } void createExcelFile() { FileOutputStream fos = null; try { fos = new FileOutputStream(new File("E:\\report\\Download&Upload.xls")); HSSFCellStyle hsfstyle = workbook.createCellStyle(); hsfstyle.setBorderBottom((short) 1); hsfstyle.setFillBackgroundColor((short) 245); workbook.write(fos); } catch (Exception e) { } } public void CreateExcelFile(List<List> l1) throws Exception { try { for (int j = 0; j < l1.size(); j++) { Row row = firstSheet.createRow(rownum); List<String> l2 = l1.get(j); for (int k = 0; k < l2.size(); k++) { Cell cell = row.createCell(k); cell.setCellValue(l2.get(k)); } rownum++; } } catch (Exception e) { } finally { } } } (The purpose is to verify the files Downloaded and Uploaded for the given date) Thanks.

    Read the article

  • Nginx reverse proxy IP issue

    - by Tiffany Walker
    For some reason Apache is still seeing my SERVERS ip. Is this an nginx problem? /etc/nginx.conf user nobody; # no need for more workers in the proxy mode worker_processes 4; error_log /var/log/nginx/error.log info; worker_rlimit_nofile 20480; events { worker_connections 5120; # increase for busier servers use epoll; # you should use epoll here for Linux kernels 2.6.x } http { server_name_in_redirect off; server_names_hash_max_size 10240; server_names_hash_bucket_size 1024; include mime.types; default_type application/octet-stream; server_tokens off; disable_symlinks if_not_owner; sendfile on; tcp_nopush on; tcp_nodelay on; keepalive_timeout 5; gzip on; gzip_vary on; gzip_disable "MSIE [1-6]\."; gzip_proxied any; gzip_http_version 1.1; gzip_min_length 1000; gzip_comp_level 6; gzip_buffers 16 8k; # You can remove image/png image/x-icon image/gif image/jpeg if you have slow CPU gzip_types text/plain text/xml text/css application/x-javascript application/xml image/png image/x-icon image/gif image/jpeg application/xml+rss text/javascript application/atom+xml; ignore_invalid_headers on; client_header_timeout 3m; client_body_timeout 3m; send_timeout 3m; reset_timedout_connection on; connection_pool_size 256; client_header_buffer_size 256k; large_client_header_buffers 4 256k; client_max_body_size 200M; client_body_buffer_size 128k; request_pool_size 32k; output_buffers 4 32k; postpone_output 1460; proxy_temp_path /tmp/nginx_proxy/; client_body_in_file_only on; log_format bytes_log "$msec $bytes_sent ."; include "/etc/nginx/vhosts/*"; } proxy.inc proxy_connect_timeout 59s; proxy_send_timeout 600; proxy_read_timeout 600; proxy_buffer_size 64k; proxy_buffers 16 32k; proxy_busy_buffers_size 64k; proxy_temp_file_write_size 64k; proxy_pass_header Set-Cookie; proxy_redirect off; proxy_hide_header Vary; proxy_set_header Accept-Encoding ''; proxy_ignore_headers Cache-Control Expires; proxy_set_header Referer $http_referer; proxy_set_header Host $host; proxy_set_header Cookie $http_cookie; proxy_set_header X-Real-IP $remote_addr; proxy_set_header X-Forwarded-Host $host; proxy_set_header X-Forwarded-Server $host; proxy_set_header X-Forwarded-For $proxy_add_x_forwarded_for; vhost file: server { error_log /var/log/nginx/vhost-error_log warn; listen 63.6.1.12:80; server_name photo-rolldomain.com www.domain.com; access_log /usr/local/apache/domlogs/domain.com-bytes_log bytes_log; access_log /usr/local/apache/domlogs/domain.com combined; root /home/mtech/public_html; location / { location ~.*\.(3gp|gif|jpg|jpeg|png|ico|wmv|avi|asf|asx|mpg|mpeg|mp4|pls|mp3|mid|wav|swf|flv|html|htm|txt|js|css|exe|zip|tar|rar|gz|tgz|bz2|uha|7z|doc|docx|xls|xlsx|pdf|iso)$ { expires 7d; try_files $uri @backend; } error_page 405 = @backend; add_header X-Cache "HIT from Backend"; proxy_pass http://63.6.1.12:8081; include proxy.inc; } location @backend { internal; proxy_pass http://63.6.1.12:8081; include proxy.inc; } location ~ .*\.(php|jsp|cgi|pl|py)?$ { proxy_pass http://63.6.1.12:8081; include proxy.inc; } location ~ /\.ht { deny all; } }

    Read the article

  • Fastest way to parse XML files in C#?

    - by LifeH2O
    I have to load many XML files from internet. But for testing with better speed i downloaded all of them (more than 500 files) of the following format. <player-profile> <personal-information> <id>36</id> <fullname>Adam Gilchrist</fullname> <majorteam>Australia</majorteam> <nickname>Gilchrist</nickname> <shortName>A Gilchrist</shortName> <dateofbirth>Nov 14, 1971</dateofbirth> <battingstyle>Left-hand bat</battingstyle> <bowlingstyle>Right-arm offbreak</bowlingstyle> <role>Wicket-Keeper</role> <teams-played-for>Western Australia, New South Wales, ICC World XI, Deccan Chargers, Australia</teams-played-for> <iplteam>Deccan Chargers</iplteam> </personal-information> <batting-statistics> <odi-stats> <matchtype>ODI</matchtype> <matches>287</matches> <innings>279</innings> <notouts>11</notouts> <runsscored>9619</runsscored> <highestscore>172</highestscore> <ballstaken>9922</ballstaken> <sixes>149</sixes> <fours>1000+</fours> <ducks>0</ducks> <fifties>55</fifties> <catches>417</catches> <stumpings>55</stumpings> <hundreds>16</hundreds> <strikerate>96.95</strikerate> <average>35.89</average> </odi-stats> <test-stats> . . . </test-stats> <t20-stats> . . . </t20-stats> <ipl-stats> . . . </ipl-stats> </batting-statistics> <bowling-statistics> <odi-stats> . . . </odi-stats> <test-stats> . . . </test-stats> <t20-stats> . . . </t20-stats> <ipl-stats> . . . </ipl-stats> </bowling-statistics> </player-profile> I am using XmlNodeList list = _document.SelectNodes("/player-profile/batting-statistics/odi-stats"); And then loop this list with foreach as foreach (XmlNode stats in list) { _btMatchType = GetInnerString(stats, "matchtype"); //it returns null string if node not availible . . . . _btAvg = Convert.ToDouble(stats["average"].InnerText); } Even i am loading all files offline, parsing is very slow Is there any good faster way to parse them? Or is it problem with SQL? I am saving all extracted data from XML to database using DataSets, TableAdapters with insert command. I

    Read the article

  • C# SQL Parameter Errors in Loops

    - by jakesankey
    Please help me out with this. I have this small application to load txt files into a sql db and it works fine with sqlite. When I ported to SQL I started getting 'parameter already declared' errors.. If anyone can help me reorganize this code, it would be great! I need to get the parameter definitions outside of the loops or something.. using System; using System.Data; using System.Data.SQLite; using System.IO; using System.Text.RegularExpressions; using System.Threading; using System.Collections.Generic; using System.Linq; using System.Data.SqlClient; namespace JohnDeereCMMDataParser { internal class Program { public static List<string> GetImportedFileList() { List<string> ImportedFiles = new List<string>(); using (SqlConnection connect = new SqlConnection(@"Server=FRXSQLDEV;Database=RX_CMMData;Integrated Security=YES")) { connect.Open(); using (SqlCommand fmd = connect.CreateCommand()) { fmd.CommandText = @"SELECT FileName FROM Import;"; fmd.CommandType = CommandType.Text; SqlDataReader r = fmd.ExecuteReader(); while (r.Read()) { ImportedFiles.Add(Convert.ToString(r["FileName"])); } } } return ImportedFiles; } private static void Main(string[] args) { using (SqlConnection con = new SqlConnection(@"Server=FRXSQLDEV;Database=RX_CMMData;Integrated Security=YES")) { con.Open(); using (SqlCommand insertCommand = con.CreateCommand()) { Console.WriteLine("Connecting to SQL server..."); SqlCommand cmdd = con.CreateCommand(); string[] files = Directory.GetFiles(@"C:\Documents and Settings\js91162\Desktop\", "R.txt*", SearchOption.AllDirectories); insertCommand.Parameters.Add(new SqlParameter("@FeatType", DbType.String)); insertCommand.Parameters.Add(new SqlParameter("@FeatName", DbType.String)); insertCommand.Parameters.Add(new SqlParameter("@Value", DbType.String)); insertCommand.Parameters.Add(new SqlParameter("@Actual", DbType.Decimal)); insertCommand.Parameters.Add(new SqlParameter("@Nominal", DbType.Decimal)); insertCommand.Parameters.Add(new SqlParameter("@Dev", DbType.Decimal)); insertCommand.Parameters.Add(new SqlParameter("@TolMin", DbType.Decimal)); insertCommand.Parameters.Add(new SqlParameter("@TolPlus", DbType.Decimal)); insertCommand.Parameters.Add(new SqlParameter("@OutOfTol", DbType.Decimal)); List<string> ImportedFiles = GetImportedFileList(); foreach (string file in files.Except(ImportedFiles)) { var FileNameExt1 = Path.GetFileName(file); cmdd.Parameters.Add(new SqlParameter("@FileExt", FileNameExt1)); cmdd.CommandText = @" IF (EXISTS (SELECT * FROM INFORMATION_SCHEMA.TABLES WHERE TABLE_SCHEMA = 'RX_CMMData' AND TABLE_NAME = 'Import')) BEGIN SELECT COUNT(*) FROM Import WHERE FileName = @FileExt; END"; int count = Convert.ToInt32(cmdd.ExecuteScalar()); con.Close(); con.Open(); if (count == 0) { Console.WriteLine("Parsing CMM data for SQL database... Please wait."); insertCommand.CommandText = @" INSERT INTO Import (FeatType, FeatName, Value, Actual, Nominal, Dev, TolMin, TolPlus, OutOfTol, PartNumber, CMMNumber, Date, FileName) VALUES (@FeatType, @FeatName, @Value, @Actual, @Nominal, @Dev, @TolMin, @TolPlus, @OutOfTol, @PartNumber, @CMMNumber, @Date, @FileName);"; string FileNameExt = Path.GetFullPath(file); string RNumber = Path.GetFileNameWithoutExtension(file); string RNumberE = RNumber.Split('_')[0]; string RNumberD = RNumber.Split('_')[1]; string RNumberDate = RNumber.Split('_')[2]; DateTime dateTime = DateTime.ParseExact(RNumberDate, "yyyyMMdd", Thread.CurrentThread.CurrentCulture); string cmmDate = dateTime.ToString("dd-MMM-yyyy"); string[] lines = File.ReadAllLines(file); bool parse = false; foreach (string tmpLine in lines) { string line = tmpLine.Trim(); if (!parse && line.StartsWith("Feat. Type,")) { parse = true; continue; } if (!parse || string.IsNullOrEmpty(line)) { continue; } Console.WriteLine(tmpLine); foreach (SqlParameter parameter in insertCommand.Parameters) { parameter.Value = null; } string[] values = line.Split(new[] { ',' }); for (int i = 0; i < values.Length - 1; i++) { SqlParameter param = insertCommand.Parameters[i]; if (param.DbType == DbType.Decimal) { decimal value; param.Value = decimal.TryParse(values[i], out value) ? value : 0; } else { param.Value = values[i]; } } } insertCommand.Parameters.Add(new SqlParameter("@PartNumber", RNumberE)); insertCommand.Parameters.Add(new SqlParameter("@CMMNumber", RNumberD)); insertCommand.Parameters.Add(new SqlParameter("@Date", cmmDate)); insertCommand.Parameters.Add(new SqlParameter("@FileName", FileNameExt)); // insertCommand.ExecuteNonQuery(); } } Console.WriteLine("CMM data successfully imported to SQL database..."); } con.Close(); } } } } FYI - the PartNumber, CMMNumber, Date, etc at the bottom are pulled from the file name and I need it in the table next to each respective record.

    Read the article

  • Self-relation messes up contents in fetching

    - by holographix
    Hi folks, I'm dealing with an annoying problem in core data I've got a table named Character, which is made as follows I'm filling the table in various steps: 1) fill the attributes of the table 2) fill the Character Relation (charRel) FYI charRel is defined as follows I'm feeding the contents by pulling the data from an xml, the feeding code is this curStr = [[NSMutableString stringWithString:[curStr stringByTrimmingCharactersInSet:[NSCharacterSet whitespaceAndNewlineCharacterSet]]] retain]; NSLog(@"Parsing relation within these keys %@, in order to get'em associated",curStr); NSArray *chunks = [curStr componentsSeparatedByString: @","]; for( NSString *relId in chunks ) { NSLog(@"Associating %@ with id %@",[currentCharacter valueForKey:@"character_id"], relId); NSFetchRequest *request = [[NSFetchRequest alloc] init]; NSPredicate *predicate = [NSPredicate predicateWithFormat:@"character_id == %@", relId]; [request setEntity:[NSEntityDescription entityForName:@"Character" inManagedObjectContext:[self managedObjectContext] ]]; [request setPredicate:predicate]; NSerror *error = nil; NSArray *results = [[self managedObjectContext] executeFetchRequest:request error:&error]; // error handling code if(error != nil) { NSLog(@"[SYMBOL CORRELATION]: retrieving correlated symbol error: %@", [error localizedDescription]); } else if([results count] > 0) { Character *relatedChar = [results objectAtIndex:0]; // grab the first result in the stack, could be done better! [currentCharacter addCharRelObject:relatedChar]; //VICE VERSA RELATIONS NSArray *charRels = [relatedChar valueForKey:@"charRel"]; BOOL alreadyRelated = NO; for(Character *charRel in charRels) { if([[charRel valueForKey:@"character_id"] isEqual:[currentCharacter valueForKey:@"character_id"]]) { alreadyRelated = YES; break; } } if(!alreadyRelated) { NSLog(@"\n\t\trelating %@ with %@", [relatedChar valueForKey:@"character_id"], [currentCharacter valueForKey:@"character_id"]); [relatedChar addCharRelObject:currentCharacter]; } } else { NSLog(@"[SYMBOL CORRELATION]: related symbol was not found! ##SKIPPING-->"); } [request release]; } NSLog(@"\t\t### TOTAL OF REALTIONS FOR ID %@: %d\n%@", [currentCharacter valueForKey:@"character_id"], [[currentCharacter valueForKey:@"charRel"] count], currentCharacter); error = nil; /* SAVE THE CONTEXT */ if (![managedObjectContext save:&error]) { NSLog(@"Whoops, couldn't save the symbol record: %@", [error localizedDescription]); NSArray* detailedErrors = [[error userInfo] objectForKey:NSDetailedErrorsKey]; if(detailedErrors != nil && [detailedErrors count] > 0) { for(NSError* detailedError in detailedErrors) { NSLog(@"\n################\t\tDetailedError: %@\n################", [detailedError userInfo]); } } else { NSLog(@" %@", [error userInfo]); } } at this point when I print out the values of the currentCharacter, everything looks perfect. every relation is in its place. in example in this log we can clearly see that this element has got 3 items in charRel: <Character: 0x5593af0> (entity: Character; id: 0x55938c0 <x-coredata://67288D50-D349-4B19-B7CB-F7AC4671AD61/Character/p86> ; data: { catRel = "<relationship fault: 0x9a29db0 'catRel'>"; charRel = ( "0x9a1f870 <x-coredata://67288D50-D349-4B19-B7CB-F7AC4671AD61/Character/p74>", "0x9a14bd0 <x-coredata://67288D50-D349-4B19-B7CB-F7AC4671AD61/Character/p109>", "0x558ba00 <x-coredata://67288D50-D349-4B19-B7CB-F7AC4671AD61/Character/p5>" ); "character_id" = 254; examplesRel = "<relationship fault: 0x9a29df0 'examplesRel'>"; meaning = "\n Left"; pinyin = "\n zu\U01d2"; "pronunciation_it" = "\n zu\U01d2"; strokenumber = 5; text = "\n \n <p>The most ancient form of this symbol"; unicodevalue = "\n \U5de6"; }) then when I'm in need of retrieving this item I perform an extraction, like this: // at first I get the single Character record NSFetchRequest *request = [[NSFetchRequest alloc] init]; NSError *error; NSPredicate *predicate = [NSPredicate predicateWithFormat:@"character_id == %@", self.char_id ]; [request setEntity:[NSEntityDescription entityForName:@"Character" inManagedObjectContext:_context ]]; [request setPredicate:predicate]; NSArray *fetchedObjs = [_context executeFetchRequest:request error:&error]; when, for instance, I print out in NSLog the contents of charRel NSArray *correlations = [singleCharacter valueForKey:@"charRel"]; NSLog(@"CHARACTER OBJECT \n%@", correlations); I get this Relationship fault for (<NSRelationshipDescription: 0x5568520>), name charRel, isOptional 1, isTransient 0, entity Character, renamingIdentifier charRel, validation predicates (), warnings (), versionHashModifier (null), destination entity Character, inverseRelationship (null), minCount 1, maxCount 99 on 0x6937f00 hope that I made myself clear. this thing is driving me insane, I've googled all over world, but I couldn't find a solution (and this make me think to as issue related to bad coding somehow :P). thank you in advance guys. k

    Read the article

  • SQL error C# - Parameter already defined

    - by jakesankey
    Hey there. I have a c# application that parses txt files and imports the data from them into a sql db. I was using sqlite and am now working on porting it to sql server. It was working fine with sqlite but now with sql i am getting an error when it is processing the files. It added the first row of data to the db and then says "parameter @PartNumber has already been declared. Variable names must be unique within a batch or stored procedure". Here is my whole code and SQL table layout ... the error comes at the last insertCommand.ExecuteNonQuery() instance at the end of the code... SQL TABLE: CREATE TABLE Import ( RowId int PRIMARY KEY IDENTITY, PartNumber text, CMMNumber text, Date text, FeatType text, FeatName text, Value text, Actual text, Nominal text, Dev text, TolMin text, TolPlus text, OutOfTol text, FileName text ); CODE: using System; using System.Data; using System.Data.SQLite; using System.IO; using System.Text.RegularExpressions; using System.Threading; using System.Collections.Generic; using System.Linq; using System.Data.SqlClient; namespace JohnDeereCMMDataParser { internal class Program { public static List<string> GetImportedFileList() { List<string> ImportedFiles = new List<string>(); using (SqlConnection connect = new SqlConnection(@"Server=FRXSQLDEV;Database=RX_CMMData;Integrated Security=YES")) { connect.Open(); using (SqlCommand fmd = connect.CreateCommand()) { fmd.CommandText = @"IF (EXISTS (SELECT * FROM INFORMATION_SCHEMA.TABLES WHERE TABLE_SCHEMA = 'RX_CMMData' AND TABLE_NAME = 'Import')) BEGIN SELECT DISTINCT FileName FROM Import; END"; fmd.CommandType = CommandType.Text; SqlDataReader r = fmd.ExecuteReader(); while (r.Read()) { ImportedFiles.Add(Convert.ToString(r["FileName"])); } } } return ImportedFiles; } private static void Main(string[] args) { Console.Title = "John Deere CMM Data Parser"; Console.WriteLine("Preparing CMM Data Parser... done"); Console.WriteLine("Scanning for new CMM data... done"); Console.ForegroundColor = ConsoleColor.Gray; using (SqlConnection con = new SqlConnection(@"Server=FRXSQLDEV;Database=RX_CMMData;Integrated Security=YES")) { con.Open(); using (SqlCommand insertCommand = con.CreateCommand()) { SqlCommand cmdd = con.CreateCommand(); string[] files = Directory.GetFiles(@"C:\Documents and Settings\js91162\Desktop\", "R303717*.txt*", SearchOption.AllDirectories); List<string> ImportedFiles = GetImportedFileList(); foreach (string file in files.Except(ImportedFiles)) { string FileNameExt1 = Path.GetFileName(file); cmdd.CommandText = @" IF (EXISTS (SELECT * FROM INFORMATION_SCHEMA.TABLES WHERE TABLE_SCHEMA = 'RX_CMMData' AND TABLE_NAME = 'Import')) BEGIN SELECT COUNT(*) FROM Import WHERE FileName = @FileExt; END"; cmdd.Parameters.Add(new SqlParameter("@FileExt", FileNameExt1)); int count = Convert.ToInt32(cmdd.ExecuteScalar()); con.Close(); con.Open(); if (count == 0) { Console.WriteLine("Parsing CMM data for SQL database... Please wait."); insertCommand.CommandText = @" INSERT INTO Import (FeatType, FeatName, Value, Actual, Nominal, Dev, TolMin, TolPlus, OutOfTol, PartNumber, CMMNumber, Date, FileName) VALUES (@FeatType, @FeatName, @Value, @Actual, @Nominal, @Dev, @TolMin, @TolPlus, @OutOfTol, @PartNumber, @CMMNumber, @Date, @FileName);"; insertCommand.Parameters.Add(new SqlParameter("@FeatType", DbType.Decimal)); insertCommand.Parameters.Add(new SqlParameter("@FeatName", DbType.Decimal)); insertCommand.Parameters.Add(new SqlParameter("@Value", DbType.Decimal)); insertCommand.Parameters.Add(new SqlParameter("@Actual", DbType.Decimal)); insertCommand.Parameters.Add(new SqlParameter("@Nominal", DbType.Decimal)); insertCommand.Parameters.Add(new SqlParameter("@Dev", DbType.Decimal)); insertCommand.Parameters.Add(new SqlParameter("@TolMin", DbType.Decimal)); insertCommand.Parameters.Add(new SqlParameter("@TolPlus", DbType.Decimal)); insertCommand.Parameters.Add(new SqlParameter("@OutOfTol", DbType.Decimal)); string FileNameExt = Path.GetFullPath(file); string RNumber = Path.GetFileNameWithoutExtension(file); string RNumberE = RNumber.Split('_')[0]; string RNumberD = RNumber.Split('_')[1]; string RNumberDate = RNumber.Split('_')[2]; DateTime dateTime = DateTime.ParseExact(RNumberDate, "yyyyMMdd", Thread.CurrentThread.CurrentCulture); string cmmDate = dateTime.ToString("dd-MMM-yyyy"); string[] lines = File.ReadAllLines(file); bool parse = false; foreach (string tmpLine in lines) { string line = tmpLine.Trim(); if (!parse && line.StartsWith("Feat. Type,")) { parse = true; continue; } if (!parse || string.IsNullOrEmpty(line)) { continue; } Console.WriteLine(tmpLine); foreach (SqlParameter parameter in insertCommand.Parameters) { parameter.Value = null; } string[] values = line.Split(new[] { ',' }); for (int i = 0; i < values.Length - 1; i++) { SqlParameter param = insertCommand.Parameters[i]; if (param.DbType == DbType.Decimal) { decimal value; param.Value = decimal.TryParse(values[i], out value) ? value : 0; } else { param.Value = values[i]; } } insertCommand.Parameters.Add(new SqlParameter("@PartNumber", RNumberE)); insertCommand.Parameters.Add(new SqlParameter("@CMMNumber", RNumberD)); insertCommand.Parameters.Add(new SqlParameter("@Date", cmmDate)); insertCommand.Parameters.Add(new SqlParameter("@FileName", FileNameExt)); // insertCommand.ExecuteNonQuery(); } } } Console.WriteLine("CMM data successfully imported to SQL database..."); } con.Close(); } } } }

    Read the article

  • Performance issues with repeatable loops as control part

    - by djerry
    Hey guys, In my application, i need to show made calls to the user. The user can arrange some filters, according to what they want to see. The problem is that i find it quite hard to filter the calls without losing performance. This is what i am using now : private void ProcessFilterChoice() { _filteredCalls = ServiceConnector.ServiceConnector.SingletonServiceConnector.Proxy.GetAllCalls().ToList(); if (cboOutgoingIncoming.SelectedIndex > -1) GetFilterPartOutgoingIncoming(); if (cboInternExtern.SelectedIndex > -1) GetFilterPartInternExtern(); if (cboDateFilter.SelectedIndex > -1) GetFilteredCallsByDate(); wbPdf.Source = null; btnPrint.Content = "Pdf preview"; } private void GetFilterPartOutgoingIncoming() { if (cboOutgoingIncoming.SelectedItem.ToString().Equals("Outgoing")) for (int i = _filteredCalls.Count - 1; i > -1; i--) { if (_filteredCalls[i].Caller.E164.Length > 4 || _filteredCalls[i].Caller.E164.Equals("0")) _filteredCalls.RemoveAt(i); } else if (cboOutgoingIncoming.SelectedItem.ToString().Equals("Incoming")) for (int i = _filteredCalls.Count - 1; i > -1; i--) { if (_filteredCalls[i].Called.E164.Length > 4 || _filteredCalls[i].Called.E164.Equals("0")) _filteredCalls.RemoveAt(i); } } private void GetFilterPartInternExtern() { if (cboInternExtern.SelectedItem.ToString().Equals("Intern")) for (int i = _filteredCalls.Count - 1; i > -1; i--) { if (_filteredCalls[i].Called.E164.Length > 4 || _filteredCalls[i].Caller.E164.Length > 4 || _filteredCalls[i].Caller.E164.Equals("0")) _filteredCalls.RemoveAt(i); } else if (cboInternExtern.SelectedItem.ToString().Equals("Extern")) for (int i = _filteredCalls.Count - 1; i > -1; i--) { if ((_filteredCalls[i].Called.E164.Length < 5 && _filteredCalls[i].Caller.E164.Length < 5) || _filteredCalls[i].Called.E164.Equals("0")) _filteredCalls.RemoveAt(i); } } private void GetFilteredCallsByDate() { DateTime period = DateTime.Now; switch (cboDateFilter.SelectedItem.ToString()) { case "Today": period = DateTime.Today; break; case "Last week": period = DateTime.Today.Subtract(new TimeSpan(7, 0, 0, 0)); break; case "Last month": period = DateTime.Today.AddMonths(-1); break; case "Last year": period = DateTime.Today.AddYears(-1); break; default: return; } for (int i = _filteredCalls.Count - 1; i > -1; i--) { if (_filteredCalls[i].Start < period) _filteredCalls.RemoveAt(i); } } _filtered calls is a list of "calls". Calls is a class that looks like this : [DataContract] public class Call { private User caller, called; private DateTime start, end; private string conferenceId; private int id; private bool isNew = false; [DataMember] public bool IsNew { get { return isNew; } set { isNew = value; } } [DataMember] public int Id { get { return id; } set { id = value; } } [DataMember] public string ConferenceId { get { return conferenceId; } set { conferenceId = value; } } [DataMember] public DateTime End { get { return end; } set { end = value; } } [DataMember] public DateTime Start { get { return start; } set { start = value; } } [DataMember] public User Called { get { return called; } set { called = value; } } [DataMember] public User Caller { get { return caller; } set { caller = value; } } Can anyone direct me to a better solution or make some suggestions.

    Read the article

  • Wordpress blog with Joomla?

    - by user427902
    Hi, I had this Wordpress installation which was installed in a subfolder (not root). Like http: //server/blog/. Now, I installed Joomla on the root (http: //server/). Everything seems to be working fine with the Joomla part. However, the blog part is messed up. If I try to browse the homepage of my blog which is http: //server/blog/ it works like a charm. But while trying to view individual blog pages like say, http: //server/blog/some_category/some_post I get a Joomla 404 page. So, I was wondering if it was possible to use both Wordpress and Joomla in the same server in the setup I am trying to. Let me clarify that I am NOT looking to integrate user login and other such things. I just want the blog to be functional under a subfolder while I run the Joomla site in the root. So, what is the correct way to go about it. Can this be solved by any .config edits or something else? Edit: Here's the .htaccess for Joomla ... (I can't find any .htaccess for Wp though, still looking for it.) ## # @version $Id: htaccess.txt 14401 2010-01-26 14:10:00Z louis $ # @package Joomla # @copyright Copyright (C) 2005 - 2010 Open Source Matters. All rights reserved. # @license http://www.gnu.org/copyleft/gpl.html GNU/GPL # Joomla! is Free Software ## ##################################################### # READ THIS COMPLETELY IF YOU CHOOSE TO USE THIS FILE # # The line just below this section: 'Options +FollowSymLinks' may cause problems # with some server configurations. It is required for use of mod_rewrite, but may already # be set by your server administrator in a way that dissallows changing it in # your .htaccess file. If using it causes your server to error out, comment it out (add # to # beginning of line), reload your site in your browser and test your sef url's. If they work, # it has been set by your server administrator and you do not need it set here. # ##################################################### ## Can be commented out if causes errors, see notes above. Options +FollowSymLinks # # mod_rewrite in use RewriteEngine On ########## Begin - Rewrite rules to block out some common exploits ## If you experience problems on your site block out the operations listed below ## This attempts to block the most common type of exploit `attempts` to Joomla! # ## Deny access to extension xml files (uncomment out to activate) #<Files ~ "\.xml$"> #Order allow,deny #Deny from all #Satisfy all #</Files> ## End of deny access to extension xml files RewriteCond %{QUERY_STRING} mosConfig_[a-zA-Z_]{1,21}(=|\%3D) [OR] # Block out any script trying to base64_encode crap to send via URL RewriteCond %{QUERY_STRING} base64_encode.*\(.*\) [OR] # Block out any script that includes a <script> tag in URL RewriteCond %{QUERY_STRING} (\<|%3C).*script.*(\>|%3E) [NC,OR] # Block out any script trying to set a PHP GLOBALS variable via URL RewriteCond %{QUERY_STRING} GLOBALS(=|\[|\%[0-9A-Z]{0,2}) [OR] # Block out any script trying to modify a _REQUEST variable via URL RewriteCond %{QUERY_STRING} _REQUEST(=|\[|\%[0-9A-Z]{0,2}) # Send all blocked request to homepage with 403 Forbidden error! RewriteRule ^(.*)$ index.php [F,L] # ########## End - Rewrite rules to block out some common exploits # Uncomment following line if your webserver's URL # is not directly related to physical file paths. # Update Your Joomla! Directory (just / for root) # RewriteBase / ########## Begin - Joomla! core SEF Section # RewriteCond %{REQUEST_FILENAME} !-f RewriteCond %{REQUEST_FILENAME} !-d RewriteCond %{REQUEST_URI} !^/index.php RewriteCond %{REQUEST_URI} (/|\.php|\.html|\.htm|\.feed|\.pdf|\.raw|/[^.]*)$ [NC] RewriteRule (.*) index.php RewriteRule .* - [E=HTTP_AUTHORIZATION:%{HTTP:Authorization},L] # ########## End - Joomla! core SEF Section

    Read the article

  • How do I learn algorithms?

    - by Panthe
    Brief History: Just graduated high school, learned a bit of python and C++, have no friends with any helpful computer knowledge at all. Out of anyone i met in my school years I was probably the biggest nerd, but no one really knew. I consider my self to have a vast amount of knowledge on computers and tech then the average person. built/fixed tons of computers, and ability to troubleshoot pretty much any problem I came across. Now that high school is over, Ive really been thinking about my career. Loving, living computers for the past 15 years of my life I decided to take my ability's and try to learn computer programming, why I didn't start earlier I don't know, seems to be big mistake on my part... Doing some research I concluded that Python was the first programming language I should learn, since it was high level and easier to understand then C++ and Java. I also knew that to become good at what I did I needed to know more then just 2 or 3 languages, which didn't seem like a big problem considering once I learned the way Python worked, mainly syntax changed, and the rest would come naturally. I watched a couple of youtube videos, downloaded some book pdf's and snooped around from some tutorials here and there to get the hang of what to do. A two solid weeks had passed of trying to understand the syntax, create small programs that used the basic functions and understanding how it worked, I think i have got the hang of it. It breaks down into what ive been dealing with all this time (although i kinda knew) is that, input,output, loops, functions and other things derived from 0's and 1's storing data and recalling it, ect. (A VERY BASIC IDEA). Ive been able to create small programs, Hangman, file storing, temperature conversion, Caeser Cipher decode/encoding, Fibonacci Sequence and more, which i can create and understand how each work. Being 2 weeks into this, I have learned alot. Nothing at all compared to what i should be lear ning in the years to come if i get a grip on what I'm doing. While doing these programs I wont stop untill I've done doing a practice problem on a book, which embarresing enough will take me a couple hour depending on the complexity of it. I absolutly will not put aside the challenge until its complete, WHICH CAN BE EXTREMELY DRAINING, ive tried most problems without cheating and reached success, which makes me feel extremely proud of my self after completing something after much trial and error. After all this I have met the demon, alogrithm's which seem to be key to effiecent code. I cant seem to rap my head around some of the computer codes people put out there using numbers, and sometimes even basic functions, I have been able to understand them after a while but i know there are alot more complex things to come, considering my self smart, functions that require complex codes, actually hurt my brain. NOTHING EVER IN LIFE HURT MY BRAIN....... not even math classes in highschool, trying to understand some of the stuff people put out there makes me feel like i have a mental disadvantage lol... i still walk forward though, crossing my fingers that the understanding will come with time. Sorry if is this is long i just wish someone takes all these things into consideration when answering my question. even through all these downsides im still pushing through and continuing to try and get good at this, i know reading these tutorials wont make me any good unless i can become creative and make my own, understand other peoples programs, so this leads me to the simple question i could have asked in the beginning..... WHERE IN THE WORLD DO I START ? Ive been trying to find out how to understand some of the open source projects, how i can work with experianced coders to learn from them and help them, but i dont think thats even possible by the way how far people's knowledge is compared to me, i have no freinds who i can learn from, can someone help me and guide me into the right direction.. i have a huge motivation to get good at coding, anything information would be extremely helpful

    Read the article

  • Can anyone tell me why my XML writer is not writing attributes?

    - by user1632018
    I am writing a parsing tool to help me clean up a large VC++ project before I make .net bindings for it. I am using an XML writer to read an xml file and write out each element to a new file. If an element with a certain name is found, then it executes some code and writes an output value into the elements value. So far it is almost working, except for one thing: It is not copying the attributes. Can anyone tell me why this is happening? Here is a sample of what it is supposed to copy/modify(Includes the attributes): <?xml version="1.0" encoding="utf-8"?> <Project DefaultTargets="Build" ToolsVersion="4.0" xmlns="http://schemas.microsoft.com/developer/msbuild/2003"> <ItemGroup Label="ProjectConfigurations"> <ProjectConfiguration Include="Debug|Win32"> <Configuration>Debug</Configuration> <Platform>Win32</Platform> </ProjectConfiguration> <ProjectConfiguration Include="Release|Win32"> <Configuration>Release</Configuration> <Platform>Win32</Platform> </ProjectConfiguration> </ItemGroup> <PropertyGroup Label="Globals"> <ProjectGuid>{57900E99-A405-49F4-83B2-0254117D041B}</ProjectGuid> <Keyword>Win32Proj</Keyword> <RootNamespace>libproj</RootNamespace> </PropertyGroup> Here is the output I am getting(No Attributes): <?xml version="1.0" encoding="utf-8"?> <Project> <ItemGroup> <ProjectConfiguration> <Configuration>Debug</Configuration> <Platform>Win32</Platform> </ProjectConfiguration> <ProjectConfiguration> <Configuration>Release</Configuration> <Platform>Win32</Platform> </ProjectConfiguration> </ItemGroup> <PropertyGroup> <ProjectGuid>{57900E99-A405-49F4-83B2-0254117D041B}</ProjectGuid> <Keyword>Win32Proj</Keyword> <RootNamespace>libproj</RootNamespace> Here is my code currently. I have tried every way I can come up with to write the attributes. string baseDir = (textBox2.Text + "\\" + safeFileName); string vcName = Path.GetFileName(textBox1.Text); string vcProj = Path.Combine(baseDir, vcName); using (XmlReader reader = XmlReader.Create(textBox1.Text)) { XmlWriterSettings settings = new XmlWriterSettings(); settings.OmitXmlDeclaration = true; settings.ConformanceLevel = ConformanceLevel.Fragment; settings.Indent = true; settings.CloseOutput = false; using (XmlWriter writer = XmlWriter.Create(vcProj, settings)) { while (reader.Read()) { switch (reader.NodeType) { case XmlNodeType.Element: if (reader.Name == "ClInclude") { string include = reader.GetAttribute("Include"); string dirPath = Path.GetDirectoryName(textBox1.Text); Directory.SetCurrentDirectory(dirPath); string fullPath = Path.GetFullPath(include); //string dirPath = Path.GetDirectoryName(fullPath); copyFile(fullPath, 3); string filename = Path.GetFileName(fullPath); writer.WriteStartElement(reader.Name); writer.WriteAttributeString("Include", "include/" + filename); writer.WriteEndElement(); } else if (reader.Name == "ClCompile" && reader.HasAttributes) { string include = reader.GetAttribute("Include"); string dirPath = Path.GetDirectoryName(textBox1.Text); Directory.SetCurrentDirectory(dirPath); string fullPath = Path.GetFullPath(include); copyFile(fullPath, 2); string filename = Path.GetFileName(fullPath); writer.WriteStartElement(reader.Name); writer.WriteAttributeString("Include", "src/" + filename); writer.WriteEndElement(); } else { writer.WriteStartElement(reader.Name); } break; case XmlNodeType.Text: writer.WriteString(reader.Value); break; case XmlNodeType.XmlDeclaration: case XmlNodeType.ProcessingInstruction: writer.WriteProcessingInstruction(reader.Name, reader.Value); break; case XmlNodeType.Comment: writer.WriteComment(reader.Value); break; case XmlNodeType.Attribute: writer.WriteAttributes(reader, true); break; case XmlNodeType.EntityReference: writer.WriteEntityRef(reader.Value); break; case XmlNodeType.EndElement: writer.WriteFullEndElement(); break; } } } }

    Read the article

  • Accessing Layout Items from inside Widget AppWidgetProvider

    - by cam4mav
    I am starting to go insane trying to figure this out. It seems like it should be very easy, I'm starting to wonder if it's possible. What I am trying to do is create a home screen widget, that only contains an ImageButton. When it is pressed, the idea is to change some setting (like the wi-fi toggle) and then change the Buttons image. I have the ImageButton declared like this in my main.xml <ImageButton android:id="@+id/buttonOne" android:src="@drawable/button_normal_ringer" android:layout_width="wrap_content" android:layout_height="wrap_content" android:layout_gravity="center" /> my AppWidgetProvider class, named ButtonWidget * note that the RemoteViews class is a locally stored variable. this allowed me to get access to the RViews layout elements... or so I thought. @Override public void onUpdate(Context context, AppWidgetManager appWidgetManager, int[] appWidgetIds) { remoteViews = new RemoteViews(context.getPackageName(), R.layout.main); Intent active = new Intent(context, ButtonWidget.class); active.setAction(VIBRATE_UPDATE); active.putExtra("msg","TESTING"); PendingIntent actionPendingIntent = PendingIntent.getBroadcast(context, 0, active, 0); remoteViews.setOnClickPendingIntent(R.id.buttonOne, actionPendingIntent); appWidgetManager.updateAppWidget(appWidgetIds, remoteViews); } @Override public void onReceive(Context context, Intent intent) { // v1.5 fix that doesn't call onDelete Action final String action = intent.getAction(); Log.d("onReceive",action); if (AppWidgetManager.ACTION_APPWIDGET_DELETED.equals(action)) { final int appWidgetId = intent.getExtras().getInt( AppWidgetManager.EXTRA_APPWIDGET_ID, AppWidgetManager.INVALID_APPWIDGET_ID); if (appWidgetId != AppWidgetManager.INVALID_APPWIDGET_ID) { this.onDeleted(context, new int[] { appWidgetId }); } } else { // check, if our Action was called if (intent.getAction().equals(VIBRATE_UPDATE)) { String msg = "null"; try { msg = intent.getStringExtra("msg"); } catch (NullPointerException e) { Log.e("Error", "msg = null"); } Log.d("onReceive",msg); if(remoteViews != null){ Log.d("onReceive",""+remoteViews.getLayoutId()); remoteViews.setImageViewResource(R.id.buttonOne, R.drawable.button_pressed_ringer); Log.d("onReceive", "tried to switch"); } else{ Log.d("F!", "--naughty language used here!!!--"); } } super.onReceive(context, intent); } } so, I've been testing this and the onReceive method works great, I'm able to send notifications and all sorts of stuff (removed from code for ease of reading) the one thing I can't do is change any properties of the view elements. To try and fix this, I made RemoteViews a local and static private variable. Using log's I was able to see that When multiple instances of the app are on screen, they all refer to the one instance of RemoteViews. perfect for what I'm trying to do The trouble is in trying to change the image of the ImageButton. I can do this from within the onUpdate method using this. remoteViews.setImageViewResource(R.id.buttonOne, R.drawable.button_pressed_ringer); that doesn't do me any good though once the widget is created. For some reason, even though its inside the same class, being inside the onReceive method makes that line not work. That line used to throw a Null pointer as a matter of fact, until I changed the variable to static. now it passes the null test, refers to the same layoutId as it did at the start, reads the line, but it does nothing. Its like the code isn't even there, just keeps chugging along. SO...... Is there any way to modify layout elements from within a widget after the widget has been created!? I want to do this based on the environment, not with a configuration activity launch. I've been looking at various questions and this seems to be an issue that really hasn't been solved, such as link text and link text oh and for anyone who finds this and wants a good starting tutorial for widgets, this is easy to follow (though a bit old, it gets you comfortable with widgets) .pdf link text hopefully someone can help here. I kinda have the feeling that this is illegal and there is a different way to go about this. I would LOVE to be told another approach!!!! Thanks

    Read the article

  • I never really understood: what is Application Binary Interface (ABI)?

    - by claws
    I never clearly understood what is an ABI. I'm sorry for such a lengthy question. I just want to clearly understand things. Please don't point me to wiki article, If could understand it, I wouldn't be here posting such a lengthy post. This is my mindset about different interfaces: TV remote is an interface between user and TV. It is an existing entity but useless (doesn't provide any functionality) by itself. All the functionality for each of those buttons on the remote is implemented in the Television set. Interface: It is a "existing entity" layer between the functionality and consumer of that functionality. An, interface by itself is doesn't do anything. It just invokes the functionality lying behind. Now depending on who the user is there are different type of interfaces. Command Line Interface(CLI) commands are the existing entities, consumer is the user and functionality lies behind. functionality: my software functionality which solves some purpose to which we are describing this interface. existing entities: commands consumer: user Graphical User Interface(GUI) window,buttons etc.. are the existing entities, again consumer is the user and functionality lies behind. functionality: my software functionality which solves some purpose to which we are describing this interface. existing entities: window,buttons etc.. consumer: user Application Programming Interface(API) functions or to be more correct, interfaces (in interfaced based programming) are the existing entities, consumer here is another program not a user. and again functionality lies behind this layer. functionality: my software functionality which solves some purpose to which we are describing this interface. existing entities: functions, Interfaces(array of functions). consumer: another program/application. Application Binary Interface (ABI) Here is my problem starts. functionality: ??? existing entities: ??? consumer: ??? I've wrote few softwares in different languages and provided different kind of interfaces (CLI, GUI, API) but I'm not sure, if I ever, provided any ABI. http://en.wikipedia.org/wiki/Application_binary_interface says: ABIs cover details such as data type, size, and alignment; the calling convention, which controls how functions' arguments are passed and return values retrieved; the system call numbers and how an application should make system calls to the operating system; Other ABIs standardize details such as the C++ name mangling,[2] . exception propagation,[3] and calling convention between compilers on the same platform, but do not require cross-platform compatibility. Who needs these details? Please don't say, OS. I know assembly programming. I know how linking & loading works. I know what exactly happens inside. Where did C++ name mangling come in between? I thought we are talking at the binary level. Where did languages come in between? anyway, I've downloaded the [PDF] System V Application Binary Interface Edition 4.1 (1997-03-18) to see what exactly it contains. Well, most of it didn't make any sense. Why does it contain 2 chapters (4th & 5th) which describe the ELF file format.Infact, these are the only 2 significant chapters that specification. Rest of all the chapters "Processor Specific". Anyway, I thought that it is completely different topic. Please don't say that ELF file format specs are the ABI. It doesn't qualify to be Interface according to the definition. I know, since we are talking at such low level it must be very specific. But I'm not sure how is it "Instruction Set Architecture(ISA)" specific? Where can I find MS Window's ABI? So, these are the major queries that are bugging me.

    Read the article

  • What is New in ASP.NET 4.0 Code Access Security

    - by Xiaohong
    ASP.NET Code Access Security (CAS) is a feature that helps protect server applications on hosting multiple Web sites, ASP.NET lets you assign a configurable trust level that corresponds to a predefined set of permissions. ASP.NET has predefined ASP.NET Trust Levels and Policy Files that you can assign to applications, you also can assign custom trust level and policy files. Most web hosting companies run ASP.NET applications in Medium Trust to prevent that one website affect or harm another site etc. As .NET Framework's Code Access Security model has evolved, ASP.NET 4.0 Code Access Security also has introduced several changes and improvements. The main change in ASP.NET 4.0 CAS In ASP.NET v4.0 partial trust applications, application domain can have a default partial trust permission set as opposed to being full-trust, the permission set name is defined in the <trust /> new attribute permissionSetName that is used to initialize the application domain . By default, the PermissionSetName attribute value is "ASP.Net" which is the name of the permission set you can find in all predefined partial trust configuration files. <trust level="Something" permissionSetName="ASP.Net" /> This is ASP.NET 4.0 new CAS model. For compatibility ASP.NET 4.0 also support legacy CAS model where application domain still has full trust permission set. You can specify new legacyCasModel attribute on the <trust /> element to indicate whether the legacy CAS model is enabled. By default legacyCasModel is false which means that new 4.0 CAS model is the default. <trust level="Something" legacyCasModel="true|false" /> In .Net FX 4.0 Config directory, there are two set of predefined partial trust config files for each new CAS model and legacy CAS model, trust config files with name legacy.XYZ.config are for legacy CAS model: New CAS model: Legacy CAS model: web_hightrust.config legacy.web_hightrust.config web_mediumtrust.config legacy.web_mediumtrust.config web_lowtrust.config legacy.web_lowtrust.config web_minimaltrust.config legacy.web_minimaltrust.config   The figure below shows in ASP.NET 4.0 new CAS model what permission set to grant to code for partial trust application using predefined partial trust levels and policy files:    There also some benefits that comes with the new CAS model: You can lock down a machine by making all managed code no-execute by default (e.g. setting the MyComputer zone to have no managed execution code permissions), it should still be possible to configure ASP.NET web applications to run as either full-trust or partial trust. UNC share doesn’t require full trust with CASPOL at machine-level CAS policy. Side effect that comes with the new CAS model: processRequestInApplicationTrust attribute is deprecated  in new CAS model since application domain always has partial trust permission set in new CAS model.   In ASP.NET 4.0 legacy CAS model or ASP.NET 2.0 CAS model, even though you assign partial trust level to a application but the application domain still has full trust permission set. The figure below shows in ASP.NET 4.0 legacy CAS model (or ASP.NET 2.0 CAS model) what permission set to grant to code for partial trust application using predefined partial trust levels and policy files:     What $AppDirUrl$, $CodeGen$, $Gac$ represents: $AppDirUrl$ The application's virtual root directory. This allows permissions to be applied to code that is located in the application's bin directory. For example, if a virtual directory is mapped to C:\YourWebApp, then $AppDirUrl$ would equate to C:\YourWebApp. $CodeGen$ The directory that contains dynamically generated assemblies (for example, the result of .aspx page compiles). This can be configured on a per application basis and defaults to %windir%\Microsoft.NET\Framework\{version}\Temporary ASP.NET Files. $CodeGen$ allows permissions to be applied to dynamically generated assemblies. $Gac$ Any assembly that is installed in the computer's global assembly cache (GAC). This allows permissions to be granted to strong named assemblies loaded from the GAC by the Web application.   The new customization of CAS Policy in ASP.NET 4.0 new CAS model 1. Define which named permission set in partial trust configuration files By default the permission set that will be assigned at application domain initialization time is the named "ASP.Net" permission set found in all predefined partial trust configuration files. However ASP.NET 4.0 allows you set PermissionSetName attribute to define which named permission set in a partial trust configuration file should be the one used to initialize an application domain. Example: add "ASP.Net_2" named permission set in partial trust configuration file: <PermissionSet class="NamedPermissionSet" version="1" Name="ASP.Net_2"> <IPermission class="FileIOPermission" version="1" Read="$AppDir$" PathDiscovery="$AppDir$" /> <IPermission class="ReflectionPermission" version="1" Flags ="RestrictedMemberAccess" /> <IPermission class="SecurityPermission " version="1" Flags ="Execution, ControlThread, ControlPrincipal, RemotingConfiguration" /></PermissionSet> Then you can use "ASP.Net_2" named permission set for the application domain permission set: <trust level="Something" legacyCasModel="false" permissionSetName="ASP.Net_2" /> 2. Define a custom set of Full Trust Assemblies for an application By using the new fullTrustAssemblies element to configure a set of Full Trust Assemblies for an application, you can modify set of partial trust assemblies to full trust at the machine, site or application level. The configuration definition is shown below: <fullTrustAssemblies> <add assemblyName="MyAssembly" version="1.1.2.3" publicKey="hex_char_representation_of_key_blob" /></fullTrustAssemblies> 3. Define <CodeGroup /> policy in partial trust configuration files ASP.NET 4.0 new CAS model will retain the ability for developers to optionally define <CodeGroup />with membership conditions and assigned permission sets. The specific restriction in ASP.NET 4.0 new CAS model though will be that the results of evaluating custom policies can only result in one of two outcomes: either an assembly is granted full trust, or an assembly is granted the partial trust permission set currently associated with the running application domain. It will not be possible to use custom policies to create additional custom partial trust permission sets. When parsing the partial trust configuration file: Any assemblies that match to code groups associated with "PermissionSet='FullTrust'" will run at full trust. Any assemblies that match to code groups associated with "PermissionSet='Nothing'" will result in a PolicyError being thrown from the CLR. This is acceptable since it provides administrators with a way to do a blanket-deny of managed code followed by selectively defining policy in a <CodeGroup /> that re-adds assemblies that would be allowed to run. Any assemblies that match to code groups associated with other permissions sets will be interpreted to mean the assembly should run at the permission set of the appdomain. This means that even though syntactically a developer could define additional "flavors" of partial trust in an ASP.NET partial trust configuration file, those "flavors" will always be ignored. Example: defines full trust in <CodeGroup /> for my strong named assemblies in partial trust config files: <CodeGroup class="FirstMatchCodeGroup" version="1" PermissionSetName="Nothing"> <IMembershipCondition    class="AllMembershipCondition"    version="1" /> <CodeGroup    class="UnionCodeGroup"    version="1"    PermissionSetName="FullTrust"    Name="My_Strong_Name"    Description="This code group grants code signed full trust. "> <IMembershipCondition      class="StrongNameMembershipCondition" version="1"       PublicKeyBlob="hex_char_representation_of_key_blob" /> </CodeGroup> <CodeGroup   class="UnionCodeGroup" version="1" PermissionSetName="ASP.Net">   <IMembershipCondition class="UrlMembershipCondition" version="1" Url="$AppDirUrl$/*" /> </CodeGroup> <CodeGroup class="UnionCodeGroup" version="1" PermissionSetName="ASP.Net">   <IMembershipCondition class="UrlMembershipCondition" version="1" Url="$CodeGen$/*"   /> </CodeGroup></CodeGroup>   4. Customize CAS policy at runtime in ASP.NET 4.0 new CAS model ASP.NET 4.0 new CAS model allows to customize CAS policy at runtime by using custom HostSecurityPolicyResolver that overrides the ASP.NET code access security policy. Example: use custom host security policy resolver to resolve partial trust web application bin folder MyTrustedAssembly.dll to full trust at runtime: You can create a custom host security policy resolver and compile it to assembly MyCustomResolver.dll with strong name enabled and deploy in GAC: public class MyCustomResolver : HostSecurityPolicyResolver{ public override HostSecurityPolicyResults ResolvePolicy(Evidence evidence) { IEnumerator hostEvidence = evidence.GetHostEnumerator(); while (hostEvidence.MoveNext()) { object hostEvidenceObject = hostEvidence.Current; if (hostEvidenceObject is System.Security.Policy.Url) { string assemblyName = hostEvidenceObject.ToString(); if (assemblyName.Contains(“MyTrustedAssembly.dll”) return HostSecurityPolicyResult.FullTrust; } } //default fall-through return HostSecurityPolicyResult.DefaultPolicy; }} Because ASP.NET accesses the custom HostSecurityPolicyResolver during application domain initialization, and a custom policy resolver requires full trust, you also can add a custom policy resolver in <fullTrustAssemblies /> , or deploy in the GAC. You also need configure a custom HostSecurityPolicyResolver instance by adding the HostSecurityPolicyResolverType attribute in the <trust /> element: <trust level="Something" legacyCasModel="false" hostSecurityPolicyResolverType="MyCustomResolver, MyCustomResolver" permissionSetName="ASP.Net" />   Note: If an assembly policy define in <CodeGroup/> and also in hostSecurityPolicyResolverType, hostSecurityPolicyResolverType will win. If an assembly added in <fullTrustAssemblies/> then the assembly has full trust no matter what policy in <CodeGroup/> or in hostSecurityPolicyResolverType.   Other changes in ASP.NET 4.0 CAS Use the new transparency model introduced in .Net Framework 4.0 Change in dynamically compiled code generated assemblies by ASP.NET: In new CAS model they will be marked as security transparent level2 to use Framework 4.0 security transparent rule that means partial trust code is treated as completely Transparent and it is more strict enforcement. In legacy CAS model they will be marked as security transparent level1 to use Framework 2.0 security transparent rule for compatibility. Most of ASP.NET products runtime assemblies are also changed to be marked as security transparent level2 to switch to SecurityTransparent code by default unless SecurityCritical or SecuritySafeCritical attribute specified. You also can look at Security Changes in the .NET Framework 4 for more information about these security attributes. Support conditional APTCA If an assembly is marked with the Conditional APTCA attribute to allow partially trusted callers, and if you want to make the assembly both visible and accessible to partial-trust code in your web application, you must add a reference to the assembly in the partialTrustVisibleAssemblies section: <partialTrustVisibleAssemblies> <add assemblyName="MyAssembly" publicKey="hex_char_representation_of_key_blob" />/partialTrustVisibleAssemblies>   Most of ASP.NET products runtime assemblies are also changed to be marked as conditional APTCA to prevent use of ASP.NET APIs in partial trust environments such as Winforms or WPF UI controls hosted in Internet Explorer.   Differences between ASP.NET new CAS model and legacy CAS model: Here list some differences between ASP.NET new CAS model and legacy CAS model ASP.NET 4.0 legacy CAS model  : Asp.net partial trust appdomains have full trust permission Multiple different permission sets in a single appdomain are allowed in ASP.NET partial trust configuration files Code groups Machine CAS policy is honored processRequestInApplicationTrust attribute is still honored    New configuration setting for legacy model: <trust level="Something" legacyCASModel="true" ></trust><partialTrustVisibleAssemblies> <add assemblyName="MyAssembly" publicKey="hex_char_representation_of_key_blob" /></partialTrustVisibleAssemblies>   ASP.NET 4.0 new CAS model: ASP.NET will now run in homogeneous application domains. Only full trust or the app-domain's partial trust grant set, are allowable permission sets. It is no longer possible to define arbitrary permission sets that get assigned to different assemblies. If an application currently depends on fine-tuning the partial trust permission set using the ASP.NET partial trust configuration file, this will no longer be possible. processRequestInApplicationTrust attribute is deprecated Dynamically compiled assemblies output by ASP.NET build providers will be updated to explicitly mark assemblies as transparent. ASP.NET partial trust grant sets will be independent from any enterprise, machine, or user CAS policy levels. A simplified model for locking down web servers that only allows trusted managed web applications to run. Machine policy used to always grant full-trust to managed code (based on membership conditions) can instead be configured using the new ASP.NET 4.0 full-trust assembly configuration section. The full-trust assembly configuration section requires explicitly listing each assembly as opposed to using membership conditions. Alternatively, the membership condition(s) used in machine policy can instead be re-defined in a <CodeGroup /> within ASP.NET's partial trust configuration file to grant full-trust.   New configuration setting for new model: <trust level="Something" legacyCASModel="false" permissionSetName="ASP.Net" hostSecurityPolicyResolverType=".NET type string" ></trust><fullTrustAssemblies> <add assemblyName=”MyAssembly” version=”1.0.0.0” publicKey="hex_char_representation_of_key_blob" /></fullTrustAssemblies><partialTrustVisibleAssemblies> <add assemblyName="MyAssembly" publicKey="hex_char_representation_of_key_blob" /></partialTrustVisibleAssemblies>     Hope this post is helpful to better understand the ASP.Net 4.0 CAS. Xiaohong Tang ASP.NET QA Team

    Read the article

  • Running ASP.NET Webforms and ASP.NET MVC side by side

    - by rajbk
    One of the nice things about ASP.NET MVC and its older brother ASP.NET WebForms is that they are both built on top of the ASP.NET runtime environment. The advantage of this is that, you can still run them side by side even though MVC and WebForms are different frameworks. Another point to note is that with the release of the ASP.NET routing in .NET 3.5 SP1, we are able to create SEO friendly URLs that do not map to specific files on disk. The routing is part of the core runtime environment and therefore can be used by both WebForms and MVC. To run both frameworks side by side, we could easily create a separate folder in your MVC project for all our WebForm files and be good to go. What this post shows you instead, is how to have an MVC application with WebForm pages  that both use a common master page and common routing for SEO friendly URLs.  A sample project that shows WebForms and MVC running side by side is attached at the bottom of this post. So why would we want to run WebForms and MVC in the same project?  WebForms come with a lot of nice server controls that provide a lot of functionality. One example is the ReportViewer control. Using this control and client report definition files (RDLC), we can create rich interactive reports (with charting controls). I show you how to use the ReportViewer control in a WebForm project here :  Creating an ASP.NET report using Visual Studio 2010. We can create even more advanced reports by using SQL reporting services that can also be rendered by the ReportViewer control. Now, consider the sample MVC application I blogged about called ASP.NET MVC Paging/Sorting/Filtering using the MVCContrib Grid and Pager. Assume you were given the requirement to add a UI to the MVC application where users could interact with a report and be given the option to export the report to Excel, PDF or Word. How do you go about doing it?   This is a perfect scenario to use the ReportViewer control and RDLCs. As you saw in the post on creating the ASP.NET report, the ReportViewer control is a Web Control and is designed to be run in a WebForm project with dependencies on, amongst others, a ScriptManager control and the beloved Viewstate.  Since MVC and WebForm both run under the same runtime, the easiest thing to is to add the WebForm application files (index.aspx, rdlc, related class files) into our MVC project. You can copy the files over from the WebForm project into the MVC project. Create a new folder in our MVC application called CommonReports. Add the index.aspx and rdlc file from the Webform project   Right click on the Index.aspx file and convert it to a web application. This will add the index.aspx.designer.cs file (this step is not required if you are manually adding a WebForm aspx file into the MVC project).    Verify that all the type names for the ObjectDataSources in code behind to point to the correct ProductRepository and fix any compiler errors. Right click on Index.aspx and select “View in browser”. You should see a screen like the one below:   There are two issues with our page. It does not use our site master page and the URL is not SEO friendly. Common Master Page The easiest way to use master pages with both MVC and WebForm pages is to have a common master page that each inherits from as shown below. The reason for this is most WebForm controls require them to be inside a Form control and require ControlState or ViewState. ViewMasterPages used in MVC, on the other hand, are designed to be used with content pages that derive from ViewPage with Viewstate turned off. By having a separate master page for MVC and WebForm that inherit from the Root master page,, we can set properties that are specific to each. For example, in the Webform master, we can turn on ViewState, add a form tag etc. Another point worth noting is that if you set a WebForm page to use a MVC site master page, you may run into errors like the following: A ViewMasterPage can be used only with content pages that derive from ViewPage or ViewPage<TViewItem> or Control 'MainContent_MyButton' of type 'Button' must be placed inside a form tag with runat=server. Since the ViewMasterPage inherits from MasterPage as seen below, we make our Root.master inherit from MasterPage, MVC.master inherit from ViewMasterPage and Webform.master inherits from MasterPage. We define the attributes on the master pages like so: Root.master <%@ Master Inherits="System.Web.UI.MasterPage"  … %> MVC.master <%@ Master MasterPageFile="~/Views/Shared/Root.Master" Inherits="System.Web.Mvc.ViewMasterPage" … %> WebForm.master <%@ Master MasterPageFile="~/Views/Shared/Root.Master" Inherits="NorthwindSales.Views.Shared.Webform" %> Code behind: public partial class Webform : System.Web.UI.MasterPage {} We make changes to our reports aspx file to use the Webform.master. See the source of the master pages in the sample project for a better understanding of how they are connected. SEO friendly links We want to create SEO friendly links that point to our report. A request to /Reports/Products should render the report located in ~/CommonReports/Products.aspx. Simillarly to support future reports, a request to /Reports/Sales should render a report in ~/CommonReports/Sales.aspx. Lets start by renaming our index.aspx file to Products.aspx to be consistent with our routing criteria above. As mentioned earlier, since routing is part of the core runtime environment, we ca easily create a custom route for our reports by adding an entry in Global.asax. public static void RegisterRoutes(RouteCollection routes) { routes.IgnoreRoute("{resource}.axd/{*pathInfo}");   //Custom route for reports routes.MapPageRoute( "ReportRoute", // Route name "Reports/{reportname}", // URL "~/CommonReports/{reportname}.aspx" // File );     routes.MapRoute( "Default", // Route name "{controller}/{action}/{id}", // URL with parameters new { controller = "Home", action = "Index", id = UrlParameter.Optional } // Parameter defaults ); } With our custom route in place, a request to Reports/Employees will render the page at ~/CommonReports/Employees.aspx. We make this custom route the first entry since the routing system walks the table from top to bottom, and the first route to match wins. Note that it is highly recommended that you write unit tests for your routes to ensure that the mappings you defined are correct. Common Menu Structure The master page in our original MVC project had a menu structure like so: <ul id="menu"> <li> <%=Html.ActionLink("Home", "Index", "Home") %></li> <li> <%=Html.ActionLink("Products", "Index", "Products") %></li> <li> <%=Html.ActionLink("Help", "Help", "Home") %></li> </ul> We want this menu structure to be common to all pages/views and hence should reside in Root.master. Unfortunately the Html.ActionLink helpers will not work since Root.master inherits from MasterPage which does not have the helper methods available. The quickest way to resolve this issue is to use RouteUrl expressions. Using  RouteUrl expressions, we can programmatically generate URLs that are based on route definitions. By specifying parameter values and a route name if required, we get back a URL string that corresponds to a matching route. We move our menu structure to Root.master and change it to use RouteUrl expressions: <ul id="menu"> <li> <asp:HyperLink ID="hypHome" runat="server" NavigateUrl="<%$RouteUrl:routename=default,controller=home,action=index%>">Home</asp:HyperLink></li> <li> <asp:HyperLink ID="hypProducts" runat="server" NavigateUrl="<%$RouteUrl:routename=default,controller=products,action=index%>">Products</asp:HyperLink></li> <li> <asp:HyperLink ID="hypReport" runat="server" NavigateUrl="<%$RouteUrl:routename=ReportRoute,reportname=products%>">Product Report</asp:HyperLink></li> <li> <asp:HyperLink ID="hypHelp" runat="server" NavigateUrl="<%$RouteUrl:routename=default,controller=home,action=help%>">Help</asp:HyperLink></li> </ul> We are done adding the common navigation to our application. The application now uses a common theme, routing and navigation structure. Conclusion We have seen how to do the following through this post Add a WebForm page from a WebForm project to an existing ASP.NET MVC application Use a common master page for both WebForm and MVC pages Use routing for SEO friendly links Use a common menu structure for both WebForm and MVC. The sample project is attached below. Version: VS 2010 RTM Remember to change your connection string to point to your Northwind database NorthwindSalesMVCWebform.zip

    Read the article

  • CodePlex Daily Summary for Thursday, March 01, 2012

    CodePlex Daily Summary for Thursday, March 01, 2012Popular ReleasesMetodología General Ajustada - MGA: 01.09.08: Cambios John: Cambios en el MDI: Habilitación del menú e ícono de Imprimir. Deshabilitación de menú Ayuda y opciones de Importar y Exportar del menú Proyectos temporalmente. Integración con código de Crystal Report. Validaciones con Try-Catch al generar los reportes, personalización de los formularios en estilos y botones y validación de selección de tipo de reporte. Creación de instalador con TODOS los cambios y la creación de las carpetas asociadas a los RPT.WatchersNET CKEditor™ Provider for DotNetNuke®: CKEditor Provider 1.14.01: Whats NewAdded New Plugin "Ventrian News Articles Link Selector" to select an Article Link from the News Article Module (This Plugin is not visible by default in your Toolbar, you need to manually add the 'newsarticleslinks' to your toolbarset) http://www.watchersnet.de/Portals/0/screenshots/dnn/CKEditorNewsArticlesLinks.png File-Browser: Added Paging to the Files List. You can define the Page Size in the Options (Default Value: 20) http://www.watchersnet.de/Portals/0/screenshots/dnn/CKEdito...MyRouter (Virtual WiFi Router): MyRouter 1.0 (Beta): A friendlier User Interface. A logger file to catch exceptions so you may send it to use to improve and fix any bugs that may occur. A feedback form because we always love hearing what you guy's think of MyRouter. Check for update menu item for you to stay up to date will the latest changes. Facebook fan page so you may spread the word and share MyRouter with friends and family And Many other exciting features were sure your going to love!WPF Sound Visualization Library: WPF SVL 0.3 (Source, Binaries, Examples, Help): Version 0.3 of WPFSVL. This includes three new controls: an equalizer, a digital clock, and a time editor.Thai Flood Watch: Thai Flood Watch - Source: non commercial use only ** This project supported by Department of Computer Science KhonKaen University Thailand.ZXing.Net: ZXing.Net 0.4.0.0: sync with rev. 2196 of the java version important fix for RGBLuminanceSource generating barcode bitmaps Windows Phone demo client (only tested with emulator, because I don't have a Windows Phone) Barcode generation support for Windows Forms demo client Webcam support for Windows Forms demo clientOrchard Project: Orchard 1.4: Please read our release notes for Orchard 1.4: http://docs.orchardproject.net/Documentation/Orchard-1-4-Release-Notes.NET Assembly Information: Assembly Information 2.1.0.1: - Fixed the issue in which AnyCPU binaries were shown as 32bit - Added support to show the errors in-case if some dlls failed to load.FluentData -Micro ORM with a fluent API that makes it simple to query a database: FluentData version 1.2: New features: - QueryValues method - Added support for automapping to enumerations (both int and string are supported). Fixed 2 reported issues.NetSqlAzMan - .NET SQL Authorization Manager: 3.6.0.15: 3.6.0.15 28-Feb-2012 • Fix: The communication object, System.ServiceModel.Channels.ServiceChannel, cannot be used for communication because it is in the Faulted state. Work Item 10435: http://netsqlazman.codeplex.com/workitem/10435 • Fix: Made StorageCache thread safe. Thanks to tangrl. • Fix: Members property of SqlAzManApplicationGroup is not functioning. Thanks to tangrl. Work Item 10267: http://netsqlazman.codeplex.com/workitem/10267 • Fix: Indexer are making database calls. Thanks to t...SCCM Client Actions Tool: Client Actions Tool v1.1: SCCM Client Actions Tool v1.1 is the latest version. It comes with following changes since last version: Added stop button to stop the ongoing process. Added action "Query update status". Added option "saveOnlineComputers" in config.ini to enable saving list of online computers from last session. Default value for "LatestClientVersion" set to SP2 R3 (4.00.6487.2157). Wuauserv service manual startup mode is considered healthy on Windows 7. Errors are now suppressed in checkReleases...Kinect PowerPoint Control: Kinect PowerPoint Control v1.1: Updated for Kinect SDK 1.0.SharpCompress - a fully native C# library for RAR, 7Zip, Zip, Tar, GZip, BZip2: SharpCompress 0.8: API Updates: SOLID Extract Method for Archives (7Zip and RAR). ExtractAllEntries method on Archive classes will extract archives as a streaming file. This can offer better 7Zip extraction performance if any of the entries are solid. The IsSolid method on 7Zip archives will return true if any are solid. Removed IExtractionListener was removed in favor of events. Unit tests show example. Bug fixes: PPMd passes tests plus other fixes (Thanks Pavel) Zip used to always write a Post Descri...Social Network Importer for NodeXL: SocialNetImporter(v.1.3): This new version includes: - Download new networks for Facebook fan pages. - New options for downloading more posts - Bug fixes To use the new graph data provider, do the following: Unzip the Zip file into the "PlugIns" folder that can be found in the NodeXL installation folder (i.e "C:\Program Files\Social Media Research Foundation\NodeXL Excel Template\PlugIns") Open NodeXL template and you can access the new importer from the "Import" menuASP.NET REST Services Framework: Release 1.1 - Standard version: Beginning from v1.1 the REST-services Framework is compatible with ASP.NET Routing model as well with CRUD (Create, Read, Update, and Delete) principle. These two are often important when building REST API functionality within your application. It also includes ability to apply Filters to a class to target all WebRest methods, as well as some performance enhancements. New version includes Metadata Explorer providing ability exploring the existing services that becomes essential as the number ...SQL Live Monitor: SQL Live Monitor 1.31: A quick fix to make it this version work with SQL 2012. Version 2 already has 2012 working, but am still developing the UI in version 2, so this is just an interim fix to allow user to monitor SQL 2012.Content Slider Module for DotNetNuke: 01.02.00: This release has the following updates and new features: Feature: One-Click Enabling of Pager Setting Feature: Cache Sliders for Performance Feature: Configurable Cache Setting Enhancement: Transitions can be Selected Bug: Secure Folder Images not Viewable Bug: Sliders Disappear on Postback Bug: Remote Images Cause Error Bug: Deleted Images Cause Error System Requirements DotNetNuke v06.00.00 or newer .Net Framework v3.5 SP1 or newer SQL Server 2005 or newerImage Resizer for Windows: Image Resizer 3 Preview 3: Here is yet another iteration toward what will eventually become Image Resizer 3. This release is stable. However, I'm calling it a preview since there are still many features I'd still like to add before calling it complete. Updated on February 28 to fix an issue with installing on multi-user machines. As usual, here is my progress report. Done Preview 3 Fix: 3206 3076 3077 5688 Fix: 7420 Fix: 7527 Fix: 7576 7612 Preview 2 6308 6309 Fix: 7339 Fix: 7357 Preview 1 UI...Finestra Virtual Desktops: 2.5.4500: This is a bug fix release for version 2.5. It fixes several things and adds a couple of minor features. See the 2.5 release notes for more information on the major new features in that version. Important - If Finestra crashes on startup for you, you must install the Visual C++ 2010 runtime from http://www.microsoft.com/download/en/details.aspx?id=5555. Fixes a bug with window animations not refreshing the screen on XP and with DWM off Fixes a bug with with crashing on XP due to a bug in t...Media Companion: MC 3.432b Release: General Now remembers window location. Catching a few more exceptions when an image is blank TV A couple of UI tweaks Movies Fixed the actor name displaying HTML Fixed crash when using Save files as "movie.nfo", "movie.tbn", & "fanart.jpg" New CSV template for HTML output function Added <createdate> tag for HTML output A couple of UI tweaks Known Issues Multiepisodes are not handled correctly in MC. The created nfo is valid, but they are not displayed in MC correctly & saving the...New Projectsabac: abac cn websiteAION Launcher: simple aion launcher...just edit the background image of your choosing inside the code and other things such as the links for the buttons and the ip adress and port of the serverAXTFSTool: Dynamics AX tool that connects to your project's TFS and lists the objects your colleagues have changed. Written in C#, still under development and improvements. Useful for team leaders, deployment managers, etc.cookieTopo: Topo map viewerCrmFetchKit.js: Simple Library at allows the execution of fetchxml queries via JavaScript for Dynamics CRM 2011 (using the new WCF endpoints). Like the CrmRestKit this framework uses the promise/A capacities of jQuery. The code and the idea for this framework bases on the CrmServiceToolkit (http://crmtoolkit.codeplex.com/) developed by Daniel Cai. cy univerX engine: ????????DNSAPI.NET: A common API for managing DNS servers on Windows. This project is based on the work I started back in 2002 when I needed to create a web front-end for Windows' DNS server using the .Net framework. The plan is to expand on the project and include support for the BIND server on Windows too. ego.net: ego.netfdTFS: Team Foundation Server Source Control Plugin for FlashDevelopGeoWPS: GeoWPS is an implementation of the OGC WPS. It will be developed in C#. IThink: A new project.King Garden: Boy King's .net practical projects.King Garret: Boy King's .net learning projects.LottoCheck: Follow LottoNot-Terraria: This is a like terraria game but NOT terrariaPassword Protector: Password Protector SharePoint 2010 BlobCache Manager: Manage your web application's blobcache settings directly in the central administration.SharePoint 2010 SilverLight Multiple File Uploader: SharePoint 2010 SilverLight Multiple File Uploader for Documents Libraries with MetaData.Sharepoint Tool Collection: I want to Integrate Various Utilities of Sharepoint at one place. It is for easy working of user or developer. Ex-1. A utility which takes some params & csv file and upload 100s of items on the sharepoint list easily. Ex-2 A utility to upload documents in a library. etc.SQLCLR Cmd Exec Framework Example: For users of MS SQL Server, xp_cmdshell is a utility that we usually want to have disabled. However there are still cases where calling a command line is needed. This project provides an framework/example to make command line calls. It is not meant as an xp_cmdshell replacement but as a workaround.Symmetric Designs Python 3.2: Symmetric Designs for Python 3.2 helps graphical artists to design and develop their own designs freestyle. It uses the pygame module for Python 3.2. It can also be analysed in order to get a grasp of graphics programming in Python.Terminsoft open CLR libraries: Terminsoft open CLR libraries. The first is Terminsoft.Intervals, intended for modeling the sets of intervals with elements, the comparison operation is defined for. The second is Terminsoft.Syntax, intended for text parsing and transformation and built upon regular expressions.Thai Flood Watch: Thai Flood Watch provides useful information, up-to-date and visual access to the major canal in Bangkok, Thailand using data from department of drainage and sewerage. Easily monitor river and canal flow information in Bangkok area, right from your hand.TheNerd: Sample video game source code. Using Sunburn.Unity.WebAPI: A library that allows simple Integration of Microsoft's Unity IoC container with ASP.NET's WebAPI. This project includes a bespoke DependencyResolver that creates a child container per HTTP request and disposes of all registered IDisposable instances at the end of the request.Wholemy.RemoteTouch: The project is a remote touch-sensitive keyboard with a customizable interface which allows to supplement control of another computer, regardless of the wires. For example, if you have not so fast Tablet PC - a client and a fast desktop computer - the server using the network.WindowPlace: WindowPlace makes it possible to save Window positions and sizes to a profile. Switching between profiles will effortlessly move and resize your windows. Help improve productivity - especially for multi-monitor systems. Developed in C# using WPF and a few Windows API calls in the background. WP Error Manager (Devv.Core.WPErrorManager): Library to log, handle and report errors on Windows Phone 7 apps. Fully customizable and extremely easy to implement. Works with any WP7 app. Tested with the emulator, Nokia Lumia 800 and Samsung Focus Flash.WPMatic: Windows Phone7 App to manage Homematic (eQ-3) Devices. The App is like the Homematic Central Configuration Unit (CCU) in German.www.Nabaza.com Freeware and Ebooks: www.Nabaza.com Freeware and Ebooks by William R. NabazaZap: Zap is a light weight .NET communication framework. It is designed for programs running in local area network. Zap provides code generation tool that enables user to call remote methods, add/remote event listener to remote objects, while hides the lower details.

    Read the article

< Previous Page | 278 279 280 281 282 283 284 285 286 287 288 289  | Next Page >