Search Results

Search found 69812 results on 2793 pages for 'file encryption'.

Page 29/2793 | < Previous Page | 25 26 27 28 29 30 31 32 33 34 35 36  | Next Page >

  • How to create encrypted Jar file?

    - by Kartik Mistry
    I am working on project that must need to protect data (revealing code is not main problem) files. We are using Java + Netbeans. Is there any facility that will create jar in encrypted format? We are also using sqlite for database - so putting text file in encrypted format is not proper option for us too.

    Read the article

  • What (pure) Python library to use for AES 256 encryption?

    - by Daren Thomas
    I am looking for a (preferably pure) python library to do AES 256 encription and decryption. This library should support the CBC cipher mode and use PKCS7 padding according to the answer to an earlier question of mine. The library should at least work on Mac OS X (10.4) and Windows XP. Ideally just by dropping it into the source directory of my project. I have seen this by Josh Davis, but am not sure about how good it is and if it does the required CBC cipher mode... Scanning the source suggests it doesn't

    Read the article

  • C# encrypt whole XML File

    - by René
    I already have a solution for encrypting of several XML nodes or strings. But of course, you can open the local saved XML file and you should see the node tags. For some intelligent people it could be a reference for hidden informations. Is there any way to encrypt and decrypt the whole xml content including all node tags?

    Read the article

  • Can I encrypt value in C# and use that with SQL Server 2005 symmetric encryption?

    - by Robert Byrne
    To be more specific, if I create a symmetric key with a specific KEY_SOURCE and ALGORITHM (as described here), is there any way that I can set up the same key and algorithm in C# so that I can encrypt data in code, but have that data decrypted by the symmetric key in Sql Server? From the research I've done so far, it seems that the IDENTITY_VALUE for the key is also baked into the cypher text, making things even more complex. I'm thinking about just trying all the various ways I can think of, ie hashing the KEY_SOURCE using different hash algorithms for a key and trying different ways of encrypting the plain text until I get something that works. Or is that just futile? Has anyone else done this, any pointers? UPDATE Just to clarify, I want to use NHibernate on the client side, but theres a bunch of stored procedures on the database side that still perform decryption.

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • Copy mdf file and use it in run time

    - by Anibas
    After I copy mdf file (and his log file) I tries to Insert data. I receive the following message: "An attempt to attach an auto-named database for file [fileName].mdf failed. A database with the same name exists, or specified file cannot be opened, or it is located on UNC share. When I copied the file manual everything worked normally. Is it correct the order File.Copy leaves the file engaged?

    Read the article

  • Designing a database file format

    - by RoliSoft
    I would like to design my own database engine for educational purposes, for the time being. Designing a binary file format is not hard nor the question, I've done it in the past, but while designing a database file format, I have come across a very important question: How to handle the deletion of an item? So far, I've thought of the following two options: Each item will have a "deleted" bit which is set to 1 upon deletion. Pro: relatively fast. Con: potentially sensitive data will remain in the file. 0x00 out the whole item upon deletion. Pro: potentially sensitive data will be removed from the file. Con: relatively slow. Recreating the whole database. Pro: no empty blocks which makes the follow-up question void. Con: it's a really good idea to overwrite the whole 4 GB database file because a user corrected a typo. I will sell this method to Twitter ASAP! Now let's say you already have a few empty blocks in your database (deleted items). The follow-up question is how to handle the insertion of a new item? Append the item to the end of the file. Pro: fastest possible. Con: file will get huge because of all the empty blocks that remain because deleted items aren't actually deleted. Search for an empty block exactly the size of the one you're inserting. Pro: may get rid of some blocks. Con: you may end up scanning the whole file at each insert only to find out it's very unlikely to come across a perfectly fitting empty block. Find the first empty block which is equal or larger than the item you're inserting. Pro: you probably won't end up scanning the whole file, as you will find an empty block somewhere mid-way; this will keep the file size relatively low. Con: there will still be lots of leftover 0x00 bytes at the end of items which were inserted into bigger empty blocks than they are. Rigth now, I think the first deletion method and the last insertion method are probably the "best" mix, but they would still have their own small issues. Alternatively, the first insertion method and scheduled full database recreation. (Probably not a good idea when working with really large databases. Also, each small update in that method will clone the whole item to the end of the file, thus accelerating file growth at a potentially insane rate.) Unless there is a way of deleting/inserting blocks from/to the middle of the file in a file-system approved way, what's the best way to do this? More importantly, how do databases currently used in production usually handle this?

    Read the article

  • opening and viewing a file in php

    - by Christian Burgos
    how do i open/view for editing an uploaded file in php? i have tried this but it doesn't open the file. $my_file = 'file.txt'; $handle = fopen($my_file, 'r'); $data = fread($handle,filesize($my_file)); i've also tried this but it wont work. $my_file = 'file.txt'; $handle = fopen($my_file, 'w') or die('Cannot open file: '.$my_file); $data = 'This is the data'; fwrite($handle, $data); what i have in mind is like when you want to view an uploaded resume,documents or any other ms office files like .docx,.xls,.pptx and be able to edit them, save and close the said file. edit: latest tried code... <?php // Connects to your Database include "configdb.php"; //Retrieves data from MySQL $data = mysql_query("SELECT * FROM employees") or die(mysql_error()); //Puts it into an array while($info = mysql_fetch_array( $data )) { //Outputs the image and other data //Echo "<img src=localhost/uploadfile/images".$info['photo'] ."> <br>"; Echo "<b>Name:</b> ".$info['name'] . "<br> "; Echo "<b>Email:</b> ".$info['email'] . " <br>"; Echo "<b>Phone:</b> ".$info['phone'] . " <hr>"; //$file=fopen("uploadfile/images/".$info['photo'],"r+"); $file=fopen("Applications/XAMPP/xamppfiles/htdocs/uploadfile/images/file.odt","r") or exit("unable to open file");; } ?> i am getting the error: Warning: fopen(Applications/XAMPP/xamppfiles/htdocs/uploadfile/images/file.odt): failed to open stream: No such file or directory in /Applications/XAMPP/xamppfiles/htdocs/uploadfile/view.php on line 17 unable to open file the file is in that folder, i don't know it wont find it.

    Read the article

  • Reading data from text file in C

    - by themake
    I have a text file which contains words separated by space. I want to take each word from the file and store it. So i have opened the file but am unsure how to assign the word to a char. FILE *fp; fp = fopen("file.txt", "r"); //then i want char one = the first word in the file char two = the second word in the file

    Read the article

  • How does the receiver of a cipher text know the IV used for encryption?

    - by PatrickL
    If a random IV is used in encrypting plain text, how does the receiver of the cipher text know what the IV is in order to decrypt it? This is a follow-up question to a response to the previous stackoverflow question on IVs here. The IV allows for plaintext to be encrypted such that the encrypted text is harder to decrypt for an attacker. Each bit of IV you use will double the possibilities of encrypted text from a given plain text. The point is that the attacker doesn't know what the IV is and therefore must compute every possible IV for a given plain text to find the matching cipher text. In this way, the IV acts like a password salt. Most commonly, an IV is used with a chaining cipher (either a stream or block cipher). ... So, if you have a random IV used to encrypt the plain text, how do you decrypt it? Simple. Pass the IV (in plain text) along with your encrypted text. Wait. You just said the IV is randomly generated. Then why pass it as plain text along with the encrypted text?

    Read the article

  • iPhone Encryption Standard - Will this implementation bye-pass apple check?

    - by Futur
    Hi All, I found this implementation, and i am not sure whether we can use this implementation and apple will bye-pass extra check, this is a base-64 implementation. The source code link is http://blog.objectgraph.com/wp-content/uploads/2010/04/CryptTest.zip The web page link is : http://blog.objectgraph.com/index.php/2010/04/20/encrypting-decrypting-base64-encode-decode-in-iphone-objective-c/ Kindly advice me friends.

    Read the article

  • Is there a built-in class to handle encryption in C#?

    - by badpanda
    I need to encrypt bytecode to send over a connection to a webservice, preferably using a GUID as a key. I have done a bit of research and found several classes developed for a similar purpose, but haven't been able to turn up much that is built into the Windows libraries. My question is: Is there something built in to C# that performs this task? If there is not, I would very much appreciate any suggestions as to implementation. Thanks!! badPanda

    Read the article

  • Copied a file with winscp; only winscp can see it

    - by nilbus
    I recently copied a 25.5GB file from another machine using WinSCP. I copied it to C:\beth.tar.gz, and WinSCP can still see the file. However no other app (including Explorer) can see the file. What might cause this, and how can I fix it? The details that might or might not matter WinSCP shows the size of the file (C:\beth.tar.gz) correctly as 27,460,124,080 bytes, which matches the filesize on the remote host Neither explorer, cmd (command line prompt w/ dir C:\), the 7Zip archive program, nor any other File Open dialog can see the beth.tar.gz file under C:\ I have configured Explorer to show hidden files I can move the file to other directories using WinSCP If I try to move the file to Users/, UAC prompts me for administrative rights, which I grant, and I get this error: Could not find this item The item is no longer located in C:\ When I try to transfer the file back to the remote host in a new directory, the transfer starts successfully and transfers data The transfer had about 30 minutes remaining when I left it for the night The morning after the file transfer, I was greeted with a message saying that the connection to the server had been lost. I don't think this is relevant, since I did not tell it to disconnect after the file was done transferring, and it likely disconnected after the file transfer finished. I'm using an old version of WinSCP - v4.1.8 from 2008 I can view the file properties in WinSCP: Type of file: 7zip (.gz) Location: C:\ Attributes: none (Ready-only, Hidden, Archive, or Ready for indexing) Security: SYSTEM, my user, and Administrators group have full permissions - everything other than "special permissions" is checked under Allow for all 3 users/groups (my user, Administrators, SYSTEM) What's going on?!

    Read the article

  • How do I open a file in such a way that if the file doesn't exist it will be created and opened automatically?

    - by snakile
    Here's how I open a file for writing+ : if( fopen_s( &f, fileName, "w+" ) !=0 ) { printf("Open file failed\n"); return; } fprintf_s(f, "content"); If the file doesn't exist the open operation fails. What's the right way to fopen if I want to create the file automatically if the file doesn't already exist? EDIT: If the file does exist, I would like fprintf to overwrite the file, not to append to it.

    Read the article

  • C++, Ifstream opens local file but not file on HTTP Server

    - by fammi
    Hi, I am using ifstream to open a file and then read from it. My program works fine when i give location of the local file on my system. for eg /root/Desktop/abc.xxx works fine But once the location is on the http server the file fails to open. for eg http://192.168.0.10/abc.xxx fails to open. Is there any alternate for ifstream when using a URL address? thanks. part of the code where having problem: bool readTillEof = (endIndex == -1) ? true : false; // Open the file in binary mode and seek to the end to determine file size ifstream file ( fileName.c_str ( ), ios::in|ios::ate|ios::binary ); if ( file.is_open ( ) ) { long size = (long) file.tellg ( ); long numBytesRead; if ( readTillEof ) { numBytesRead = size - startIndex; } else { numBytesRead = endIndex - startIndex + 1; } // Allocate a new buffer ptr to read in the file data BufferSptr buf (new Buffer ( numBytesRead ) ); mpStreamingClientEngine->SetResponseBuffer ( nextRequest, buf ); // Seek to the start index of the byte range // and read the data file.seekg ( startIndex, ios::beg ); file.read ( (char *)buf->GetData(), numBytesRead ); // Pass on the data to the SCE // and signal completion of request mpStreamingClientEngine->HandleDataReceived( nextRequest, numBytesRead); mpStreamingClientEngine->MarkRequestCompleted( nextRequest ); // Close the file file.close ( ); } else { // Report error to the Streaming Client Engine // as unable to open file AHS_ERROR ( ConnectionManager, " Error while opening file \"%s\"\n", fileName.c_str ( ) ); mpStreamingClientEngine->HandleRequestFailed( nextRequest, CONNECTION_FAILED ); } }

    Read the article

  • Problem with File uplolad in javascript.

    - by Nikhil
    I have used javascript to upload more than one file. when user clicks on 'add more' javascript appends new object to older div using innerHTML. Now the problem is if I select a file and then click on "add more" then new file button exist but older selected file removes and two blank file buttons display. I want this old file must be selected when user add new file button. If anybody can, Help Plz!!! tnX.

    Read the article

  • Best way to secure a file.

    - by JACK IN THE CRACK
    Basically I need to like IDK encrypt a .zip file with some images and documents etc. Like it doesn't need to be .zip tho, just how can I encrypt a bunch of files with like a password or something. I NEED tHE ULTIMATE UNCRACKED PROTECTION. Now I'm a hacker, I know that anything can be hacked given enough time and effort. But I'm looking for top of the line....

    Read the article

  • Is there any sample Java code that does AES encryption exactly like this website?

    - by user1068636
    http://www.hanewin.net/encrypt/aes/aes-test.htm If you go to this website and enter the following: "Key In Hex": 00000000000000000000000000123456 "Plain Text in Hex": 00000000000000000000000000000000 And click on "Encrypt" button you will see the ciphertext in hex is: 3fa9f2a6e4c2b440fb6f676076a8ba04 Is there a Java program out there that I can do this (I.e. Is there an AES library that will input the "Key In Hex" above with the "Plain Text In Hex" above and generate the Ciphertext in Hex above? )? I would appreciate any advice or links to Java sample code that does this.

    Read the article

  • HTTPS Everywhere Extension Updates to Version 3.0, Adds Protection for 1,500 More Websites

    - by Asian Angel
    If one of your security goals is to encrypt your communication with websites as much as possible, then you will definitely be pleased with the latest update to the HTTPS Everywhere extension for Firefox and Chrome. This latest release adds encryption protection for an additional 1,500 websites to help make your browsing experience more secure than ever. Images shown above courtesy of EFF. You can learn more about this latest release along with installing the extension for Firefox and/or Chrome directly from the blog post linked below… HTTPS Everywhere 3.0 protects 1,500 more sites [via Softpedia] HTG Explains: What is the Windows Page File and Should You Disable It? How To Get a Better Wireless Signal and Reduce Wireless Network Interference How To Troubleshoot Internet Connection Problems

    Read the article

< Previous Page | 25 26 27 28 29 30 31 32 33 34 35 36  | Next Page >