Search Results

Search found 1724 results on 69 pages for 'symbol'.

Page 29/69 | < Previous Page | 25 26 27 28 29 30 31 32 33 34 35 36  | Next Page >

  • Are there equivalents to Ruby's method_missing in other languages?

    - by Justin Ethier
    In Ruby, objects have a handy method called method_missing which allows one to handle method calls for methods that have not even been (explicitly) defined: Invoked by Ruby when obj is sent a message it cannot handle. symbol is the symbol for the method called, and args are any arguments that were passed to it. By default, the interpreter raises an error when this method is called. However, it is possible to override the method to provide more dynamic behavior. The example below creates a class Roman, which responds to methods with names consisting of roman numerals, returning the corresponding integer values. class Roman def romanToInt(str) # ... end def method_missing(methId) str = methId.id2name romanToInt(str) end end r = Roman.new r.iv #=> 4 r.xxiii #=> 23 r.mm #=> 2000 For example, Ruby on Rails uses this to allow calls to methods such as find_by_my_column_name. My question is, what other languages support an equivalent to method_missing, and how do you implement the equivalent in your code?

    Read the article

  • How to force inclusion of an object file in a static library when linking into executable?

    - by Brian Bassett
    I have a C++ project that due to its directory structure is set up as a static library A, which is linked into shared library B, which is linked into executable C. (This is a cross-platform project using CMake, so on Windows we get A.lib, B.dll, and C.exe, and on Linux we get libA.a, libB.so, and C.) Library A has an init function (A_init, defined in A/initA.cpp), that is called from library B's init function (B_init, defined in B/initB.cpp), which is called from C's main. Thus, when linking B, A_init (and all symbols defined in initA.cpp) is linked into B (which is our desired behavior). The problem comes in that the A library also defines a function (Af, defined in A/Afort.f) that is intended to by dynamically loaded (i.e. LoadLibrary/GetProcAddress on Windows and dlopen/dlsym on Linux). Since there are no references to Af from library B, symbols from A/Afort.o are not included into B. On Windows, we can artifically create a reference by using the pragma: #pragma comment (linker, "/export:_Af") Since this is a pragma, it only works on Windows (using Visual Studio 2008). To get it working on Linux, we've tried adding the following to A/initA.cpp: extern void Af(void); static void (*Af_fp)(void) = &Af; This does not cause the symbol Af to be included in the final link of B. How can we force the symbol Af to be linked into B?

    Read the article

  • Randomly sorting an array

    - by Cam
    Does there exist an algorithm which, given an ordered list of symbols {a1, a2, a3, ..., ak}, produces in O(n) time a new list of the same symbols in a random order without bias? "Without bias" means the probability that any symbol s will end up in some position p in the list is 1/k. Assume it is possible to generate a non-biased integer from 1-k inclusive in O(1) time. Also assume that O(1) element access/mutation is possible, and that it is possible to create a new list of size k in O(k) time. In particular, I would be interested in a 'generative' algorithm. That is, I would be interested in an algorithm that has O(1) initial overhead, and then produces a new element for each slot in the list, taking O(1) time per slot. If no solution exists to the problem as described, I would still like to know about solutions that do not meet my constraints in one or more of the following ways (and/or in other ways if necessary): the time complexity is worse than O(n). the algorithm is biased with regards to the final positions of the symbols. the algorithm is not generative. I should add that this problem appears to be the same as the problem of randomly sorting the integers from 1-k, since we can sort the list of integers from 1-k and then for each integer i in the new list, we can produce the symbol ai.

    Read the article

  • Initializing static pointer in templated class.

    - by Anthony
    This is difficult for me to formulate in a Google query (at least one that gives me what I'm looking for) so I've had some trouble finding an answer. I'm sure I'm not the first to ask though. Consider a class like so: template < class T > class MyClass { private: static T staticObject; static T * staticPointerObject; }; ... template < class T > T MyClass<T>::staticObject; // <-- works ... template < class T > T * MyClass<T>::staticPointerObject = NULL; // <-- cannot find symbol staticPointerObject. I am having trouble figuring out why I cannot successfully create that pointer object. Edit: The above code is all specified in the header, and the issue I mentioned is an error in the link step, so it is not finding the specific symbol.

    Read the article

  • Howcome some C++ functions with unspecified linkage build with C linkage?

    - by christoffer
    This is something that makes me fairly perplexed. I have a C++ file that implements a set of functions, and a header file that defines prototypes for them. When building with Visual Studio or MingW-gcc, I get linking errors on two of the functions, and adding an 'extern "C"' qualifier resolved the error. How is this possible? Header file, "some_header.h": // Definition of struct DEMO_GLOBAL_DATA omitted DWORD WINAPI ThreadFunction(LPVOID lpData); void WriteLogString(void *pUserData, const char *pString, unsigned long nStringLen); void CheckValid(DEMO_GLOBAL_DATA *pData); int HandleStart(DEMO_GLOBAL_DATA * pDAta, TCHAR * pLogFileName); void HandleEnd(DEMO_GLOBAL_DATA *pData); C++ file, "some_implementation.cpp" #include "some_header.h" DWORD WINAPI ThreadFunction(LPVOID lpData) { /* omitted */ } void WriteLogString(void *pUserData, const char *pString, unsigned long nStringLen) { /* omitted */ } void CheckValid(DEMO_GLOBAL_DATA *pData) { /* omitted */ } int HandleStart(DEMO_GLOBAL_DATA * pDAta, TCHAR * pLogFileName) { /* omitted */ } void HandleEnd(DEMO_GLOBAL_DATA *pData) { /* omitted */ } The implementations compile without warnings, but when linking with the UI code that calls these, I get a normal error LNK2001: unresolved external symbol "int __cdecl HandleStart(struct _DEMO_GLOBAL_DATA *, wchar_t *) error LNK2001: unresolved external symbol "void __cdecl CheckValid(struct _DEMO_MAIN_GLOBAL_DATA * What really confuses me, now, is that only these two functions (HandleStart and CheckValid) seems to be built with C linkage. Explicitly adding "extern 'C'" declarations for only these two resolved the linking error, and the application builds and runs. Adding "extern 'C'" on some other function, such as HandleEnd, introduces a new linking error, so that one is obviously compiled correctly. The implementation file is never modified in any of this, only the prototypes.

    Read the article

  • VS2010 final does only link project on "rebuild all", not on "build changed"

    - by Sam
    I've just migrated a solution containing c++ and c# projects from VS2008 to VS2010 and got a strange problem. When I select "rebuild all", everything compiles and links as I would expect it to do. Then I change some c++ source file (just add a space), build the project, I get several thousands of linking errors like these: GDlgPackerListe.obj : error LNK2028: Nicht aufgelöstes Token (0A0000C7) ""public: bool __thiscall LList::Add(class LBString const &)" (?Add@LList@@$$FQAE_NABVLBString@@@Z)", auf das in Funktion ""public: virtual void __thiscall LRcPackerListe::HookRunReport(class LFortschritt &)" (?HookRunReport@LRcPackerListe@@$$FUAEXAAVLFortschritt@@@Z)" verwiesen wird. Db_Lieferschein2.obj : error LNK2020: Nicht aufgelöstes Token (0A0000E6) "public: bool __thiscall LList::Add(class LBString const &)" (?Add@LList@@$$FQAE_NABVLBString@@@Z). bmed.obj : error LNK2028: Nicht aufgelöstes Token (0A00014D) ""public: bool __thiscall LList::Add(class LBString const &)" (?Add@LList@@$$FQAE_NABVLBString@@@Z)", auf das in Funktion ""public: virtual long __thiscall MENUKB::Methode(long,long)" (?Methode@MENUKB@@$$FUAEJJJ@Z)" verwiesen wird. GDlgPackerListe.obj : error LNK2028: Nicht aufgelöstes Token (0A0000C9) ""public: void __thiscall LList::Sort(void)" (?Sort@LList@@$$FQAEXXZ)", auf das in Funktion ""public: virtual void __thiscall LRcPackerListe::HookRunReport(class LFortschritt &)" (?HookRunReport@LRcPackerListe@@$$FUAEXAAVLFortschritt@@@Z)" verwiesen wird. Dlg_Gutschrift.obj : error LNK2020: Nicht aufgelöstes Token (0A000128) "public: virtual __thiscall LBaseType::~LBaseType(void)" (??1LBaseType@@$$FUAE@XZ). Module_Damals.lib(svSuchAltLink.obj) : error LNK2001: Nicht aufgelöstes externes Symbol ""public: __thiscall SView::SView(void)" (??0SView@@QAE@XZ)". Module_Damals.lib(svShowEMF.obj) : error LNK2001: Nicht aufgelöstes externes Symbol ""public: virtual void __thiscall SView::HookValueChanged(unsigned __int64)" (?HookValueChanged@SView@@UAEX_K@Z)". When I hit "rebuild all" it recompiles and links without any errors or even warnings and produces a working exe. I'm using Visual Studio 2010 final (german edition). Whats going on here? Or, more important: how do I get the linker to work correctly??

    Read the article

  • Importing a C DLL's functions into a C++ program

    - by bobobobo
    I have a 3rd party library that's written in C. It exports all of its functions to a DLL. I have the .h file, and I'm trying to load the DLL from my C++ program. The first thing I tried was surrounding the parts where I #include the 3rd party lib in #ifdef __cplusplus extern "C" { #endif and, at the end #ifdef __cplusplus } // extern "C" #endif But the problem there was, all of the DLL file function linkage looked like this in their header files: a_function = (void *)GetProcAddress(dll, "a_function"); While really a_function had type int (*a_function) (int *). Apparently MSVC++ compiler doesn't like this, while MSVC compiler does not seem to mind. So I went through (brutal torture) and fixed them all to the pattern typedef int (*_a_function) (int *); _a_function a_function ; Then, to link it to the DLL code, in main(): a_function = (_a_function)GetProcAddress(dll, "a_function"); This SEEMS to make the compiler MUCH, MUCH happier, but it STILL complains with this final set of 143 errors, each saying for each of the DLL link attempts: error LNK2005: _a_function already defined in main.obj main.obj Multiple symbol definition errors.. sounds like a job for extern! SO I went and made ALL the function pointer declarations as follows: function_pointers.h typedef int (*_a_function) (int *); extern _a_function a_function ; And in a cpp file: function_pointers.cpp #include "function_pointers.h" _a_function a_function ; ALL fine and dandy.. except for linker errors now of the form: error LNK2001: unresolved external symbol _a_function main.obj Main.cpp includes "function_pointers.h", so it should know where to find each of the functions.. I am bamboozled. Does any one have any pointers to get me functional? (Pardon the pun..)

    Read the article

  • C++: Conceptual problem in designing an intepreter

    - by sub
    I'm programming an interpreter for an experimental programming language (educational, fun,...) So far, everything went well (Tokenizer & Parser), but I'm getting a huge problem with some of the data structures in the part that actually runs the tokenized and parsed code. My programming language basically has only two types, int and string, and they are represented as C++ strings (std class) and ints Here is a short version of the data structure that I use to pass values around: enum DataType { Null, Int, String } class Symbol { public: string identifier; DataType type; string stringValue; int intValue; } I can't use union because string doesn't allow me to. This structure above is beginning to give me a headache. I have to scatter code like this everywhere in order to make it work, it is beginning to grow unmaintainable: if( mySymbol.type == Int ) { mySymbol.intValue = 1234; } else { mySymbol.stringValue = "abcde"; } I use the Symbol data structure for variables, return values for functions and general representation of values in the programming language. Is there any better way to solve this? I hope so!

    Read the article

  • Why does Java think my object is a variable?

    - by user2896898
    Ok so I'm trying to make a simple pong game. I have a paddle that follows the mouse and a ball that bounces around. I wrote a method collidesWith(Sprite s) inside of my Sprite class that checks if the ball collides with the paddle (this works and isn't the problem). I have two objects extending my sprite class, a ball and a paddle object. So inside of my ball class I'm trying to check if it collides with the paddle. So I've tried if(this.collidesWith(paddle) == true){ System.out.println("They touched"); } I've also tried ball.collidesWith(paddle) and other combinations but it always says the same thing about the paddle (and the ball when I use ball.collidesWith) "Cannot find symbol. Symbol: variable paddle(or ball). Location: class Ball" So if I'm reading this right, it thinks that the paddle (and ball) are variables and it's complaining because it can't find them. How can I make it understand I am passing in objects, not variables? For extra information, an earlier assignment had me make two boxes and for them to change colors when they were colliding. In that assignment I used very similar code to above with if(boxOne.collidesWith(boxTwo) == true){ System.out.println("yes"); } And in this code it worked just fine. The program knew that boxOne and boxTwo were child classes of my Sprite class. Anyone know why they wouldn't work the same?

    Read the article

  • jQuery Globalization Plugin from Microsoft

    - by ScottGu
    Last month I blogged about how Microsoft is starting to make code contributions to jQuery, and about some of the first code contributions we were working on: jQuery Templates and Data Linking support. Today, we released a prototype of a new jQuery Globalization Plugin that enables you to add globalization support to your JavaScript applications. This plugin includes globalization information for over 350 cultures ranging from Scottish Gaelic, Frisian, Hungarian, Japanese, to Canadian English.  We will be releasing this plugin to the community as open-source. You can download our prototype for the jQuery Globalization plugin from our Github repository: http://github.com/nje/jquery-glob You can also download a set of samples that demonstrate some simple use-cases with it here. Understanding Globalization The jQuery Globalization plugin enables you to easily parse and format numbers, currencies, and dates for different cultures in JavaScript. For example, you can use the Globalization plugin to display the proper currency symbol for a culture: You also can use the Globalization plugin to format dates so that the day and month appear in the right order and the day and month names are correctly translated: Notice above how the Arabic year is displayed as 1431. This is because the year has been converted to use the Arabic calendar. Some cultural differences, such as different currency or different month names, are obvious. Other cultural differences are surprising and subtle. For example, in some cultures, the grouping of numbers is done unevenly. In the "te-IN" culture (Telugu in India), groups have 3 digits and then 2 digits. The number 1000000 (one million) is written as "10,00,000". Some cultures do not group numbers at all. All of these subtle cultural differences are handled by the jQuery Globalization plugin automatically. Getting dates right can be especially tricky. Different cultures have different calendars such as the Gregorian and UmAlQura calendars. A single culture can even have multiple calendars. For example, the Japanese culture uses both the Gregorian calendar and a Japanese calendar that has eras named after Japanese emperors. The Globalization Plugin includes methods for converting dates between all of these different calendars. Using Language Tags The jQuery Globalization plugin uses the language tags defined in the RFC 4646 and RFC 5646 standards to identity cultures (see http://tools.ietf.org/html/rfc5646). A language tag is composed out of one or more subtags separated by hyphens. For example: Language Tag Language Name (in English) en-AU English (Australia) en-BZ English (Belize) en-CA English (Canada) Id Indonesian zh-CHS Chinese (Simplified) Legacy Zu isiZulu Notice that a single language, such as English, can have several language tags. Speakers of English in Canada format numbers, currencies, and dates using different conventions than speakers of English in Australia or the United States. You can find the language tag for a particular culture by using the Language Subtag Lookup tool located here:  http://rishida.net/utils/subtags/ The jQuery Globalization plugin download includes a folder named globinfo that contains the information for each of the 350 cultures. Actually, this folder contains more than 700 files because the folder includes both minified and un-minified versions of each file. For example, the globinfo folder includes JavaScript files named jQuery.glob.en-AU.js for English Australia, jQuery.glob.id.js for Indonesia, and jQuery.glob.zh-CHS for Chinese (Simplified) Legacy. Example: Setting a Particular Culture Imagine that you have been asked to create a German website and want to format all of the dates, currencies, and numbers using German formatting conventions correctly in JavaScript on the client. The HTML for the page might look like this: Notice the span tags above. They mark the areas of the page that we want to format with the Globalization plugin. We want to format the product price, the date the product is available, and the units of the product in stock. To use the jQuery Globalization plugin, we’ll add three JavaScript files to the page: the jQuery library, the jQuery Globalization plugin, and the culture information for a particular language: In this case, I’ve statically added the jQuery.glob.de-DE.js JavaScript file that contains the culture information for German. The language tag “de-DE” is used for German as spoken in Germany. Now that I have all of the necessary scripts, I can use the Globalization plugin to format the product price, date available, and units in stock values using the following client-side JavaScript: The jQuery Globalization plugin extends the jQuery library with new methods - including new methods named preferCulture() and format(). The preferCulture() method enables you to set the default culture used by the jQuery Globalization plugin methods. Notice that the preferCulture() method accepts a language tag. The method will find the closest culture that matches the language tag. The $.format() method is used to actually format the currencies, dates, and numbers. The second parameter passed to the $.format() method is a format specifier. For example, passing “c” causes the value to be formatted as a currency. The ReadMe file at github details the meaning of all of the various format specifiers: http://github.com/nje/jquery-glob When we open the page in a browser, everything is formatted correctly according to German language conventions. A euro symbol is used for the currency symbol. The date is formatted using German day and month names. Finally, a period instead of a comma is used a number separator: You can see a running example of the above approach with the 3_GermanSite.htm file in this samples download. Example: Enabling a User to Dynamically Select a Culture In the previous example we explicitly said that we wanted to globalize in German (by referencing the jQuery.glob.de-DE.js file). Let’s now look at the first of a few examples that demonstrate how to dynamically set the globalization culture to use. Imagine that you want to display a dropdown list of all of the 350 cultures in a page. When someone selects a culture from the dropdown list, you want all of the dates in the page to be formatted using the selected culture. Here’s the HTML for the page: Notice that all of the dates are contained in a <span> tag with a data-date attribute (data-* attributes are a new feature of HTML 5 that conveniently also still work with older browsers). We’ll format the date represented by the data-date attribute when a user selects a culture from the dropdown list. In order to display dates for any possible culture, we’ll include the jQuery.glob.all.js file like this: The jQuery Globalization plugin includes a JavaScript file named jQuery.glob.all.js. This file contains globalization information for all of the more than 350 cultures supported by the Globalization plugin.  At 367KB minified, this file is not small. Because of the size of this file, unless you really need to use all of these cultures at the same time, we recommend that you add the individual JavaScript files for particular cultures that you intend to support instead of the combined jQuery.glob.all.js to a page. In the next sample I’ll show how to dynamically load just the language files you need. Next, we’ll populate the dropdown list with all of the available cultures. We can use the $.cultures property to get all of the loaded cultures: Finally, we’ll write jQuery code that grabs every span element with a data-date attribute and format the date: The jQuery Globalization plugin’s parseDate() method is used to convert a string representation of a date into a JavaScript date. The plugin’s format() method is used to format the date. The “D” format specifier causes the date to be formatted using the long date format. And now the content will be globalized correctly regardless of which of the 350 languages a user visiting the page selects.  You can see a running example of the above approach with the 4_SelectCulture.htm file in this samples download. Example: Loading Globalization Files Dynamically As mentioned in the previous section, you should avoid adding the jQuery.glob.all.js file to a page whenever possible because the file is so large. A better alternative is to load the globalization information that you need dynamically. For example, imagine that you have created a dropdown list that displays a list of languages: The following jQuery code executes whenever a user selects a new language from the dropdown list. The code checks whether the globalization file associated with the selected language has already been loaded. If the globalization file has not been loaded then the globalization file is loaded dynamically by taking advantage of the jQuery $.getScript() method. The globalizePage() method is called after the requested globalization file has been loaded, and contains the client-side code to perform the globalization. The advantage of this approach is that it enables you to avoid loading the entire jQuery.glob.all.js file. Instead you only need to load the files that you need and you don’t need to load the files more than once. The 5_Dynamic.htm file in this samples download demonstrates how to implement this approach. Example: Setting the User Preferred Language Automatically Many websites detect a user’s preferred language from their browser settings and automatically use it when globalizing content. A user can set a preferred language for their browser. Then, whenever the user requests a page, this language preference is included in the request in the Accept-Language header. When using Microsoft Internet Explorer, you can set your preferred language by following these steps: Select the menu option Tools, Internet Options. Select the General tab. Click the Languages button in the Appearance section. Click the Add button to add a new language to the list of languages. Move your preferred language to the top of the list. Notice that you can list multiple languages in the Language Preference dialog. All of these languages are sent in the order that you listed them in the Accept-Language header: Accept-Language: fr-FR,id-ID;q=0.7,en-US;q=0.3 Strangely, you cannot retrieve the value of the Accept-Language header from client JavaScript. Microsoft Internet Explorer and Mozilla Firefox support a bevy of language related properties exposed by the window.navigator object, such as windows.navigator.browserLanguage and window.navigator.language, but these properties represent either the language set for the operating system or the language edition of the browser. These properties don’t enable you to retrieve the language that the user set as his or her preferred language. The only reliable way to get a user’s preferred language (the value of the Accept-Language header) is to write server code. For example, the following ASP.NET page takes advantage of the server Request.UserLanguages property to assign the user’s preferred language to a client JavaScript variable named acceptLanguage (which then allows you to access the value using client-side JavaScript): In order for this code to work, the culture information associated with the value of acceptLanguage must be included in the page. For example, if someone’s preferred culture is fr-FR (French in France) then you need to include either the jQuery.glob.fr-FR.js or the jQuery.glob.all.js JavaScript file in the page or the culture information won’t be available.  The “6_AcceptLanguages.aspx” sample in this samples download demonstrates how to implement this approach. If the culture information for the user’s preferred language is not included in the page then the $.preferCulture() method will fall back to using the neutral culture (for example, using jQuery.glob.fr.js instead of jQuery.glob.fr-FR.js). If the neutral culture information is not available then the $.preferCulture() method falls back to the default culture (English). Example: Using the Globalization Plugin with the jQuery UI DatePicker One of the goals of the Globalization plugin is to make it easier to build jQuery widgets that can be used with different cultures. We wanted to make sure that the jQuery Globalization plugin could work with existing jQuery UI plugins such as the DatePicker plugin. To that end, we created a patched version of the DatePicker plugin that can take advantage of the Globalization plugin when rendering a calendar. For example, the following figure illustrates what happens when you add the jQuery Globalization and the patched jQuery UI DatePicker plugin to a page and select Indonesian as the preferred culture: Notice that the headers for the days of the week are displayed using Indonesian day name abbreviations. Furthermore, the month names are displayed in Indonesian. You can download the patched version of the jQuery UI DatePicker from our github website. Or you can use the version included in this samples download and used by the 7_DatePicker.htm sample file. Summary I’m excited about our continuing participation in the jQuery community. This Globalization plugin is the third jQuery plugin that we’ve released. We’ve really appreciated all of the great feedback and design suggestions on the jQuery templating and data-linking prototypes that we released earlier this year.  We also want to thank the jQuery and jQuery UI teams for working with us to create these plugins. Hope this helps, Scott P.S. In addition to blogging, I am also now using Twitter for quick updates and to share links. You can follow me at: twitter.com/scottgu

    Read the article

  • How can I get LibreOffice to 'number' footnotes in the order *, †, ‡, § etc.?

    - by einpoklum
    With LaTeX, I can do: \documentclass[10pt]{article} \usepackage[symbol*]{footmisc} \begin{document} One\footnote{f1} Two \footnote{f2} Three \footnote{f3} Four \footnote{f4} \end{document} And get *, †, ‡, § ... as consecutive footnote markers. MS-Word has this feature too - an alternative footnote numbering scheme. How can I achieve the same with LibreOffice? PS - Shouldn't the OpenOffice and LibreOffice tags be merged?

    Read the article

  • SVN configuration problem

    - by Sreeraj
    Configured the SVN with httpd service including below modules but it gives an error as below: LoadModule dav_svn_module /usr/lib/httpd/modules/mod_dav_svn.so LoadModule authz_svn_module /usr/lib/httpd/modules/mod_authz_svn.so error: Starting httpd: httpd: Syntax error on line 206 of /etc/httpd/conf/httpd.conf: Cannot load /usr/lib/httpd/modules/mod_dav_svn.so into server: /usr/lib/httpd/modules/mod_dav_svn.so: undefined symbol: svn_mergeinfo__remove_prefix_from_catalog Server version: Apache/2.2.3 Server built: Nov 12 2008 07:09:27 RHEL 5.4 - 32 bit How would you troubleshoot this error message?

    Read the article

  • Visual Studio Project build Error [closed]

    - by Mina Sobhy
    I installed Visual Studio 2010 on Windows7 SP1 but a debug error occurs: 1>------ Build started: Project: x, Configuration: Debug Win32 ------ 1>MSVCRTD.lib(crtexe.obj) : error LNK2019: unresolved external symbol main referenced in function __tmainCRTStartup 1>C:\Users\mina\Documents\Visual Studio 2010\Projects\x\Debug\x.exe : fatal error LNK1120: 1 unresolved externals ========== Build: 0 succeeded, 1 failed, 0 up-to-date, 0 skipped ==========

    Read the article

  • How to check if Emacs is in GUI mode (and execute `tool-bar-mode` only then)?

    - by dehmann
    I have this line in my .emacs file: (tool-bar-mode 0) because I hate the toolbars in my GUI emacs (/Applications/Emacs.app/Contents/MacOS/Emacs). But when I start up my other, text-based emacs in the terminal (/opt/local/bin/emacs) it complains about that command: Symbol's function definition is void: tool-bar-mode How can I add an if condition so that it executes the tool-bar-mode command only when I'm in the GUI emacs? Thanks!

    Read the article

  • Logitech keboard wrong keys under MAC OSX

    - by David Casillas
    I have a Logitech MK250 keyboard I use with my Macbook. One day the "minor/mayor than" and the "back slash" keys flip their functionality, so I have to hit "backslash" to get a "minor than" symbol and press the "alt + minor than" key to get the "backslash". Is there any way to reverse this annoying behavior? I often switch to Windows, where the keys work the expected way, and I'm always missing the right key.

    Read the article

  • Multiline code in Word 2007

    - by WaelJ
    I am using word 2007 and am inserting code into the document. I have a style with a fixed-width font and light grey background and all, and I use Notepad++ for syntax highlighting. My problem is with a "line" of code that is too long to display, so is there a way to auto-insert an arrow symbol at the beginning of a such lines to indicate that it is the same line (kind of like hyphenating, except on long lines instead of long words) So for e.g. something like this: public static void foo(String abcdefg, Boolean 123, ?String xyz)

    Read the article

  • Apache Error Upgrading to PHP 5.5

    - by user195385
    I am trying to upgrade php and received this error at the command line: httpd: Syntax error on line 493 of /private/etc/apache2/httpd.conf: Syntax error on line 8 of /private/etc/apache2/other/+php-osx.conf: Cannot load /usr/local/php5/libphp5.so into server: dlopen(/usr/local/php5/libphp5.so, 10): Symbol not found: _libiconv\n Referenced from: /usr/local/php5/lib/libintl.8.dylib\n Expected in: /usr/lib/libiconv.2.dylib\n in /usr/local/php5/lib/libintl.8.dylib I was trying to upgrade at http://php-osx.liip.ch/ using the command: curl -s http://php-osx.liip.ch/install.sh | bash -s 5.5 Any help would be appreciated!

    Read the article

  • Can't start apache in linux, because of proxy module

    - by Silmaril89
    When I try to start apache or run the command, httpd -M each fail and print the following error: httpd: Syntax error on line 137 of /etc/httpd/conf/httpd.conf: Syntax error on line 2 of /etc/httpd/conf.d/proxy_ajp.conf: Cannot load /etc/httpd/modules/mod_proxy_ajp.so into server: /etc/httpd/modules/mod_proxy_ajp.so: undefined symbol: proxy_module Any ideas on how to fix this? Thanks.

    Read the article

  • windows server 2008 r2 remote desktop issue with roaming clients

    - by Patrick D'Haese
    I have the following situation : a Dell windows server 2008 R2 computer, with remote desktop services installed. I have installed a java application making use of a PostgreSql database, and made this application available for clients using RDP. Clients are standard Win XP pc's and Psion Neo handheld devices running Windows CE 5 Pro. The application works fine for clients on standard XP pc's connected directly via cat 5E Ethernet cable to a Dell Powerconnect 2816 switch. The Psion Neo clients connect wireless to the network via Motorola AP6532 access points. These access points are connected via a POE adapter to the same switch as the XP pc's. The Psion devices can connect without any problem and very quickly to the server and to the application using RDP. So far, so good. When the Psion devices move around in the warehouse, and they roam from one access point to the other, the RDP session on the client freezes for approx 1 minute, and then it automatically resumes the session. This freezing is very annoying for the users. Can anyone help in solving this issue? Update (August 9) : After re-installing the access points we have a working situation, but only when connecting to the RDP host : * via a Win Xp SP3 laptop * via a Symbol MC9190 Win CE 6 mobile device When roaming we notice a small hick-up less then 1 second, what is very acceptable. With the Psion NEO it's still not working, when roaming the screen freezes from 2 to 30 seconds. The RDP client on the win xp sp3 laptop and the symbol mc9190 is version 6.0. The RDP client on the neo is version 5.2. I have changed the security layer on the RDP host to RDP security layer (based on forums on the internet), because older RDP clients seem to have issues with the RDP 7.1 protocol on the Win server 2088 R2. Psion adviced us to do some network logging activity on the different devices. We made this logging via wireshark, and based on this the conclusion of Psion is that the server fails in handling tcp-requests. Can anyone give me a second opinion by analysing the wireshark loggings. Thanks in advance. Regards Patrick

    Read the article

  • windows misconfigured keyboard after installing usb keyboard

    - by goliatone
    have a dell vostro 1520, installed an external usb keyboard which works fine but the laptop's keyboard does not work properly. in the log in screen everything works as it should, once logged in the keyboard breaks. keys that have an alternate symbol accessible with the FN key render it by default. Meaning i have to press the FN key for it to render the proper ones- p has the * as FN, in order to get the p i have to press p+FN.

    Read the article

  • Complications registering a punycode domain name

    - by chaz
    Not sure if any of you have experience with this, but I am trying to include the anchor (?) in my domain name (using the appropriate punycode to allow it) but upon registering it I encounter the error that the symbol is not supported by the language I have chosen. Does anyone know what language would support this if I were to continue or even how I would go about doing so or if i can even do so. Thanks

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

< Previous Page | 25 26 27 28 29 30 31 32 33 34 35 36  | Next Page >