Search Results

Search found 11924 results on 477 pages for 'openoffice org'.

Page 289/477 | < Previous Page | 285 286 287 288 289 290 291 292 293 294 295 296  | Next Page >

• Setting up a copy of a site with IIS 7?

  - by SJaguar13

  I have a site running on IIS with a dyndns.org domain that points to the IP of the Windows 2008 machine hosting it. I need a copy of that site for development purposes. I set up another folder with all the files, and create a new site in IIS. I don't really have a domain for it, so I was just going to use the IP address. When I go to localhost, 127.0.0.1, or the internal IP, I get bad hostname. If I use the IP address on port 80 (the same as the real version of the site), I get 404 not found. If I use a different port so I don't have them both on the same IP with the same port, I get connection timed out. How do I go about setting this up?

  Read the article

• How to setup email server in ubuntu 12.04LTS(debian 7 wheezy/sid) running on linode vps

  - by shihon

  I am working on email server, since i tried several times to create email server on ubuntu12.04LTS with postfix + dovecote + postfixadmin + courier + clamav + spamassassin. But everytime i install these packages i face new problems, like mails send to localhost users and found in users maildir. But I can't determine how to configure/setup for send an email to external smtp like gmail, yahoo. The most worst thing i can't determine how to use sasl, because i am not using SSL so it is not worthy for my domain. This is so complicated, i search everywhere on google: links are https://help.ubuntu.com/community/PostfixCompleteVirtualMailSystemHowto http://www.starbridge.org/spip/spip.php?article1&lang=fr http://knopix.wordpress.com/2008/01/16/postfixadmin-postgresql-courier-squirrelmail-on-debian-etch-howtotutorial/ http://flurdy.com/docs/postfix/ Is there any article for install email server on ubuntu 12.04LTS. Please help me to understand these things.

  Read the article

• Can GnomeKeyring store passwords unencrypted?

  - by antimeme

  I have a Fedora 15 laptop with the root and home partitions encrypted using LUKS. When it boots I have to enter a pass phrase to unlock the master key, so I have it configured to automatically log me in to my account. However, GnomeKeyring remains locked, so I have to enter another pass phrase for that. This is unpleasant and completely pointless since the entire disk is encrypted. I've not been able to find a way to configure GnomeKeyring to store its pass phrases without encryption. For example, I was not able to find an answer here: http://library.gnome.org/users/seahorse-plugins/stable/index.html.en Is there a solution? If not, is there a mailing list where it would be appropriate to plead my case?

  Read the article

• Tracking down laptops Google has never heard of

  - by John

  Using MS tools to get information on PCs using our software, our customers have sent several Lenovo systems which have names we simply cannot find using Google... no search results at all. Considering these names/ids are returned by querying the system directly, not asking the customer to write it down by looking at the box, this seems odd. The ones we have so far (more than one of each) are: Lenovo 2241BL9 Lenovo 6463Y4H My guess is these are Thinkpads after Lenovo took over the brand, but can anyone help me out with this detective work? edit: the 2nd one does turn up some driver downloads and this page, but it's unclear what any of that means. Is the 6463y4h just a T61? http://smolts.org/reports/view_profile/%20ThinkPad%20T61

  Read the article

• Expertise Location [closed]

  - by Alexey Shatygin

  Is there some really working implementations of the expertise location systems exist? It is very hard to find anything about it. What sources to use, what to read, where to look? I've started with reading David W. McDonald's, Mark S. Ackerman's overview "Just talk to me" and now need just something more detailed. For those, who voting this question to be closed for off-topic: it is connected to IT sphere, if you don't know what it is - why ever vote? http://en.wikipedia.org/wiki/Expertise_finding http://citeseerx.ist.psu.edu/viewdoc/download?doi=10.1.1.40.4654&rep=rep1&type=pdf

  Read the article

• Tagging does not work with the Subversion plugin.

  - by mark

  I have exactly the same problem as the fellow from this post - http://jenkins.361315.n4.nabble.com/Tag-this-build-not-working-subversion-td384218.html, except that I use build 1.413 Unfortunately, the post does not provide any workarounds except downgrading to 1.310 (from 1.315) I would gladly provide the logs, if I knew the logger names. Please, help. P.S. I have posted this issue both on jenkins issues site - https://issues.jenkins-ci.org/browse/JENKINS-9961 and in the respective google group - https://groups.google.com/d/topic/jenkinsci-users/4UVKFxXA9Jo/overview. To no avail. So, this site is my last hope - thanks to all in advance. EDIT Upgraded to 1.417 - still tagging does nothing.

  Read the article

• Xorg configuration file on Debian Testing

  - by nubicurio

  I cannot find the Xorg configuration file on my newly installed Debian on my tablet-pc, so I followed this tutorial http://wiki.debian.org/Xorg and ran the command "Xorg -configure", to which I got the following error messages: (EE) Failed to load module "vmwgfx" (module does not exist, 0) (EE) vmware: Please ignore the above warnings about not being able to load module/driver vmwgfx (++) Using config file: "/root/xorg.conf.new" (==) Using system config directory "/usr/share/X11/xorg.conf.d" FATAL: Module fbcon not found. Number of created screens does not match number of detected devices. Configuration failed. Dose anyone know what this means and how I should proceed? Why is there a warning about vmware, and what is this fbcon module?

  Read the article

• Installing maven on Ubuntu by manual download

  - by WebDevHobo

  To install Maven, I downloaded the latest version from the website and then followed these steps: http://maven.apache.org/download.html#Installation The last step, the version control, does not work. It says that 'mvn' is currently not installed and that I should type sudo apt-get install maven2 If I go directly to the mvn file itself, it does work: root@ubuntu:~# /usr/local/apache-maven/apache-maven-2.2.1/bin/mvn --version Apache Maven 2.2.1 (r801777; 2009-08-06 12:16:01-0700) Java version: 1.6.0_21 Java home: /usr/java/jdk1.6.0_21/jre Default locale: en_US, platform encoding: UTF-8 OS name: "linux" version: "2.6.32-25-generic" arch: "i386" Family: "unix" So, what am I doing wrong here? Or what would and apt-get install do extra that I might have forgotten?

  Read the article

• How to limit server to specific IP addresses with mod_authz_host?

  - by BeeDog

  Hi! I am very new to this area, so please bear with me. :) Right now I am running an Apache HTTP server on my setup, a very basic configuration. The website hosted on it is accessible from anywhere, and I want to limit the access to a specific IP address range. I've looked into this and I found that one Apache module called mod_authz_host handles this. http://httpd.apache.org/docs/2.2/mod/mod_authz_host.html The problem is, I haven't managed to find documentation that explains well how to actually do the stuff. How do I actually make sure only a certain range of IP addresses can access my site/server? The machine is running Ubuntu Server 10.10, the web files are stored in /var/www/, the apache2 daemon has its stuff stored in /etc/apache2/ and /usr/lib/apache2/modules/*. Thanks in advance, and sorry if this is a stupid question!

  Read the article

• Seeing DNS changes takes too long on my PC, can it be my router misconfiguration?

  - by Borek

  I administer a few sites and need to update their DNS entries from time to time, e.g., adding an A-record point certain subdomain to a certain IP. When I check sites like http://www.opendns.com/support/cache/, I can clearly see the DNS change taking effect throughout the world - is it just my PC that can't see this change (ping newsubdomain.example.org says it cannot resolve host name) The network "map" is like this: My PC -> my router -> my ISP's router -> internet On my PC, the DNS is set automatically which means that if I run iconfig /all, my router will be returned as the DNS server (192.168.1.1). On my router, the DNS is set to be what my ISP provided me with. Is this correct? What can I do to see new hostnames resolved quicker?

  Read the article

• Link two or more text boxes in Visio

  - by Dan

  I am working on creating a template in Visio 2007 (Professional). Each page should reflect a document number and a revision number (two text boxes). I would like to make the template such that entering or changing text in one of these boxes on one page will automatically update the equivalent text boxes on all other pages. Is there an easy way to link two (or more) text boxes to show the same data (mirror each other)? I've looked into creating a ShapeData set and then using the ShapeData field in place of each box, but this will require training others to access and adjust the ShapeData field. In short - I want the issue that was attempting to be solved in Changing Text in Visio Org Chart Shape Changes Multiple Shapes' Text .

  Read the article

• debian installation without internet connection

  - by Gobliins

  Hi i want to install some Debian distributions (Grip, Crush, Lenny...) for arm / armel architectures. www.emdebian.org/ i refer to this guide www.aurel32.net/info/debian_arm_qemu.php The Problem i have is that i dont have internet connection with My Linux VM or Qemu i am behind a Proxy. I want to know is there a way where i can dl all the needed files and save them to disk that i don´t need an i.c. during the installation? I am working under Windows now. my regards

  Read the article

• Accessing our Intranet from outside our Network - WITHOUT VPN

  - by westexasman

  We just upgraded our company intranet from an IIS based, ASP (poorly written) server/code base to a Windows Server 2008 r2 (Apache/MySQL/PHP) server. The old server allowed users to login to intranet.xxx.org using there AD user/pass which then lead them to the company Intranet from basically anywhere they had Internet access. We want to mimic that functionality (or change it to something more secure) with the new setup. This was seemingly setup for off-site employees running on a state network. The state network does not allow VPN, therefor, we needed a way to allow those employees access to the Intranet. So, how do we go about allowing users to login from the outside world and gain access to our Intranet?

  Read the article

• How to configure installed Ruby and gems?

  - by NARKOZ

  My current gem env returns: RubyGems Environment: - RUBYGEMS VERSION: 1.3.6 - RUBY VERSION: 1.8.7 (2008-08-11 patchlevel 72) [x86_64-linux] - INSTALLATION DIRECTORY: /home/USERNAME/.gems - RUBYGEMS PREFIX: /home/narkoz - RUBY EXECUTABLE: /usr/bin/ruby1.8 - EXECUTABLE DIRECTORY: /home/USERNAME/.gems/bin - RUBYGEMS PLATFORMS: - ruby - x86_64-linux - GEM PATHS: - /home/USERNAME/.gems - /usr/lib/ruby/gems/1.8 - GEM CONFIGURATION: - :update_sources => true - :verbose => true - :benchmark => false - :backtrace => false - :bulk_threshold => 1000 - "gempath" => ["/home/USERNAME/.gems", "/usr/lib/ruby/gems/1.8"] - "gemhome" => "/home/USERNAME/.gems" - REMOTE SOURCES: - http://rubygems.org/ How can I change path /home/USERNAME/ to my own without uninstalling? OS: Debian Linux

  Read the article

• Non interactive git clone (ssh fingerprint prompt)

  - by qwe

  I want to clone a repo in a non-interactive way. When cloning, git asks to confirm host's fingerprint: The authenticity of host 'bitbucket.org (207.223.240.182)' can't be established. RSA key fingerprint is 97:8c:1b:f2:6f:14:6b:5c:3b:ec:aa:46:46:74:7c:40. Are you sure you want to continue connecting (yes/no)? no How do I force "yes" every time this questions pops up? I tried using yes yes | git clone ..., but it doesn't work. EDIT: Here's a solution: Can I automatically add a new host to known_hosts? (adds entires to known_hosts with ssh-keyscan).

  Read the article

• Install Composer on Ubuntu

  - by Milos

  I am trying to install composer with the command: sudo curl -s https://getcomposer.org/installer | php And I am getting this error: All settings correct for using Composer Downloading... Download failed: failed to open stream: Permission denied Downloading... Download failed: failed to open stream: Permission denied Downloading... Download failed: failed to open stream: Permission denied The download failed repeatedly, aborting. I don't know why? Do you have an idea? I tryed to google it but nothing.

  Read the article

• Redirecting HTTP traffic from a local server on the web

  - by MrJackV

  Here is the situation: I have a webserver (let's call it C1) that is running an apache/php server and it is port forwarded so that I can access it anywhere. However there is another computer within the webserver LAN that has a apache server too (let's call it C2). I cannot change the port forwarding nor I can change the apache server (a.k.a. install custom modules). My question is: is there a way to access C2 within a directory of C1? (e.g. going to www.website.org/random_dir will allow me to browse the root of C2 apache server.) I am trying to change as little as possible of the config/other (e.g. activating modules etc.) Is there a possible solution? Thanks in advance.

  Read the article

• Convert text to table

  - by Quattro

  I would like convert text into a table. Here is a link to the text http://www.tcdb.org/public/tcdb Short example: >gnl|TC-DB|A0CIB0|1.A.17.3.1 Chromosome undetermined scaffold_19, whole genome shotgun sequence OS=Paramecium tetraurelia GN=GSPATT00007662001 PE=4 SV=1 MDDQNQPILQEQPKPKQKKPLLNTKMVKKQKMQNKKEENLREILNFYTNQVDARKFLQKM KAVVDSNQQEKKYQDDFLNPNEYNEMQDIYEDYNMGDLVIVFPNPDADGVKNPPITYKEA PLTKTNFYSKIGNVSYENDIDELCVDEMEYLRNMRNVDGEHMDQDHVKEEI >gnl|TC-DB|A0CS82|9.B.82.1.5 Chromosome undetermined scaffold_26, whole genome shotgun sequence - Paramecium tetraurelia. MIIEEQIEEKMIYKAIHRVKVNYQKKIDRYILYKKSRWFFNLLLMLLYAYRIQNIGGFYI VTYIYCVYQLQLLIDYFTPLGLPPVNLEDEEEDDDQFQNDFSELPTTLSNKNELNDKEFR PLLRTTSEFKVWQKSVFSVIFAYFCTYIPIWDIPVYWPFLFCYFFVIVGMSIRKYIKHMK KYGYTILDFTKKK I wanted to have columns for example delimited with pipe | or ; |>gnl|TC-DB|A0CIB0|1.A.17.3.1| Chromosome undetermined scaffold_19, whole genome shotgun sequence OS=Paramecium tetraurelia GN=GSPATT00007662001 PE=4 SV=1| MDDQNQPILQEQPKPKQKKPLLNTKMVKKQKMQNKKEENLREILNFYTNQVDARKFLQKM KAVVDSNQQEKKYQDDFLNPNEYNEMQDIYEDYNMGDLVIVFPNPDADGVKNPPITYKEA PLTKTNFYSKIGNVSYENDIDELCVDEMEYLRNMRNVDGEHMDQDHVKEEI I am working with Windows and I don't know how to do it I just know every row starts with > I want to substitute the first whitespace in a row with a delimiter like | or ; after the first regular expression new line in a row, I want also a delimiter everything between the regular expression first new line and > should go into a new column (it's a sequence of a protein)

  Read the article

• How to combine with openvpn, dynamic-ip?

  - by asfasdv

  Dear everyone, I am currently using openvpn to surf online to bypass censorship. Let me show you the initial scenario: before openvpn is turned on: IP: 1.2.3.4 (hypothetical, checked by visiting whatismyip.com/) after openvpn is turned on IP: 10.2.3.4 (this is also checked with whatismyip.com/, I assume this is where the vpn's exit point's IP ) Situation: Once I enable openvpn, I can still ssh into this computer by sshing into 1.2.3.4, even though visiting whatismyip.com/ says it's 10.2.3.4. However, I am on dynamic IP, I run a website, and am using tools (inadyn in particular) which pings the freedns.afraid.org (my dns server) and updates my ip. The messed up part is when inadyn does so, my dns changes the ip to 10.2.3.4, which is presumably the exit point of my vpn. How do I get around this? (Note that sshing into 1.2.3.4 STILL works).

  Read the article

• time on files differ by 1 sec. FAIL Robocopy sync

  - by csmba

  I am trying to use Robocopy to sync (/IMG) a folder on my PC and a shared network drive. The problem is that the file attributes differ by 1 sec on both locations (creation,modified and access). So every time I run robocopy, it syncs the file again... BTW, problem is the same if I delete the target file and robocopy it from new... still, new file has 1 sec different properties. Env Details: Source: Win 7 64 bit Target: WD My Book World Edition NAS 1TB which takes its time from online NTP pool.ntp.org (I don't know if file system is FAT or not)

  Read the article

• Embed Powershell prompt in Windows 7 desktop

  - by EricRRichards

  On Linux (last time I did this was with Compiz on Ubuntu 11), I like to have a transparent console window anchored to the desktop, so I can get to a shell just by clicking out of whatever I'm doing and don't have to play with with moving/resizing windows. I'd like to do something similar on Windows 7/Server 2008. I could probably write up a quick little app in .Net that would run fullscreen and have a powershell terminal embedded in it, but, if somebody has already created something sufficient, or there is some other hackery to do this, I don't want to reinvent the wheel. Another possibility could be a Quake-style pulldown console, similar to Guake (guake.org).

  Read the article

• Missing time zones in OSX and Windows

  - by pellepim

  I am working on a javascript to automatically detect a user's timezone (https://bitbucket.org/pellepim/jstimezonedetect/). But there are two timezones that I have a really hard time to test, since I can not set my system to observe these timezones. The timezones I am talking about are UTC+1245 (Chatham Islands, NZ) and UTC+0845 (Australia/Eucla). As far as I can tell in OSX (Snow Leopard) and in Windows 7 these timezones do not exist as a setting. Granted, very few people live in these areas, and it might just not be worth it. Does anyone know of a way to set these timezones on a system level? In any operating system? If it is not possible in a trivial way, what do people who live in these areas do to get their systems working as they would like?

  Read the article

• How to host my own cloud so that videos are viewable via desktop web browser?

  - by jake9115

  I want to host my own cloud storage solution, something like Dropbox but entirely dependent on my own central machine. This way things are more secure if setup correctly, and there are artificial storage limitations or pay-walls. Some thing similar to ownCloud: http://owncloud.org/ There is one important feature I want to have: the ability the stream movies in a web browser from my personal cloud to anywhere in the world. In the past I tried this with a NAS, and I mapped XBMC to the NAS via SFTP, and certain media types could stream in this manner. I've also used things like PLEX. In this case, I am looking for a single solution for personal cloud storage and movie streaming from that cloud into a web browser. Does anyone know if this can be accomplished? Thanks for the suggestions!

  Read the article

• How can I delete everything after the first column in Notepad++?

  - by Bob J

  I'm trying to get rid of everything after a column in Notepad++. Column mode is not an option. Is it possible? What I have 70.97.110.40 159 ms [n/a] 21 70.97.117.177 134 ms [n/a] 21 70.97.120.10 75 ms [n/a] 21 70.97.122.105 87 ms www.portless.net 21 70.97.122.106 89 ms www.popovetsky.org 21 70.97.122.107 95 ms www.psmythe.net 21 70.97.122.104 98 ms wasabi.prostructure.com 21 70.97.122.108 89 ms crm.prostructure.com 21 70.97.122.109 87 ms internal.prostructure.com21 What I want 70.97.110.40 70.97.117.177 70.97.120.10 70.97.122.105 70.97.122.106 70.97.122.107 70.97.122.104 70.97.122.108 70.97.122.109 Thanks

  Read the article

• Move and clone VirtualBox machines with filesystem commands

  - by mit

  I know of 2 ways to clone a VirtualBox machine on a linux host, one is by using the VirtualBox gui and exporting and re-importing as Appliance (in the file menu of VirtualBox). The other is by cloning only the virtual disk containers: VBoxManage clonevdi source.vdi target.vdi (Taken from http://forums.virtualbox.org/viewtopic.php?p=853#p858 ) I would have to create a new VM afterwards and use the cloned virtual disk. Is there a way I can just copy a virtual disk and the and do the rest by hand? I'd have to manually edit the ~/VirtualBox/VirtualBox.xml and insert a new disk and a new machine: Can I just make up UUIDs or how would this work? I would very much prefer this hardcore method of doing things as it allows me to freely and rapdily backup, restore, move or clone machines. Or ist there a better way to do this?

  Read the article

< Previous Page | 285 286 287 288 289 290 291 292 293 294 295 296  | Next Page >