Search Results

Search found 11924 results on 477 pages for 'openoffice org'.

Page 289/477 | < Previous Page | 285 286 287 288 289 290 291 292 293 294 295 296  | Next Page >

• How to run nodejs on linux platform

  - by rotem

  How to run node.js on host with linux platform? To run node.js on localhost with windows operation system is simple I download package from nodejs.org/download/ and I execute Windows Installer (.msi) I go to console command line and I type node file.js and everything fine. but in my host with linux platform I have control panel with no option to run type file exe, msi and there is no window with command line, So how can I be able to run nodejs on my host? I call to support of my hosting bluehost.com and they don't know. my Details server and control panel Thanks for any help

  Read the article

• How to setup email server in ubuntu 12.04LTS(debian 7 wheezy/sid) running on linode vps

  - by shihon

  I am working on email server, since i tried several times to create email server on ubuntu12.04LTS with postfix + dovecote + postfixadmin + courier + clamav + spamassassin. But everytime i install these packages i face new problems, like mails send to localhost users and found in users maildir. But I can't determine how to configure/setup for send an email to external smtp like gmail, yahoo. The most worst thing i can't determine how to use sasl, because i am not using SSL so it is not worthy for my domain. This is so complicated, i search everywhere on google: links are https://help.ubuntu.com/community/PostfixCompleteVirtualMailSystemHowto http://www.starbridge.org/spip/spip.php?article1&lang=fr http://knopix.wordpress.com/2008/01/16/postfixadmin-postgresql-courier-squirrelmail-on-debian-etch-howtotutorial/ http://flurdy.com/docs/postfix/ Is there any article for install email server on ubuntu 12.04LTS. Please help me to understand these things.

  Read the article

• Installing maven on Ubuntu by manual download

  - by WebDevHobo

  To install Maven, I downloaded the latest version from the website and then followed these steps: http://maven.apache.org/download.html#Installation The last step, the version control, does not work. It says that 'mvn' is currently not installed and that I should type sudo apt-get install maven2 If I go directly to the mvn file itself, it does work: root@ubuntu:~# /usr/local/apache-maven/apache-maven-2.2.1/bin/mvn --version Apache Maven 2.2.1 (r801777; 2009-08-06 12:16:01-0700) Java version: 1.6.0_21 Java home: /usr/java/jdk1.6.0_21/jre Default locale: en_US, platform encoding: UTF-8 OS name: "linux" version: "2.6.32-25-generic" arch: "i386" Family: "unix" So, what am I doing wrong here? Or what would and apt-get install do extra that I might have forgotten?

  Read the article

• Can GnomeKeyring store passwords unencrypted?

  - by antimeme

  I have a Fedora 15 laptop with the root and home partitions encrypted using LUKS. When it boots I have to enter a pass phrase to unlock the master key, so I have it configured to automatically log me in to my account. However, GnomeKeyring remains locked, so I have to enter another pass phrase for that. This is unpleasant and completely pointless since the entire disk is encrypted. I've not been able to find a way to configure GnomeKeyring to store its pass phrases without encryption. For example, I was not able to find an answer here: http://library.gnome.org/users/seahorse-plugins/stable/index.html.en Is there a solution? If not, is there a mailing list where it would be appropriate to plead my case?

  Read the article

• Xorg configuration file on Debian Testing

  - by nubicurio

  I cannot find the Xorg configuration file on my newly installed Debian on my tablet-pc, so I followed this tutorial http://wiki.debian.org/Xorg and ran the command "Xorg -configure", to which I got the following error messages: (EE) Failed to load module "vmwgfx" (module does not exist, 0) (EE) vmware: Please ignore the above warnings about not being able to load module/driver vmwgfx (++) Using config file: "/root/xorg.conf.new" (==) Using system config directory "/usr/share/X11/xorg.conf.d" FATAL: Module fbcon not found. Number of created screens does not match number of detected devices. Configuration failed. Dose anyone know what this means and how I should proceed? Why is there a warning about vmware, and what is this fbcon module?

  Read the article

• How to mount a iSCSI/SAN storage drive to a stable device name (one that can't change on re-connect)?

  - by jcalfee314

  We need stable device paths for our Twinstrata SAN drives. Many guides for setting up iSCSI connectors simply say to use a device path like /dev/sda or /dev/sdb. This is far from correct, I doubt that any setup exists that would be happy to have its device name suddenly change (from /dev/sda to /dev/sdb for example). The fix I found was to install multipath and start a multipathd on boot which then provides a stable mapping between the storage's WWID to a device path like this /dev/mapper/firebird_database. This is a method described in the CentOS/RedHat here: http://www.centos.org/docs/5/html/5.1/DM_Multipath/setup_procedure.html. This seems a little complicated though. We noticed that it is common to see UUIDs appear in fstab on new installs. So, the question is, why do we need an external program (multipathd) running to provide a stable device mount? Should there be a way to provide the WWID directly in /etc/fstab?

  Read the article

• How to limit server to specific IP addresses with mod_authz_host?

  - by BeeDog

  Hi! I am very new to this area, so please bear with me. :) Right now I am running an Apache HTTP server on my setup, a very basic configuration. The website hosted on it is accessible from anywhere, and I want to limit the access to a specific IP address range. I've looked into this and I found that one Apache module called mod_authz_host handles this. http://httpd.apache.org/docs/2.2/mod/mod_authz_host.html The problem is, I haven't managed to find documentation that explains well how to actually do the stuff. How do I actually make sure only a certain range of IP addresses can access my site/server? The machine is running Ubuntu Server 10.10, the web files are stored in /var/www/, the apache2 daemon has its stuff stored in /etc/apache2/ and /usr/lib/apache2/modules/*. Thanks in advance, and sorry if this is a stupid question!

  Read the article

• debian installation without internet connection

  - by Gobliins

  Hi i want to install some Debian distributions (Grip, Crush, Lenny...) for arm / armel architectures. www.emdebian.org/ i refer to this guide www.aurel32.net/info/debian_arm_qemu.php The Problem i have is that i dont have internet connection with My Linux VM or Qemu i am behind a Proxy. I want to know is there a way where i can dl all the needed files and save them to disk that i don´t need an i.c. during the installation? I am working under Windows now. my regards

  Read the article

• Tracking down laptops Google has never heard of

  - by John

  Using MS tools to get information on PCs using our software, our customers have sent several Lenovo systems which have names we simply cannot find using Google... no search results at all. Considering these names/ids are returned by querying the system directly, not asking the customer to write it down by looking at the box, this seems odd. The ones we have so far (more than one of each) are: Lenovo 2241BL9 Lenovo 6463Y4H My guess is these are Thinkpads after Lenovo took over the brand, but can anyone help me out with this detective work? edit: the 2nd one does turn up some driver downloads and this page, but it's unclear what any of that means. Is the 6463y4h just a T61? http://smolts.org/reports/view_profile/%20ThinkPad%20T61

  Read the article

• Accessing our Intranet from outside our Network - WITHOUT VPN

  - by westexasman

  We just upgraded our company intranet from an IIS based, ASP (poorly written) server/code base to a Windows Server 2008 r2 (Apache/MySQL/PHP) server. The old server allowed users to login to intranet.xxx.org using there AD user/pass which then lead them to the company Intranet from basically anywhere they had Internet access. We want to mimic that functionality (or change it to something more secure) with the new setup. This was seemingly setup for off-site employees running on a state network. The state network does not allow VPN, therefor, we needed a way to allow those employees access to the Intranet. So, how do we go about allowing users to login from the outside world and gain access to our Intranet?

  Read the article

• Seeing DNS changes takes too long on my PC, can it be my router misconfiguration?

  - by Borek

  I administer a few sites and need to update their DNS entries from time to time, e.g., adding an A-record point certain subdomain to a certain IP. When I check sites like http://www.opendns.com/support/cache/, I can clearly see the DNS change taking effect throughout the world - is it just my PC that can't see this change (ping newsubdomain.example.org says it cannot resolve host name) The network "map" is like this: My PC -> my router -> my ISP's router -> internet On my PC, the DNS is set automatically which means that if I run iconfig /all, my router will be returned as the DNS server (192.168.1.1). On my router, the DNS is set to be what my ISP provided me with. Is this correct? What can I do to see new hostnames resolved quicker?

  Read the article

• Tagging does not work with the Subversion plugin.

  - by mark

  I have exactly the same problem as the fellow from this post - http://jenkins.361315.n4.nabble.com/Tag-this-build-not-working-subversion-td384218.html, except that I use build 1.413 Unfortunately, the post does not provide any workarounds except downgrading to 1.310 (from 1.315) I would gladly provide the logs, if I knew the logger names. Please, help. P.S. I have posted this issue both on jenkins issues site - https://issues.jenkins-ci.org/browse/JENKINS-9961 and in the respective google group - https://groups.google.com/d/topic/jenkinsci-users/4UVKFxXA9Jo/overview. To no avail. So, this site is my last hope - thanks to all in advance. EDIT Upgraded to 1.417 - still tagging does nothing.

  Read the article

• Link two or more text boxes in Visio

  - by Dan

  I am working on creating a template in Visio 2007 (Professional). Each page should reflect a document number and a revision number (two text boxes). I would like to make the template such that entering or changing text in one of these boxes on one page will automatically update the equivalent text boxes on all other pages. Is there an easy way to link two (or more) text boxes to show the same data (mirror each other)? I've looked into creating a ShapeData set and then using the ShapeData field in place of each box, but this will require training others to access and adjust the ShapeData field. In short - I want the issue that was attempting to be solved in Changing Text in Visio Org Chart Shape Changes Multiple Shapes' Text .

  Read the article

• Convert text to table

  - by Quattro

  I would like convert text into a table. Here is a link to the text http://www.tcdb.org/public/tcdb Short example: >gnl|TC-DB|A0CIB0|1.A.17.3.1 Chromosome undetermined scaffold_19, whole genome shotgun sequence OS=Paramecium tetraurelia GN=GSPATT00007662001 PE=4 SV=1 MDDQNQPILQEQPKPKQKKPLLNTKMVKKQKMQNKKEENLREILNFYTNQVDARKFLQKM KAVVDSNQQEKKYQDDFLNPNEYNEMQDIYEDYNMGDLVIVFPNPDADGVKNPPITYKEA PLTKTNFYSKIGNVSYENDIDELCVDEMEYLRNMRNVDGEHMDQDHVKEEI >gnl|TC-DB|A0CS82|9.B.82.1.5 Chromosome undetermined scaffold_26, whole genome shotgun sequence - Paramecium tetraurelia. MIIEEQIEEKMIYKAIHRVKVNYQKKIDRYILYKKSRWFFNLLLMLLYAYRIQNIGGFYI VTYIYCVYQLQLLIDYFTPLGLPPVNLEDEEEDDDQFQNDFSELPTTLSNKNELNDKEFR PLLRTTSEFKVWQKSVFSVIFAYFCTYIPIWDIPVYWPFLFCYFFVIVGMSIRKYIKHMK KYGYTILDFTKKK I wanted to have columns for example delimited with pipe | or ; |>gnl|TC-DB|A0CIB0|1.A.17.3.1| Chromosome undetermined scaffold_19, whole genome shotgun sequence OS=Paramecium tetraurelia GN=GSPATT00007662001 PE=4 SV=1| MDDQNQPILQEQPKPKQKKPLLNTKMVKKQKMQNKKEENLREILNFYTNQVDARKFLQKM KAVVDSNQQEKKYQDDFLNPNEYNEMQDIYEDYNMGDLVIVFPNPDADGVKNPPITYKEA PLTKTNFYSKIGNVSYENDIDELCVDEMEYLRNMRNVDGEHMDQDHVKEEI I am working with Windows and I don't know how to do it I just know every row starts with > I want to substitute the first whitespace in a row with a delimiter like | or ; after the first regular expression new line in a row, I want also a delimiter everything between the regular expression first new line and > should go into a new column (it's a sequence of a protein)

  Read the article

• Non interactive git clone (ssh fingerprint prompt)

  - by qwe

  I want to clone a repo in a non-interactive way. When cloning, git asks to confirm host's fingerprint: The authenticity of host 'bitbucket.org (207.223.240.182)' can't be established. RSA key fingerprint is 97:8c:1b:f2:6f:14:6b:5c:3b:ec:aa:46:46:74:7c:40. Are you sure you want to continue connecting (yes/no)? no How do I force "yes" every time this questions pops up? I tried using yes yes | git clone ..., but it doesn't work. EDIT: Here's a solution: Can I automatically add a new host to known_hosts? (adds entires to known_hosts with ssh-keyscan).

  Read the article

• time on files differ by 1 sec. FAIL Robocopy sync

  - by csmba

  I am trying to use Robocopy to sync (/IMG) a folder on my PC and a shared network drive. The problem is that the file attributes differ by 1 sec on both locations (creation,modified and access). So every time I run robocopy, it syncs the file again... BTW, problem is the same if I delete the target file and robocopy it from new... still, new file has 1 sec different properties. Env Details: Source: Win 7 64 bit Target: WD My Book World Edition NAS 1TB which takes its time from online NTP pool.ntp.org (I don't know if file system is FAT or not)

  Read the article

• How to configure installed Ruby and gems?

  - by NARKOZ

  My current gem env returns: RubyGems Environment: - RUBYGEMS VERSION: 1.3.6 - RUBY VERSION: 1.8.7 (2008-08-11 patchlevel 72) [x86_64-linux] - INSTALLATION DIRECTORY: /home/USERNAME/.gems - RUBYGEMS PREFIX: /home/narkoz - RUBY EXECUTABLE: /usr/bin/ruby1.8 - EXECUTABLE DIRECTORY: /home/USERNAME/.gems/bin - RUBYGEMS PLATFORMS: - ruby - x86_64-linux - GEM PATHS: - /home/USERNAME/.gems - /usr/lib/ruby/gems/1.8 - GEM CONFIGURATION: - :update_sources => true - :verbose => true - :benchmark => false - :backtrace => false - :bulk_threshold => 1000 - "gempath" => ["/home/USERNAME/.gems", "/usr/lib/ruby/gems/1.8"] - "gemhome" => "/home/USERNAME/.gems" - REMOTE SOURCES: - http://rubygems.org/ How can I change path /home/USERNAME/ to my own without uninstalling? OS: Debian Linux

  Read the article

• Redirecting HTTP traffic from a local server on the web

  - by MrJackV

  Here is the situation: I have a webserver (let's call it C1) that is running an apache/php server and it is port forwarded so that I can access it anywhere. However there is another computer within the webserver LAN that has a apache server too (let's call it C2). I cannot change the port forwarding nor I can change the apache server (a.k.a. install custom modules). My question is: is there a way to access C2 within a directory of C1? (e.g. going to www.website.org/random_dir will allow me to browse the root of C2 apache server.) I am trying to change as little as possible of the config/other (e.g. activating modules etc.) Is there a possible solution? Thanks in advance.

  Read the article

• Install Composer on Ubuntu

  - by Milos

  I am trying to install composer with the command: sudo curl -s https://getcomposer.org/installer | php And I am getting this error: All settings correct for using Composer Downloading... Download failed: failed to open stream: Permission denied Downloading... Download failed: failed to open stream: Permission denied Downloading... Download failed: failed to open stream: Permission denied The download failed repeatedly, aborting. I don't know why? Do you have an idea? I tryed to google it but nothing.

  Read the article

• How to combine with openvpn, dynamic-ip?

  - by asfasdv

  Dear everyone, I am currently using openvpn to surf online to bypass censorship. Let me show you the initial scenario: before openvpn is turned on: IP: 1.2.3.4 (hypothetical, checked by visiting whatismyip.com/) after openvpn is turned on IP: 10.2.3.4 (this is also checked with whatismyip.com/, I assume this is where the vpn's exit point's IP ) Situation: Once I enable openvpn, I can still ssh into this computer by sshing into 1.2.3.4, even though visiting whatismyip.com/ says it's 10.2.3.4. However, I am on dynamic IP, I run a website, and am using tools (inadyn in particular) which pings the freedns.afraid.org (my dns server) and updates my ip. The messed up part is when inadyn does so, my dns changes the ip to 10.2.3.4, which is presumably the exit point of my vpn. How do I get around this? (Note that sshing into 1.2.3.4 STILL works).

  Read the article

• SFTP not working, but SSH is

  - by Dan

  I've had a server running CentOS for a few months now. A few days ago, I stopped being able to connect to it over SFTP. I've tried from multiple computers, OSes, clients, and internet connections. I can SSH in just fine, though. For example, Nautilus gives me this: Error: DBus error org.freedesktop.DBus.Error.NoReply: Did not receive a reply. Possible causes include: the remote application did not send a reply, the message bus security policy blocked the reply, the reply timeout expired, or the network connection was broken. Please select another viewer and try again. I was under the impression that SFTP was just pure SSH, and if one worked, the other would, and vice-versa. Clearly that's not the case, though. What could I have done wrong?

  Read the article

• ionice idle is ignored

  - by Ferran Basora

  I have been testing the ionice command for a while and the idle (3) mode seems to be ignored in most cases. My test is to run both command at the same time: du <big folder> ionice -c 3 du <another big folder> If I check both process in iotop I see no difference in the percentage of io utilization for each process. To provide more information about the CFQ scheduler I'm using a 3.5.0 linux kernel. I started doing this test because I'm experimenting a system lag each time a daily cron job updatedb.mlocate is executed in my Ubuntu 12.10 machine. If you check the /etc/cron.daily/mlocate file you realize that the command is executed like: /usr/bin/ionice -c3 /usr/bin/updatedb.mlocate Also, the funny thing is that whenever my system for some reason starts using swap memory, the updatedb.mlocate io process is been scheduled faster than kswapd0 process, and then my system gets stuck. Some suggestion? References: http://ubuntuforums.org/showthread.php?t=1243951&page=2 https://bugs.launchpad.net/ubuntu/+source/findutils/+bug/332790

  Read the article

• Missing time zones in OSX and Windows

  - by pellepim

  I am working on a javascript to automatically detect a user's timezone (https://bitbucket.org/pellepim/jstimezonedetect/). But there are two timezones that I have a really hard time to test, since I can not set my system to observe these timezones. The timezones I am talking about are UTC+1245 (Chatham Islands, NZ) and UTC+0845 (Australia/Eucla). As far as I can tell in OSX (Snow Leopard) and in Windows 7 these timezones do not exist as a setting. Granted, very few people live in these areas, and it might just not be worth it. Does anyone know of a way to set these timezones on a system level? In any operating system? If it is not possible in a trivial way, what do people who live in these areas do to get their systems working as they would like?

  Read the article

• Embed Powershell prompt in Windows 7 desktop

  - by EricRRichards

  On Linux (last time I did this was with Compiz on Ubuntu 11), I like to have a transparent console window anchored to the desktop, so I can get to a shell just by clicking out of whatever I'm doing and don't have to play with with moving/resizing windows. I'd like to do something similar on Windows 7/Server 2008. I could probably write up a quick little app in .Net that would run fullscreen and have a powershell terminal embedded in it, but, if somebody has already created something sufficient, or there is some other hackery to do this, I don't want to reinvent the wheel. Another possibility could be a Quake-style pulldown console, similar to Guake (guake.org).

  Read the article

• X11 not sending windows to remote computer matlab

  - by MZimmerman6

  I am trying to set up my home desktop, running OS X Mountain Lion, to basically do a bunch of grunt work for me remotely. I have set up ssh, and am able to remotely control the computer fine, but the issue comes in when I try to run X11 apps, like MATLAB, remotely and get windows to pop up. Every time I try to bring up a new window it either opens that window on the remote computer (not the one I am using to control it), or it tells me it can't find a display. here is how I am setting up my ssh assume my matlab alias is set up properly, which it is. ssh -X username@host.org matlab -nodesktop figure; This will open the window on the computer I am SSHing into, and not on the remote one. Basically I want that window to open on the computer I am remoting from. I changed my SSH X11Forwarding and stuff to be yes in ssh_config and sshd_config. Any other suggestions?

  Read the article

< Previous Page | 285 286 287 288 289 290 291 292 293 294 295 296  | Next Page >