Search Results

Search found 44510 results on 1781 pages for 'text mode'.

Page 29/1781 | < Previous Page | 25 26 27 28 29 30 31 32 33 34 35 36  | Next Page >

  • Text extra aliased(jagged) in IE - looks terrible - but OK in FF and Chrome

    - by jon
    I am building a website - http://www.efficaxdevelopment.com As you can see when you load the page(in IE) the text on the page that isn't an image or the menu looks terrible, while in FF and Chrome the text looks fine. you can view the source on the page and the css is here http://www.efficaxdevelopment.com/styles/mainstyle.css Also, the sliding bar over the menu appears a few pixels left of where it appears in FF and IE. Any ideas?

    Read the article

  • Errors when installing Open Office

    - by user109036
    I followed the first set of instructions on this page to install Open Office: How to install Open Office? However, the last step which says to change the CHMOD of a folder, I got an error saying that the directory does not exist. Open Office now appears in my Ubuntu start menu, but clicking on it does nothing. I tried a reboot. Below is what I could copy from my terminal. I am running the latest Ubuntu. I have not uninstalled Libreoffice as suggested somewhere. The reason is that in the Ubuntu software centre, Libre office appears to be made up of several components and I don't know which ones to remove (or all maybe?). They are Libreoffice Draw, Math, Writer, Calc. After this operation, 480 MB of additional disk space will be used. Do you want to continue [Y/n]? y Get:1 http://gb.archive.ubuntu.com/ubuntu/ quantal-updates/universe openjdk-6-jre-lib all 6b24-1.11.5-0ubuntu1~12.10.1 [6,135 kB] Get:2 http://ppa.launchpad.net/upubuntu-com/office/ubuntu/ quantal/main openoffice amd64 3.4~oneiric [321 MB] Get:3 http://gb.archive.ubuntu.com/ubuntu/ quantal/main ca-certificates-java all 20120721 [13.2 kB] Get:4 http://gb.archive.ubuntu.com/ubuntu/ quantal/main tzdata-java all 2012e-0ubuntu2 [140 kB] Get:5 http://gb.archive.ubuntu.com/ubuntu/ quantal/main java-common all 0.43ubuntu3 [61.7 kB] Get:6 http://gb.archive.ubuntu.com/ubuntu/ quantal-updates/universe openjdk-6-jre-headless amd64 6b24-1.11.5-0ubuntu1~12.10.1 [25.4 MB] Get:7 http://gb.archive.ubuntu.com/ubuntu/ quantal/main libgif4 amd64 4.1.6-9.1ubuntu1 [31.3 kB] Get:8 http://gb.archive.ubuntu.com/ubuntu/ quantal-updates/universe openjdk-6-jre amd64 6b24-1.11.5-0ubuntu1~12.10.1 [234 kB] Get:9 http://gb.archive.ubuntu.com/ubuntu/ quantal/main libatk-wrapper-java all 0.30.4-0ubuntu4 [29.8 kB] Get:10 http://gb.archive.ubuntu.com/ubuntu/ quantal/main libatk-wrapper-java-jni amd64 0.30.4-0ubuntu4 [31.1 kB] Get:11 http://gb.archive.ubuntu.com/ubuntu/ quantal/main xorg-sgml-doctools all 1:1.10-1 [12.0 kB] Get:12 http://gb.archive.ubuntu.com/ubuntu/ quantal/main x11proto-core-dev all 7.0.23-1 [744 kB] Get:13 http://gb.archive.ubuntu.com/ubuntu/ quantal/main libice-dev amd64 2:1.0.8-2 [57.6 kB] Get:14 http://gb.archive.ubuntu.com/ubuntu/ quantal/main libpthread-stubs0 amd64 0.3-3 [3,258 B] Get:15 http://gb.archive.ubuntu.com/ubuntu/ quantal/main libpthread-stubs0-dev amd64 0.3-3 [2,866 B] Get:16 http://gb.archive.ubuntu.com/ubuntu/ quantal/main libsm-dev amd64 2:1.2.1-2 [19.9 kB] Get:17 http://gb.archive.ubuntu.com/ubuntu/ quantal/main libxau-dev amd64 1:1.0.7-1 [10.2 kB] Get:18 http://gb.archive.ubuntu.com/ubuntu/ quantal/main libxdmcp-dev amd64 1:1.1.1-1 [26.9 kB] Get:19 http://gb.archive.ubuntu.com/ubuntu/ quantal/main x11proto-input-dev all 2.2-1 [133 kB] Get:20 http://gb.archive.ubuntu.com/ubuntu/ quantal/main x11proto-kb-dev all 1.0.6-2 [269 kB] Get:21 http://gb.archive.ubuntu.com/ubuntu/ quantal/main xtrans-dev all 1.2.7-1 [84.3 kB] Get:22 http://gb.archive.ubuntu.com/ubuntu/ quantal/main libxcb1-dev amd64 1.8.1-1ubuntu1 [82.6 kB] Get:23 http://gb.archive.ubuntu.com/ubuntu/ quantal/main libx11-dev amd64 2:1.5.0-1 [912 kB] Get:24 http://gb.archive.ubuntu.com/ubuntu/ quantal/main libx11-doc all 2:1.5.0-1 [2,460 kB] Get:25 http://gb.archive.ubuntu.com/ubuntu/ quantal/main libxt-dev amd64 1:1.1.3-1 [492 kB] Get:26 http://gb.archive.ubuntu.com/ubuntu/ quantal/main ttf-dejavu-extra all 2.33-2ubuntu1 [3,420 kB] Get:27 http://gb.archive.ubuntu.com/ubuntu/ quantal-updates/universe icedtea-6-jre-cacao amd64 6b24-1.11.5-0ubuntu1~12.10.1 [417 kB] Get:28 http://gb.archive.ubuntu.com/ubuntu/ quantal-updates/universe icedtea-6-jre-jamvm amd64 6b24-1.11.5-0ubuntu1~12.10.1 [581 kB] Get:29 http://gb.archive.ubuntu.com/ubuntu/ quantal-updates/main icedtea-netx-common all 1.3-1ubuntu1.1 [617 kB] Get:30 http://gb.archive.ubuntu.com/ubuntu/ quantal-updates/main icedtea-netx amd64 1.3-1ubuntu1.1 [16.2 kB] Get:31 http://gb.archive.ubuntu.com/ubuntu/ quantal-updates/universe openjdk-6-jdk amd64 6b24-1.11.5-0ubuntu1~12.10.1 [11.1 MB] Fetched 374 MB in 9min 18s (671 kB/s) Extract templates from packages: 100% Selecting previously unselected package openjdk-6-jre-lib. (Reading database ... 143191 files and directories currently installed.) Unpacking openjdk-6-jre-lib (from .../openjdk-6-jre-lib_6b24-1.11.5-0ubuntu1~12.10.1_all.deb) ... Selecting previously unselected package ca-certificates-java. Unpacking ca-certificates-java (from .../ca-certificates-java_20120721_all.deb) ... Selecting previously unselected package tzdata-java. Unpacking tzdata-java (from .../tzdata-java_2012e-0ubuntu2_all.deb) ... Selecting previously unselected package java-common. Unpacking java-common (from .../java-common_0.43ubuntu3_all.deb) ... Selecting previously unselected package openjdk-6-jre-headless:amd64. Unpacking openjdk-6-jre-headless:amd64 (from .../openjdk-6-jre-headless_6b24-1.11.5-0ubuntu1~12.10.1_amd64.deb) ... Selecting previously unselected package libgif4:amd64. Unpacking libgif4:amd64 (from .../libgif4_4.1.6-9.1ubuntu1_amd64.deb) ... Selecting previously unselected package openjdk-6-jre:amd64. Unpacking openjdk-6-jre:amd64 (from .../openjdk-6-jre_6b24-1.11.5-0ubuntu1~12.10.1_amd64.deb) ... Selecting previously unselected package libatk-wrapper-java. Unpacking libatk-wrapper-java (from .../libatk-wrapper-java_0.30.4-0ubuntu4_all.deb) ... Selecting previously unselected package libatk-wrapper-java-jni:amd64. Unpacking libatk-wrapper-java-jni:amd64 (from .../libatk-wrapper-java-jni_0.30.4-0ubuntu4_amd64.deb) ... Selecting previously unselected package xorg-sgml-doctools. Unpacking xorg-sgml-doctools (from .../xorg-sgml-doctools_1%3a1.10-1_all.deb) ... Selecting previously unselected package x11proto-core-dev. Unpacking x11proto-core-dev (from .../x11proto-core-dev_7.0.23-1_all.deb) ... Selecting previously unselected package libice-dev:amd64. Unpacking libice-dev:amd64 (from .../libice-dev_2%3a1.0.8-2_amd64.deb) ... Selecting previously unselected package libpthread-stubs0:amd64. Unpacking libpthread-stubs0:amd64 (from .../libpthread-stubs0_0.3-3_amd64.deb) ... Selecting previously unselected package libpthread-stubs0-dev:amd64. Unpacking libpthread-stubs0-dev:amd64 (from .../libpthread-stubs0-dev_0.3-3_amd64.deb) ... Selecting previously unselected package libsm-dev:amd64. Unpacking libsm-dev:amd64 (from .../libsm-dev_2%3a1.2.1-2_amd64.deb) ... Selecting previously unselected package libxau-dev:amd64. Unpacking libxau-dev:amd64 (from .../libxau-dev_1%3a1.0.7-1_amd64.deb) ... Selecting previously unselected package libxdmcp-dev:amd64. Unpacking libxdmcp-dev:amd64 (from .../libxdmcp-dev_1%3a1.1.1-1_amd64.deb) ... Selecting previously unselected package x11proto-input-dev. Unpacking x11proto-input-dev (from .../x11proto-input-dev_2.2-1_all.deb) ... Selecting previously unselected package x11proto-kb-dev. Unpacking x11proto-kb-dev (from .../x11proto-kb-dev_1.0.6-2_all.deb) ... Selecting previously unselected package xtrans-dev. Unpacking xtrans-dev (from .../xtrans-dev_1.2.7-1_all.deb) ... Selecting previously unselected package libxcb1-dev:amd64. Unpacking libxcb1-dev:amd64 (from .../libxcb1-dev_1.8.1-1ubuntu1_amd64.deb) ... Selecting previously unselected package libx11-dev:amd64. Unpacking libx11-dev:amd64 (from .../libx11-dev_2%3a1.5.0-1_amd64.deb) ... Selecting previously unselected package libx11-doc. Unpacking libx11-doc (from .../libx11-doc_2%3a1.5.0-1_all.deb) ... Selecting previously unselected package libxt-dev:amd64. Unpacking libxt-dev:amd64 (from .../libxt-dev_1%3a1.1.3-1_amd64.deb) ... Selecting previously unselected package ttf-dejavu-extra. Unpacking ttf-dejavu-extra (from .../ttf-dejavu-extra_2.33-2ubuntu1_all.deb) ... Selecting previously unselected package icedtea-6-jre-cacao:amd64. Unpacking icedtea-6-jre-cacao:amd64 (from .../icedtea-6-jre-cacao_6b24-1.11.5-0ubuntu1~12.10.1_amd64.deb) ... Selecting previously unselected package icedtea-6-jre-jamvm:amd64. Unpacking icedtea-6-jre-jamvm:amd64 (from .../icedtea-6-jre-jamvm_6b24-1.11.5-0ubuntu1~12.10.1_amd64.deb) ... Selecting previously unselected package icedtea-netx-common. Unpacking icedtea-netx-common (from .../icedtea-netx-common_1.3-1ubuntu1.1_all.deb) ... Selecting previously unselected package icedtea-netx:amd64. Unpacking icedtea-netx:amd64 (from .../icedtea-netx_1.3-1ubuntu1.1_amd64.deb) ... Selecting previously unselected package openjdk-6-jdk:amd64. Unpacking openjdk-6-jdk:amd64 (from .../openjdk-6-jdk_6b24-1.11.5-0ubuntu1~12.10.1_amd64.deb) ... Selecting previously unselected package openoffice. Unpacking openoffice (from .../openoffice_3.4~oneiric_amd64.deb) ... Processing triggers for doc-base ... Processing 2 added doc-base files... Processing triggers for man-db ... Processing triggers for desktop-file-utils ... Processing triggers for bamfdaemon ... Rebuilding /usr/share/applications/bamf.index... Processing triggers for gnome-menus ... Processing triggers for hicolor-icon-theme ... Processing triggers for fontconfig ... Processing triggers for gnome-icon-theme ... Processing triggers for shared-mime-info ... Setting up tzdata-java (2012e-0ubuntu2) ... Setting up java-common (0.43ubuntu3) ... Setting up libgif4:amd64 (4.1.6-9.1ubuntu1) ... Setting up xorg-sgml-doctools (1:1.10-1) ... Setting up x11proto-core-dev (7.0.23-1) ... Setting up libice-dev:amd64 (2:1.0.8-2) ... Setting up libpthread-stubs0:amd64 (0.3-3) ... Setting up libpthread-stubs0-dev:amd64 (0.3-3) ... Setting up libsm-dev:amd64 (2:1.2.1-2) ... Setting up libxau-dev:amd64 (1:1.0.7-1) ... Setting up libxdmcp-dev:amd64 (1:1.1.1-1) ... Setting up x11proto-input-dev (2.2-1) ... Setting up x11proto-kb-dev (1.0.6-2) ... Setting up xtrans-dev (1.2.7-1) ... Setting up libxcb1-dev:amd64 (1.8.1-1ubuntu1) ... Setting up libx11-dev:amd64 (2:1.5.0-1) ... Setting up libx11-doc (2:1.5.0-1) ... Setting up libxt-dev:amd64 (1:1.1.3-1) ... Setting up ttf-dejavu-extra (2.33-2ubuntu1) ... Setting up icedtea-netx-common (1.3-1ubuntu1.1) ... Setting up openjdk-6-jre-lib (6b24-1.11.5-0ubuntu1~12.10.1) ... Setting up openjdk-6-jre-headless:amd64 (6b24-1.11.5-0ubuntu1~12.10.1) ... update-alternatives: using /usr/lib/jvm/java-6-openjdk-amd64/jre/bin/java to provide /usr/bin/java (java) in auto mode update-alternatives: using /usr/lib/jvm/java-6-openjdk-amd64/jre/bin/keytool to provide /usr/bin/keytool (keytool) in auto mode update-alternatives: using /usr/lib/jvm/java-6-openjdk-amd64/jre/bin/pack200 to provide /usr/bin/pack200 (pack200) in auto mode update-alternatives: using /usr/lib/jvm/java-6-openjdk-amd64/jre/bin/rmid to provide /usr/bin/rmid (rmid) in auto mode update-alternatives: using /usr/lib/jvm/java-6-openjdk-amd64/jre/bin/rmiregistry to provide /usr/bin/rmiregistry (rmiregistry) in auto mode update-alternatives: using /usr/lib/jvm/java-6-openjdk-amd64/jre/bin/unpack200 to provide /usr/bin/unpack200 (unpack200) in auto mode update-alternatives: using /usr/lib/jvm/java-6-openjdk-amd64/jre/bin/orbd to provide /usr/bin/orbd (orbd) in auto mode update-alternatives: using /usr/lib/jvm/java-6-openjdk-amd64/jre/bin/servertool to provide /usr/bin/servertool (servertool) in auto mode update-alternatives: using /usr/lib/jvm/java-6-openjdk-amd64/jre/bin/tnameserv to provide /usr/bin/tnameserv (tnameserv) in auto mode update-alternatives: using /usr/lib/jvm/java-6-openjdk-amd64/jre/lib/jexec to provide /usr/bin/jexec (jexec) in auto mode Setting up ca-certificates-java (20120721) ... Adding debian:Deutsche_Telekom_Root_CA_2.pem Adding debian:Comodo_Trusted_Services_root.pem Adding debian:Certum_Trusted_Network_CA.pem Adding debian:thawte_Primary_Root_CA_-_G2.pem Adding debian:UTN_USERFirst_Hardware_Root_CA.pem Adding debian:AddTrust_Low-Value_Services_Root.pem Adding debian:Microsec_e-Szigno_Root_CA.pem Adding debian:SwissSign_Silver_CA_-_G2.pem Adding debian:ComSign_Secured_CA.pem Adding debian:Buypass_Class_2_CA_1.pem Adding debian:Verisign_Class_1_Public_Primary_Certification_Authority_-_G3.pem Adding debian:Certum_Root_CA.pem Adding debian:AddTrust_External_Root.pem Adding debian:Chambers_of_Commerce_Root_-_2008.pem Adding debian:Starfield_Root_Certificate_Authority_-_G2.pem Adding debian:Verisign_Class_1_Public_Primary_Certification_Authority_-_G2.pem Adding debian:Visa_eCommerce_Root.pem Adding debian:Digital_Signature_Trust_Co._Global_CA_3.pem Adding debian:AC_Raíz_Certicámara_S.A..pem Adding debian:NetLock_Arany_=Class_Gold=_Fotanúsítvány.pem Adding debian:Taiwan_GRCA.pem Adding debian:Camerfirma_Chambers_of_Commerce_Root.pem Adding debian:Juur-SK.pem Adding debian:Entrust.net_Premium_2048_Secure_Server_CA.pem Adding debian:XRamp_Global_CA_Root.pem Adding debian:Security_Communication_RootCA2.pem Adding debian:AddTrust_Qualified_Certificates_Root.pem Adding debian:NetLock_Qualified_=Class_QA=_Root.pem Adding debian:TC_TrustCenter_Class_2_CA_II.pem Adding debian:DST_ACES_CA_X6.pem Adding debian:thawte_Primary_Root_CA.pem Adding debian:thawte_Primary_Root_CA_-_G3.pem Adding debian:GeoTrust_Universal_CA_2.pem Adding debian:ACEDICOM_Root.pem Adding debian:Security_Communication_EV_RootCA1.pem Adding debian:America_Online_Root_Certification_Authority_2.pem Adding debian:TC_TrustCenter_Universal_CA_I.pem Adding debian:SwissSign_Platinum_CA_-_G2.pem Adding debian:Global_Chambersign_Root_-_2008.pem Adding debian:SecureSign_RootCA11.pem Adding debian:GeoTrust_Global_CA_2.pem Adding debian:Buypass_Class_3_CA_1.pem Adding debian:Baltimore_CyberTrust_Root.pem Adding debian:UbuntuOne-Go_Daddy_Class_2_CA.pem Adding debian:Equifax_Secure_eBusiness_CA_1.pem Adding debian:SwissSign_Gold_CA_-_G2.pem Adding debian:AffirmTrust_Premium_ECC.pem Adding debian:TC_TrustCenter_Universal_CA_III.pem Adding debian:ca.pem Adding debian:Verisign_Class_3_Public_Primary_Certification_Authority_-_G2.pem Adding debian:NetLock_Express_=Class_C=_Root.pem Adding debian:VeriSign_Class_3_Public_Primary_Certification_Authority_-_G5.pem Adding debian:Firmaprofesional_Root_CA.pem Adding debian:Comodo_Secure_Services_root.pem Adding debian:cacert.org.pem Adding debian:GeoTrust_Primary_Certification_Authority.pem Adding debian:RSA_Security_2048_v3.pem Adding debian:Staat_der_Nederlanden_Root_CA.pem Adding debian:Cybertrust_Global_Root.pem Adding debian:DigiCert_High_Assurance_EV_Root_CA.pem Adding debian:TDC_OCES_Root_CA.pem Adding debian:A-Trust-nQual-03.pem Adding debian:Equifax_Secure_CA.pem Adding debian:Digital_Signature_Trust_Co._Global_CA_1.pem Adding debian:GeoTrust_Global_CA.pem Adding debian:Starfield_Class_2_CA.pem Adding debian:ApplicationCA_-_Japanese_Government.pem Adding debian:Swisscom_Root_CA_1.pem Adding debian:Verisign_Class_2_Public_Primary_Certification_Authority_-_G2.pem Adding debian:Camerfirma_Global_Chambersign_Root.pem Adding debian:QuoVadis_Root_CA_3.pem Adding debian:QuoVadis_Root_CA.pem Adding debian:Comodo_AAA_Services_root.pem Adding debian:ComSign_CA.pem Adding debian:AddTrust_Public_Services_Root.pem Adding debian:DigiCert_Assured_ID_Root_CA.pem Adding debian:UTN_DATACorp_SGC_Root_CA.pem Adding debian:CA_Disig.pem Adding debian:E-Guven_Kok_Elektronik_Sertifika_Hizmet_Saglayicisi.pem Adding debian:GlobalSign_Root_CA_-_R3.pem Adding debian:QuoVadis_Root_CA_2.pem Adding debian:Entrust_Root_Certification_Authority.pem Adding debian:GTE_CyberTrust_Global_Root.pem Adding debian:ValiCert_Class_1_VA.pem Adding debian:Autoridad_de_Certificacion_Firmaprofesional_CIF_A62634068.pem Adding debian:GeoTrust_Primary_Certification_Authority_-_G2.pem Adding debian:spi-ca-2003.pem Adding debian:America_Online_Root_Certification_Authority_1.pem Adding debian:AffirmTrust_Premium.pem Adding debian:Sonera_Class_1_Root_CA.pem Adding debian:Verisign_Class_2_Public_Primary_Certification_Authority_-_G3.pem Adding debian:Certplus_Class_2_Primary_CA.pem Adding debian:TURKTRUST_Certificate_Services_Provider_Root_2.pem Adding debian:Network_Solutions_Certificate_Authority.pem Adding debian:Go_Daddy_Class_2_CA.pem Adding debian:StartCom_Certification_Authority.pem Adding debian:Hongkong_Post_Root_CA_1.pem Adding debian:Hellenic_Academic_and_Research_Institutions_RootCA_2011.pem Adding debian:Thawte_Premium_Server_CA.pem Adding debian:EBG_Elektronik_Sertifika_Hizmet_Saglayicisi.pem Adding debian:TURKTRUST_Certificate_Services_Provider_Root_1.pem Adding debian:NetLock_Business_=Class_B=_Root.pem Adding debian:Microsec_e-Szigno_Root_CA_2009.pem Adding debian:DigiCert_Global_Root_CA.pem Adding debian:VeriSign_Class_3_Public_Primary_Certification_Authority_-_G4.pem Adding debian:IGC_A.pem Adding debian:TWCA_Root_Certification_Authority.pem Adding debian:S-TRUST_Authentication_and_Encryption_Root_CA_2005_PN.pem Adding debian:VeriSign_Universal_Root_Certification_Authority.pem Adding debian:DST_Root_CA_X3.pem Adding debian:Verisign_Class_1_Public_Primary_Certification_Authority.pem Adding debian:Root_CA_Generalitat_Valenciana.pem Adding debian:UTN_USERFirst_Email_Root_CA.pem Adding debian:ssl-cert-snakeoil.pem Adding debian:Starfield_Services_Root_Certificate_Authority_-_G2.pem Adding debian:GeoTrust_Primary_Certification_Authority_-_G3.pem Adding debian:Certinomis_-_Autorité_Racine.pem Adding debian:Verisign_Class_3_Public_Primary_Certification_Authority.pem Adding debian:TDC_Internet_Root_CA.pem Adding debian:UbuntuOne-ValiCert_Class_2_VA.pem Adding debian:AffirmTrust_Commercial.pem Adding debian:spi-cacert-2008.pem Adding debian:Izenpe.com.pem Adding debian:EC-ACC.pem Adding debian:Go_Daddy_Root_Certificate_Authority_-_G2.pem Adding debian:COMODO_ECC_Certification_Authority.pem Adding debian:CNNIC_ROOT.pem Adding debian:NetLock_Notary_=Class_A=_Root.pem Adding debian:Equifax_Secure_eBusiness_CA_2.pem Adding debian:Verisign_Class_3_Public_Primary_Certification_Authority_-_G3.pem Adding debian:Secure_Global_CA.pem Adding debian:UbuntuOne-Go_Daddy_CA.pem Adding debian:GeoTrust_Universal_CA.pem Adding debian:Wells_Fargo_Root_CA.pem Adding debian:Thawte_Server_CA.pem Adding debian:WellsSecure_Public_Root_Certificate_Authority.pem Adding debian:TC_TrustCenter_Class_3_CA_II.pem Adding debian:COMODO_Certification_Authority.pem Adding debian:Equifax_Secure_Global_eBusiness_CA.pem Adding debian:Security_Communication_Root_CA.pem Adding debian:GlobalSign_Root_CA_-_R2.pem Adding debian:TÜBITAK_UEKAE_Kök_Sertifika_Hizmet_Saglayicisi_-_Sürüm_3.pem Adding debian:Verisign_Class_4_Public_Primary_Certification_Authority_-_G3.pem Adding debian:certSIGN_ROOT_CA.pem Adding debian:RSA_Root_Certificate_1.pem Adding debian:ePKI_Root_Certification_Authority.pem Adding debian:Entrust.net_Secure_Server_CA.pem Adding debian:OISTE_WISeKey_Global_Root_GA_CA.pem Adding debian:Sonera_Class_2_Root_CA.pem Adding debian:Certigna.pem Adding debian:AffirmTrust_Networking.pem Adding debian:ValiCert_Class_2_VA.pem Adding debian:GlobalSign_Root_CA.pem Adding debian:Staat_der_Nederlanden_Root_CA_-_G2.pem Adding debian:SecureTrust_CA.pem done. Setting up openjdk-6-jre:amd64 (6b24-1.11.5-0ubuntu1~12.10.1) ... update-alternatives: using /usr/lib/jvm/java-6-openjdk-amd64/jre/bin/policytool to provide /usr/bin/policytool (policytool) in auto mode Setting up libatk-wrapper-java (0.30.4-0ubuntu4) ... Setting up icedtea-6-jre-cacao:amd64 (6b24-1.11.5-0ubuntu1~12.10.1) ... Setting up icedtea-6-jre-jamvm:amd64 (6b24-1.11.5-0ubuntu1~12.10.1) ... Setting up icedtea-netx:amd64 (1.3-1ubuntu1.1) ... update-alternatives: using /usr/lib/jvm/java-6-openjdk-amd64/jre/bin/javaws to provide /usr/bin/javaws (javaws) in auto mode update-alternatives: using /usr/lib/jvm/java-6-openjdk-amd64/jre/bin/itweb-settings to provide /usr/bin/itweb-settings (itweb-settings) in auto mode update-alternatives: using /usr/lib/jvm/java-7-openjdk-amd64/jre/bin/javaws to provide /usr/bin/javaws (javaws) in auto mode update-alternatives: using /usr/lib/jvm/java-7-openjdk-amd64/jre/bin/itweb-settings to provide /usr/bin/itweb-settings (itweb-settings) in auto mode Setting up openjdk-6-jdk:amd64 (6b24-1.11.5-0ubuntu1~12.10.1) ... update-alternatives: using /usr/lib/jvm/java-6-openjdk-amd64/bin/appletviewer to provide /usr/bin/appletviewer (appletviewer) in auto mode update-alternatives: using /usr/lib/jvm/java-6-openjdk-amd64/bin/extcheck to provide /usr/bin/extcheck (extcheck) in auto mode update-alternatives: using /usr/lib/jvm/java-6-openjdk-amd64/bin/idlj to provide /usr/bin/idlj (idlj) in auto mode update-alternatives: using /usr/lib/jvm/java-6-openjdk-amd64/bin/jar to provide /usr/bin/jar (jar) in auto mode update-alternatives: using /usr/lib/jvm/java-6-openjdk-amd64/bin/jarsigner to provide /usr/bin/jarsigner (jarsigner) in auto mode update-alternatives: using /usr/lib/jvm/java-6-openjdk-amd64/bin/javac to provide /usr/bin/javac (javac) in auto mode update-alternatives: using /usr/lib/jvm/java-6-openjdk-amd64/bin/javadoc to provide /usr/bin/javadoc (javadoc) in auto mode update-alternatives: using /usr/lib/jvm/java-6-openjdk-amd64/bin/javah to provide /usr/bin/javah (javah) in auto mode update-alternatives: using /usr/lib/jvm/java-6-openjdk-amd64/bin/javap to provide /usr/bin/javap (javap) in auto mode update-alternatives: using /usr/lib/jvm/java-6-openjdk-amd64/bin/jconsole to provide /usr/bin/jconsole (jconsole) in auto mode update-alternatives: using /usr/lib/jvm/java-6-openjdk-amd64/bin/jdb to provide /usr/bin/jdb (jdb) in auto mode update-alternatives: using /usr/lib/jvm/java-6-openjdk-amd64/bin/jhat to provide /usr/bin/jhat (jhat) in auto mode update-alternatives: using /usr/lib/jvm/java-6-openjdk-amd64/bin/jinfo to provide /usr/bin/jinfo (jinfo) in auto mode update-alternatives: using /usr/lib/jvm/java-6-openjdk-amd64/bin/jmap to provide /usr/bin/jmap (jmap) in auto mode update-alternatives: using /usr/lib/jvm/java-6-openjdk-amd64/bin/jps to provide /usr/bin/jps (jps) in auto mode update-alternatives: using /usr/lib/jvm/java-6-openjdk-amd64/bin/jrunscript to provide /usr/bin/jrunscript (jrunscript) in auto mode update-alternatives: using /usr/lib/jvm/java-6-openjdk-amd64/bin/jsadebugd to provide /usr/bin/jsadebugd (jsadebugd) in auto mode update-alternatives: using /usr/lib/jvm/java-6-openjdk-amd64/bin/jstack to provide /usr/bin/jstack (jstack) in auto mode update-alternatives: using /usr/lib/jvm/java-6-openjdk-amd64/bin/jstat to provide /usr/bin/jstat (jstat) in auto mode update-alternatives: using /usr/lib/jvm/java-6-openjdk-amd64/bin/jstatd to provide /usr/bin/jstatd (jstatd) in auto mode update-alternatives: using /usr/lib/jvm/java-6-openjdk-amd64/bin/native2ascii to provide /usr/bin/native2ascii (native2ascii) in auto mode update-alternatives: using /usr/lib/jvm/java-6-openjdk-amd64/bin/rmic to provide /usr/bin/rmic (rmic) in auto mode update-alternatives: using /usr/lib/jvm/java-6-openjdk-amd64/bin/schemagen to provide /usr/bin/schemagen (schemagen) in auto mode update-alternatives: using /usr/lib/jvm/java-6-openjdk-amd64/bin/serialver to provide /usr/bin/serialver (serialver) in auto mode update-alternatives: using /usr/lib/jvm/java-6-openjdk-amd64/bin/wsgen to provide /usr/bin/wsgen (wsgen) in auto mode update-alternatives: using /usr/lib/jvm/java-6-openjdk-amd64/bin/wsimport to provide /usr/bin/wsimport (wsimport) in auto mode update-alternatives: using /usr/lib/jvm/java-6-openjdk-amd64/bin/xjc to provide /usr/bin/xjc (xjc) in auto mode Setting up openoffice (3.4~oneiric) ... Setting up libatk-wrapper-java-jni:amd64 (0.30.4-0ubuntu4) ... Processing triggers for libc-bin ... ldconfig deferred processing now taking place philip@X301-2:~$ sudo apt-get install libxrandr2:i386 libxinerama1:i386 Reading package lists... Done Building dependency tree Reading state information... Done The following package was automatically installed and is no longer required: linux-headers-3.5.0-17 Use 'apt-get autoremove' to remove it. The following extra packages will be installed: gcc-4.7-base:i386 libc6:i386 libgcc1:i386 libx11-6:i386 libxau6:i386 libxcb1:i386 libxdmcp6:i386 libxext6:i386 libxrender1:i386 Suggested packages: glibc-doc:i386 locales:i386 The following NEW packages will be installed gcc-4.7-base:i386 libc6:i386 libgcc1:i386 libx11-6:i386 libxau6:i386 libxcb1:i386 libxdmcp6:i386 libxext6:i386 libxinerama1:i386 libxrandr2:i386 libxrender1:i386 0 upgraded, 11 newly installed, 0 to remove and 93 not upgraded. Need to get 4,936 kB of archives. After this operation, 11.9 MB of additional disk space will be used. Do you want to continue [Y/n]? y Get:1 http://gb.archive.ubuntu.com/ubuntu/ quantal/main gcc-4.7-base i386 4.7.2-2ubuntu1 [15.5 kB] Get:2 http://gb.archive.ubuntu.com/ubuntu/ quantal/main libc6 i386 2.15-0ubuntu20 [3,940 kB] Get:3 http://gb.archive.ubuntu.com/ubuntu/ quantal/main libgcc1 i386 1:4.7.2-2ubuntu1 [53.5 kB] Get:4 http://gb.archive.ubuntu.com/ubuntu/ quantal/main libxau6 i386 1:1.0.7-1 [8,582 B] Get:5 http://gb.archive.ubuntu.com/ubuntu/ quantal/main libxdmcp6 i386 1:1.1.1-1 [13.1 kB] Get:6 http://gb.archive.ubuntu.com/ubuntu/ quantal/main libxcb1 i386 1.8.1-1ubuntu1 [48.7 kB] Get:7 http://gb.archive.ubuntu.com/ubuntu/ quantal/main libx11-6 i386 2:1.5.0-1 [776 kB] Get:8 http://gb.archive.ubuntu.com/ubuntu/ quantal/main libxext6 i386 2:1.3.1-2 [33.9 kB] Get:9 http://gb.archive.ubuntu.com/ubuntu/ quantal/main libxinerama1 i386 2:1.1.2-1 [8,118 B] Get:10 http://gb.archive.ubuntu.com/ubuntu/ quantal/main libxrender1 i386 1:0.9.7-1 [20.1 kB] Get:11 http://gb.archive.ubuntu.com/ubuntu/ quantal/main libxrandr2 i386 2:1.4.0-1 [18.8 kB] Fetched 4,936 kB in 30s (161 kB/s) Preconfiguring packages ... Selecting previously unselected package gcc-4.7-base:i386. (Reading database ... 146005 files and directories currently installed.) Unpacking gcc-4.7-base:i386 (from .../gcc-4.7-base_4.7.2-2ubuntu1_i386.deb) ... Selecting previously unselected package libc6:i386. Unpacking libc6:i386 (from .../libc6_2.15-0ubuntu20_i386.deb) ... Selecting previously unselected package libgcc1:i386. Unpacking libgcc1:i386 (from .../libgcc1_1%3a4.7.2-2ubuntu1_i386.deb) ... Selecting previously unselected package libxau6:i386. Unpacking libxau6:i386 (from .../libxau6_1%3a1.0.7-1_i386.deb) ... Selecting previously unselected package libxdmcp6:i386. Unpacking libxdmcp6:i386 (from .../libxdmcp6_1%3a1.1.1-1_i386.deb) ... Selecting previously unselected package libxcb1:i386. Unpacking libxcb1:i386 (from .../libxcb1_1.8.1-1ubuntu1_i386.deb) ... Selecting previously unselected package libx11-6:i386. Unpacking libx11-6:i386 (from .../libx11-6_2%3a1.5.0-1_i386.deb) ... Selecting previously unselected package libxext6:i386. Unpacking libxext6:i386 (from .../libxext6_2%3a1.3.1-2_i386.deb) ... Selecting previously unselected package libxinerama1:i386. Unpacking libxinerama1:i386 (from .../libxinerama1_2%3a1.1.2-1_i386.deb) ... Selecting previously unselected package libxrender1:i386. Unpacking libxrender1:i386 (from .../libxrender1_1%3a0.9.7-1_i386.deb) ... Selecting previously unselected package libxrandr2:i386. Unpacking libxrandr2:i386 (from .../libxrandr2_2%3a1.4.0-1_i386.deb) ... Setting up gcc-4.7-base:i386 (4.7.2-2ubuntu1) ... Setting up libc6:i386 (2.15-0ubuntu20) ... Setting up libgcc1:i386 (1:4.7.2-2ubuntu1) ... Setting up libxau6:i386 (1:1.0.7-1) ... Setting up libxdmcp6:i386 (1:1.1.1-1) ... Setting up libxcb1:i386 (1.8.1-1ubuntu1) ... Setting up libx11-6:i386 (2:1.5.0-1) ... Setting up libxext6:i386 (2:1.3.1-2) ... Setting up libxinerama1:i386 (2:1.1.2-1) ... Setting up libxrender1:i386 (1:0.9.7-1) ... Setting up libxrandr2:i386 (2:1.4.0-1) ... Processing triggers for libc-bin ... ldconfig deferred processing now taking place $ sudo chmod a+rx /opt/openoffice.org3/share/uno_packages/cache/uno_packages chmod: cannot access `/opt/openoffice.org3/share/uno_packages/cache/uno_packages': No such file or directory

    Read the article

  • Appcelerator Titanium - auto height table views break with shortish text

    - by ceejayoz
    I posted this on the Appcelerator Titanium dev Q&A site, but maybe someone here has had this issue... KitchenSink 1.1 illustrates this issue. In table_view_api_auto_height.js, changing row: addRow(0,'This is some long text. This is some long text. This is some long text. This is some long text. This is some long text. This is some long text. This is some long text. This is some long text. This is some long text. This is some long text. This is some long text. This is some long text. This is some long text. This is some long text. This is some long text. This is some long text. This is some long text. This is some long text.'); to something like: addRow(0,'This is some long text. This is some long text.'); results in incorrect left padding on the row. See screenshot:

    Read the article

  • Webrat says it can't find some text, but the text is actually there

    - by Jason
    I have a webpage that has a form button on it called "delete", and a cuke scenario that has the line: And I should see "delete" When I run the scenario, I get this error: expected the following element's content to include "delete" ...and it dumps the webrat page to stdout and the "delete" is, in fact, not there. So far so good. However, when I tell webrat to show me the page before the error happens: Then show me the page And I should see "delete" ...Safari fires up and shows me the page, and in Safari there's the "delete" button, totally there. Why is webrat not finding the form button? I've also had this same problem with form fields, such as text inputs that have a value in them when the page loads, but webrat says there's nothing there. Looking at it in Safari shows, again, that the field does have the right text in it. Is this a bug, or is webrat just not suitable for checking form elements? Is there a different way to do this? Thanks!

    Read the article

  • scale mode window on same workspace (ubuntu 12.04)

    - by shantanu
    I have recently upgraded from ubuntu 11.10 to ubuntu 12.04. Generally in unity if we open several interface of an application then we can switch them by double clicking the icon of the application on unity panel. It shows the opened application's multiple interface in scale mode. But ubuntu 12.04 does not show the windows of different workspace in scale mode. If i open three nautilus, two in same and one in different workspace then click on icon show two interface (which workspace contains two). That's means it only shows current workspace's application's interface. Is it a bug or feature of ubuntu 12.04? Is there any way to fix it?

    Read the article

  • Low graphics mode on Ubuntu 12.04 with Intel Graphics

    - by NightShadeQueen
    When I boot, my computer just tells me it can't detect graphic card (or something else) settings and it has to use the low graphics mode. Then it gives me four choices, but doesn't let me choose any of them. I can get my computer to boot by going to some sort of terminal mode and then typing sudo gdm. The other graphics manager I have is lightdm. I originally had the nVidia propriety driver, and I've tried bumblebee. Mobile Intel Graphics Media Accelerator 4500M is my graphics card. Is there any way to fix this so I can use lightdm again?

    Read the article

  • Silverlight Html Placeholder now support OOB mode

    With the official Silverlight 4 release this week, one of the things we introduced in the Telerik Silverlight controls is the ability to use the Html Placeholder control in OOB in the same way you do when the control is hosted in the browser. The good news is that you don't need to do anything in order to enable this feature. It comes out of the box and if you have an app that is using the HtmlPlaceholder you just need to install it in OOB mode to see the same html that you are seeing when the application is hosted in the browser. When in OOB mode we are using internally the Microsoft WebBrowser control to render the Html - that's why this feature is SL4 specific and is not available in the SL3 binaries (which we still officially support).   Go play with it and if you have any questions ...Did you know that DotNetSlackers also publishes .net articles written by top known .net Authors? We already have over 80 articles in several categories including Silverlight. Take a look: here.

    Read the article

  • Can only run firefox 8.0 in safe mode [closed]

    - by Max Popp
    This is a recent problem but I have no idea what caused it: I can only run firefox in safe mode. Any other mode, I get a completely khaki, unresponsive screen, that I have to forcibly terminate. I have uninstalled firefox, and then re-installed it via synaptic. That didn't seem to work. The problem occurs in all the four user accounts I have defined in the ubuntu. I am running an ubuntu 11.10, amd64. My firefox is version 8.0.

    Read the article

  • How to load with "simplegame" mode after cooking?

    - by Emran Bayati
    i got a problem after i cook my game in Frontend (udk) ! Every thing is ok during the Cook operation i mean i compiled my scripts,it's ok there's no problem in this step,and i cooked my packages it's ok too ! no problem just like last step. so before i package the whole game;i'll lunch it and see if every thing is ok ! but when i load the game it'll load whit the Unreal tournament default game type ! i mean i don't want it to load with this type ! i want it to load with the "simplegame" game type ! i need to say that i set game type to "simplegame" in the Editor from View world Properties Game Type! but still it's loading with Ut game mode when i cook the game ! I just want load my game in "Simplegame" mode after cooked. if any one can help ! plz help ! Tnx Alot Emran Bayati

    Read the article

  • Change input text to regular text on blur and ability to edit jQuery

    - by eknown
    I'm creating a form where I'm eliminating the use of a save button. The form is made up of input text boxes and textareas. After the user enters data into the input field, I want to trigger an onBlur function and change the input into a span that contains the information that the user entered. I also want to have the ability to edit this information, so if the user clicks on the newly created span with text, it will turn back into the input field with the current information for their editing pleasure. For reference, I'm looking to have a functionality pretty much like on editing a photo title on Flickr. If possible, I'd also like to have the textbox show "saving..." for half a second after the blur to reflect interaction with server.

    Read the article

  • Fullscreen windowed mode in id games

    - by Oli
    I run a TwinView, dual monitor system. I like to play games fullscreen on one of the monitors, not spanning both. With wine, this works by just setting it to desktop mode and setting the resolution to that of one screen. For OpenTTD, I used Compiz's Window Rules plugin. But I have a few native games that this doesn't work for. Today's experiment involved Prey (Doom 3 engine) but I've had similar issues with other ID engines. So in short: has anybody found a way of having Prey/OpenAreana/Doom3/etc run in windowed mode but with fullscreen decorations (that is to say, no borders and above the panel)?

    Read the article

  • laptop-mode-tools and harddrive spinoff

    - by sagarchalise
    So I wanted to extend my laptop battery life. After googleing a lot I found many tips and tricks. Some even in this site as well. Then I found this package in synaptic as well laptop-mode-tools. Now I am not well aware of what harddrive spinoffs are, so I have a dilemma of installing this package as it seems to remove acpi support as well. So my question is, how reliable is this package in battery life extension and what configurations should I use with it ? Also I stumbled upon some posts saying spinoffs may kill the harddrive as well. So can anyone clearify with some configuration tips especially for laptop-mode-tools. Thanks in advance

    Read the article

  • Kiosk Mode Coding in Chromium

    - by Aaron
    I don't know how easy this would be, since I don't know anything about it, but I need an Ubuntu setup where the machine boots up, displays the login for a few seconds allowing a chance to log in as an admin, and then precedes to automatically log in to a user account which directly opens Chromium (any other browser is acceptable) in a kiosk mode where only the web content is visible, all Chromium keyboard shortcuts are disabled, and all but a select few websites are blocked, redirecting back to the home page after an "Unauthorized web page" warning comes up if the URL constraint is violated. Is it possible to code a kiosk setup like this, or am I asking for too much? If I'm simply uninformed, and there is already much documentation on anything like this, please redirect me to an appropriate page. If you can code or set up something like my description, please reply with step-by-step instructions, and instructions on how to modify the elements of the kiosk mode. Thank you in advance for any help. (Note: I'm currently using Ubuntu 10.04, but any distribution would work.)

    Read the article

  • ASP.NET Conditionally Change ButtonField text at runTime

    - by Rodney Vinyard
    ASP.NET Conditionally Change ButtonField text at runTime   <asp:ButtonField CommandName="Edit" HeaderText="" Text="Edit" ButtonType="Link" />       protected void gvRequests_RowDataBound(object sender, GridViewRowEventArgs e)     {         if (e.Row.RowType == DataControlRowType.DataRow)         {             //----------------------------------------------------             // If status = "Saved", change buttonField.LinkButton.Text to "Copy"             //----------------------------------------------------             if (e.Row.Cells[(int)gCol.Status].Text == "Saved")             {                 //----------------------------------------------------                 // no !                 //----------------------------------------------------                 //string x = e.Row.Cells[(int)gCol.EditLink].Text;                 //e.Row.Cells[(int)gCol.EditLink].Text = "Copy";                   //----------------------------------------------------                 // yes !                 //----------------------------------------------------                 LinkButton linkButton = (LinkButton)e.Row.Cells[(int)gCol.EditLink].Controls[0];                 linkButton.Text = "Copy";             }         }     }

    Read the article

  • Issue with parsed text with HTMLCleaner - spaces at the begining of text

    - by ansol90
    Im able to get text using HTMLCleaner from website. The problem is that when I set the text to a TextView it shows the beginning of the text with a big space on it. Here is the screenshot of what im talking about. I have tried android:gravity but nothing happened. Please help. Here is my Code: private class SiteParser extends AsyncTask<String, Void, String> { protected String doInBackground(String... arg) { String output = null; try { HtmlHelper hh = new HtmlHelper(new URL(arg[0])); List<TagNode> news = hh.getnewsByClass("TextoPrint"); for (Iterator<TagNode> iterator = newss.iterator(); iterator .hasNext();) { TagNode divElement = (TagNode) iterator.next(); output = divElement.getText().toString(); } } catch (Exception e) { e.printStackTrace(); } return output; } protected void onPostExecute(String output) { Bundle bundle=new Bundle(); bundle.putString("body",output); Intent mainIntent = new Intent(act, MyView.class); mainIntent.putExtras(bundle); startActivity(mainIntent); act.finish(); } } public class HtmlHelper { TagNode rootNode; public HtmlHelper(URL htmlPage) throws IOException, XPatherException { HtmlCleaner cleaner = new HtmlCleaner(); rootNode = cleaner.clean(htmlPage); } List<TagNode> getnewsByClass(String Classname){ List<TagNode> newsList = new ArrayList<TagNode>(); TagNode divElements[] = rootNode.getElementsByName("div", true); for (int i = 0; divElements != null && i < divElements.length; i++) { String classType = divElements[i].getAttributeByName("id"); if (classType != null && classType.equals(Classname)) { newsList.add(divElements[i]); } } return newsList; } }

    Read the article

  • How to make IE 9 Standards Mode the default mode?

    - by Evik James
    I have a web site that works perfectly fine in IE9 when compatibility mode is turned OFF (the compatibility symbol is gray). When compatibility mode is turned on (blue), the jQuery doesn't work at all. I have added the following tag to the site to tell the browser that compatibility mode should NOT be used. <meta http-equiv="X-UA-Compatible" content="IE=Edge" > I have the doctype as this: <!DOCTYPE html PUBLIC "-//W3C//DTD XHTML 1.0 Transitional//EN" "http://www.w3.org/TR/xhtml1/DTD/xhtml1-transitional.dtd"> Still, the browser doesn't seem to default to standard mode and the user must manually ensure that they are NOT in compatibility mode. Can I disable IE 9 Compatibility Mode? Have I done what I need to do to disable IE 9 Compatibility Mode? Can the user always override IE 9 Standards Mode?

    Read the article

  • Send SMS text messages for FREE using Java ME

    - by hinkmond
    Here's a way to get around those nasty SMS text messages charges (and maybe a way to get around the Pakistan SMS text censors too!). Use this Java ME SMS text app for your Java ME mobile phone, called JaxtrSMS: See: JaxtrSMS free Java ME SMS Here's a quote: JaxtrSMS lets you send FREE SMS and txt messages to any mobile phone in the world. Best of all, the receiver does not have to have the JaxtrSMS app. International and local SMS/texting can be expensive but with JaxtrSMS you can text anyone in the world for FREE! Great! Now, you can send 2,000 text messages from your phone every month and not worry about a huge bill. You don't send 2,000 text message in a month? Well, get it for your teenage kids then. They certainly send 2,000 text messages in a month... Hinkmond

    Read the article

  • Switching to Kubuntu results in low graphics mode

    - by HackToHell
    I looked at some screen shots of Kubuntu and I liked it so I went to Synaptic and installed the kubuntu-desktop package and set my desktop window manager to kde and rebooted. After reboot, I saw Kubuntu splash screen then this message; running in Low Graphical Mode. Then I was not able to dismiss the message because my mouse did not work Seemingly How to Geek had the same problem http://www.howtogeek.com/howto/ubuntu/install-kde-kubuntu-on-ubuntu/ . You will probably see that your xorg.conf file was backed up to xorg.conf.1 during the ?KDE / Kubuntu installation. Just copy the xorg.conf.1 back to xorg.conf, reboot, and everything should be fine. I also tried to do that by booting into recovery mode and then droping onto the shell. But it would not let me rename, came up with some error.

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

< Previous Page | 25 26 27 28 29 30 31 32 33 34 35 36  | Next Page >