Search Results

Search found 28793 results on 1152 pages for 'line endings'.

Page 294/1152 | < Previous Page | 290 291 292 293 294 295 296 297 298 299 300 301  | Next Page >

  • Solaris X86 AESNI OpenSSL Engine

    - by danx
    Solaris X86 AESNI OpenSSL Engine Cryptography is a major component of secure e-commerce. Since cryptography is compute intensive and adds a significant load to applications, such as SSL web servers (https), crypto performance is an important factor. Providing accelerated crypto hardware greatly helps these applications and will help lead to a wider adoption of cryptography, and lower cost, in e-commerce and other applications. The Intel Westmere microprocessor has six new instructions to acclerate AES encryption. They are called "AESNI" for "AES New Instructions". These are unprivileged instructions, so no "root", other elevated access, or context switch is required to execute these instructions. These instructions are used in a new built-in OpenSSL 1.0 engine available in Solaris 11, the aesni engine. Previous Work Previously, AESNI instructions were introduced into the Solaris x86 kernel and libraries. That is, the "aes" kernel module (used by IPsec and other kernel modules) and the Solaris pkcs11 library (for user applications). These are available in Solaris 10 10/09 (update 8) and above, and Solaris 11. The work here is to add the aesni engine to OpenSSL. X86 AESNI Instructions Intel's Xeon 5600 is one of the processors that support AESNI. This processor is used in the Sun Fire X4170 M2 As mentioned above, six new instructions acclerate AES encryption in processor silicon. The new instructions are: aesenc performs one round of AES encryption. One encryption round is composed of these steps: substitute bytes, shift rows, mix columns, and xor the round key. aesenclast performs the final encryption round, which is the same as above, except omitting the mix columns (which is only needed for the next encryption round). aesdec performs one round of AES decryption aesdeclast performs the final AES decryption round aeskeygenassist Helps expand the user-provided key into a "key schedule" of keys, one per round aesimc performs an "inverse mixed columns" operation to convert the encryption key schedule into a decryption key schedule pclmulqdq Not a AESNI instruction, but performs "carryless multiply" operations to acclerate AES GCM mode. Since the AESNI instructions are implemented in hardware, they take a constant number of cycles and are not vulnerable to side-channel timing attacks that attempt to discern some bits of data from the time taken to encrypt or decrypt the data. Solaris x86 and OpenSSL Software Optimizations Having X86 AESNI hardware crypto instructions is all well and good, but how do we access it? The software is available with Solaris 11 and is used automatically if you are running Solaris x86 on a AESNI-capable processor. AESNI is used internally in the kernel through kernel crypto modules and is available in user space through the PKCS#11 library. For OpenSSL on Solaris 11, AESNI crypto is available directly with a new built-in OpenSSL 1.0 engine, called the "aesni engine." This is in lieu of the extra overhead of going through the Solaris OpenSSL pkcs11 engine, which accesses Solaris crypto and digest operations. Instead, AESNI assembly is included directly in the new aesni engine. Instead of including the aesni engine in a separate library in /lib/openssl/engines/, the aesni engine is "built-in", meaning it is included directly in OpenSSL's libcrypto.so.1.0.0 library. This reduces overhead and the need to manually specify the aesni engine. Since the engine is built-in (that is, in libcrypto.so.1.0.0), the openssl -engine command line flag or API call is not needed to access the engine—the aesni engine is used automatically on AESNI hardware. Ciphers and Digests supported by OpenSSL aesni engine The Openssl aesni engine auto-detects if it's running on AESNI hardware and uses AESNI encryption instructions for these ciphers: AES-128-CBC, AES-192-CBC, AES-256-CBC, AES-128-CFB128, AES-192-CFB128, AES-256-CFB128, AES-128-CTR, AES-192-CTR, AES-256-CTR, AES-128-ECB, AES-192-ECB, AES-256-ECB, AES-128-OFB, AES-192-OFB, and AES-256-OFB. Implementation of the OpenSSL aesni engine The AESNI assembly language routines are not a part of the regular Openssl 1.0.0 release. AESNI is a part of the "HEAD" ("development" or "unstable") branch of OpenSSL, for future release. But AESNI is also available as a separate patch provided by Intel to the OpenSSL project for OpenSSL 1.0.0. A minimal amount of "glue" code in the aesni engine works between the OpenSSL libcrypto.so.1.0.0 library and the assembly functions. The aesni engine code is separate from the base OpenSSL code and requires patching only a few source files to use it. That means OpenSSL can be more easily updated to future versions without losing the performance from the built-in aesni engine. OpenSSL aesni engine Performance Here's some graphs of aesni engine performance I measured by running openssl speed -evp $algorithm where $algorithm is aes-128-cbc, aes-192-cbc, and aes-256-cbc. These are using the 64-bit version of openssl on the same AESNI hardware, a Sun Fire X4170 M2 with a Intel Xeon E5620 @2.40GHz, running Solaris 11 FCS. "Before" is openssl without the aesni engine and "after" is openssl with the aesni engine. The numbers are MBytes/second. OpenSSL aesni engine performance on Sun Fire X4170 M2 (Xeon E5620 @2.40GHz) (Higher is better; "before"=OpenSSL on AESNI without AESNI engine software, "after"=OpenSSL AESNI engine) As you can see the speedup is dramatic for all 3 key lengths and for data sizes from 16 bytes to 8 Kbytes—AESNI is about 7.5-8x faster over hand-coded amd64 assembly (without aesni instructions). Verifying the OpenSSL aesni engine is present The easiest way to determine if you are running the aesni engine is to type "openssl engine" on the command line. No configuration, API, or command line options are needed to use the OpenSSL aesni engine. If you are running on Intel AESNI hardware with Solaris 11 FCS, you'll see this output indicating you are using the aesni engine: intel-westmere $ openssl engine (aesni) Intel AES-NI engine (no-aesni) (dynamic) Dynamic engine loading support (pkcs11) PKCS #11 engine support If you are running on Intel without AESNI hardware you'll see this output indicating the hardware can't support the aesni engine: intel-nehalem $ openssl engine (aesni) Intel AES-NI engine (no-aesni) (dynamic) Dynamic engine loading support (pkcs11) PKCS #11 engine support For Solaris on SPARC or older Solaris OpenSSL software, you won't see any aesni engine line at all. Third-party OpenSSL software (built yourself or from outside Oracle) will not have the aesni engine either. Solaris 11 FCS comes with OpenSSL version 1.0.0e. The output of typing "openssl version" should be "OpenSSL 1.0.0e 6 Sep 2011". 64- and 32-bit OpenSSL OpenSSL comes in both 32- and 64-bit binaries. 64-bit executable is now the default, at /usr/bin/openssl, and OpenSSL 64-bit libraries at /lib/amd64/libcrypto.so.1.0.0 and libssl.so.1.0.0 The 32-bit executable is at /usr/bin/i86/openssl and the libraries are at /lib/libcrytpo.so.1.0.0 and libssl.so.1.0.0. Availability The OpenSSL AESNI engine is available in Solaris 11 x86 for both the 64- and 32-bit versions of OpenSSL. It is not available with Solaris 10. You must have a processor that supports AESNI instructions, otherwise OpenSSL will fallback to the older, slower AES implementation without AESNI. Processors that support AESNI include most Westmere and Sandy Bridge class processor architectures. Some low-end processors (such as for mobile/laptop platforms) do not support AESNI. The easiest way to determine if the processor supports AESNI is with the isainfo -v command—look for "amd64" and "aes" in the output: $ isainfo -v 64-bit amd64 applications pclmulqdq aes sse4.2 sse4.1 ssse3 popcnt tscp ahf cx16 sse3 sse2 sse fxsr mmx cmov amd_sysc cx8 tsc fpu Conclusion The Solaris 11 OpenSSL aesni engine provides easy access to powerful Intel AESNI hardware cryptography, in addition to Solaris userland PKCS#11 libraries and Solaris crypto kernel modules.

    Read the article

  • Coming to OpenWorld? A must attend session…

    - by Ruma Sanyal
    Normal 0 false false false EN-US X-NONE X-NONE NTT Docomo, Inc. is the predominant mobile phone operator in Japan. The name is officially an abbreviation of the phrase, "do communications over the mobile network", and is also from a compound word dokomo, meaning "everywhere" in Japanese.  Normal 0 false false false EN-US X-NONE X-NONE /* Style Definitions */ table.MsoNormalTable {mso-style-name:"Table Normal"; mso-tstyle-rowband-size:0; mso-tstyle-colband-size:0; mso-style-noshow:yes; mso-style-priority:99; mso-style-qformat:yes; mso-style-parent:""; mso-padding-alt:0in 5.4pt 0in 5.4pt; mso-para-margin-top:0in; mso-para-margin-right:0in; mso-para-margin-bottom:10.0pt; mso-para-margin-left:0in; line-height:115%; mso-pagination:widow-orphan; font-size:11.0pt; font-family:"Calibri","sans-serif"; mso-ascii-font-family:Calibri; mso-ascii-theme-font:minor-latin; mso-hansi-font-family:Calibri; mso-hansi-theme-font:minor-latin; mso-bidi-font-family:"Times New Roman"; mso-bidi-theme-font:minor-bidi;} One of the most important of NTT Docomo’s systems is ALADIN, which is a nationwide operating system shared with its eight regional subsidiaries. ALADIN has five primary functions: customer management, phone number management, information processing and storage, sales information management, and credit investigation. To enhance cost efficiency and help ensure stable operation of ALADIN, NTT Docomo has employed Oracle WebLogic Server as a new application platform. Further information on this can be found here. Normal 0 false false false EN-US X-NONE X-NONE /* Style Definitions */ table.MsoNormalTable {mso-style-name:"Table Normal"; mso-tstyle-rowband-size:0; mso-tstyle-colband-size:0; mso-style-noshow:yes; mso-style-priority:99; mso-style-qformat:yes; mso-style-parent:""; mso-padding-alt:0in 5.4pt 0in 5.4pt; mso-para-margin-top:0in; mso-para-margin-right:0in; mso-para-margin-bottom:10.0pt; mso-para-margin-left:0in; line-height:115%; mso-pagination:widow-orphan; font-size:11.0pt; font-family:"Calibri","sans-serif"; mso-ascii-font-family:Calibri; mso-ascii-theme-font:minor-latin; mso-hansi-font-family:Calibri; mso-hansi-theme-font:minor-latin; mso-bidi-font-family:"Times New Roman"; mso-bidi-theme-font:minor-bidi;} Last year at OpenWorld, NTT Docomo was honored as an Innovation Award Winner for: · Implementing real time sales and contract management system enabling all services requested by customers for immediate activations before customer leaves the Docomo store · A robust disaster recovery strategy, room to grow the business, and ability to move custom Java development to a platform with built in standards - WebLogic · Better performance, better reliability, better stability, and smooth migration v\:* {behavior:url(#default#VML);} o\:* {behavior:url(#default#VML);} w\:* {behavior:url(#default#VML);} .shape {behavior:url(#default#VML);} Normal 0 false false false false EN-US X-NONE X-NONE /* Style Definitions */ table.MsoNormalTable {mso-style-name:"Table Normal"; mso-tstyle-rowband-size:0; mso-tstyle-colband-size:0; mso-style-noshow:yes; mso-style-priority:99; mso-style-qformat:yes; mso-style-parent:""; mso-padding-alt:0in 5.4pt 0in 5.4pt; mso-para-margin-top:0in; mso-para-margin-right:0in; mso-para-margin-bottom:10.0pt; mso-para-margin-left:0in; line-height:115%; mso-pagination:widow-orphan; font-size:11.0pt; font-family:"Calibri","sans-serif"; mso-ascii-font-family:Calibri; mso-ascii-theme-font:minor-latin; mso-hansi-font-family:Calibri; mso-hansi-theme-font:minor-latin; mso-bidi-font-family:"Times New Roman"; mso-bidi-theme-font:minor-bidi;} Meet This Year's Most Impressive Innovators! This year we continue to honor customers for their most innovative and cutting-edge solutions using Oracle Fusion Middleware. Join us in celebrating award recipients’ great achievements and commitment to innovation.   Oracle Fusion Middleware: Meet This Year's Most Impressive Innovators Session ID: CON7029 Tuesday September 30, 2014 @ 5-5:45 pm (PST) Yerba Buena Center for the Arts  YBCA Theater (next to Moscone North) 700 Howard St., San Francisco, CA, 94103 /* Style Definitions */ table.MsoNormalTable {mso-style-name:"Table Normal"; mso-tstyle-rowband-size:0; mso-tstyle-colband-size:0; mso-style-noshow:yes; mso-style-priority:99; mso-style-qformat:yes; mso-style-parent:""; mso-padding-alt:0in 5.4pt 0in 5.4pt; mso-para-margin-top:0in; mso-para-margin-right:0in; mso-para-margin-bottom:10.0pt; mso-para-margin-left:0in; line-height:115%; mso-pagination:widow-orphan; font-size:11.0pt; font-family:"Calibri","sans-serif"; mso-ascii-font-family:Calibri; mso-ascii-theme-font:minor-latin; mso-hansi-font-family:Calibri; mso-hansi-theme-font:minor-latin; mso-bidi-font-family:"Times New Roman"; mso-bidi-theme-font:minor-bidi;}

    Read the article

  • Solaris X86 AESNI OpenSSL Engine

    - by danx
    Solaris X86 AESNI OpenSSL Engine Cryptography is a major component of secure e-commerce. Since cryptography is compute intensive and adds a significant load to applications, such as SSL web servers (https), crypto performance is an important factor. Providing accelerated crypto hardware greatly helps these applications and will help lead to a wider adoption of cryptography, and lower cost, in e-commerce and other applications. The Intel Westmere microprocessor has six new instructions to acclerate AES encryption. They are called "AESNI" for "AES New Instructions". These are unprivileged instructions, so no "root", other elevated access, or context switch is required to execute these instructions. These instructions are used in a new built-in OpenSSL 1.0 engine available in Solaris 11, the aesni engine. Previous Work Previously, AESNI instructions were introduced into the Solaris x86 kernel and libraries. That is, the "aes" kernel module (used by IPsec and other kernel modules) and the Solaris pkcs11 library (for user applications). These are available in Solaris 10 10/09 (update 8) and above, and Solaris 11. The work here is to add the aesni engine to OpenSSL. X86 AESNI Instructions Intel's Xeon 5600 is one of the processors that support AESNI. This processor is used in the Sun Fire X4170 M2 As mentioned above, six new instructions acclerate AES encryption in processor silicon. The new instructions are: aesenc performs one round of AES encryption. One encryption round is composed of these steps: substitute bytes, shift rows, mix columns, and xor the round key. aesenclast performs the final encryption round, which is the same as above, except omitting the mix columns (which is only needed for the next encryption round). aesdec performs one round of AES decryption aesdeclast performs the final AES decryption round aeskeygenassist Helps expand the user-provided key into a "key schedule" of keys, one per round aesimc performs an "inverse mixed columns" operation to convert the encryption key schedule into a decryption key schedule pclmulqdq Not a AESNI instruction, but performs "carryless multiply" operations to acclerate AES GCM mode. Since the AESNI instructions are implemented in hardware, they take a constant number of cycles and are not vulnerable to side-channel timing attacks that attempt to discern some bits of data from the time taken to encrypt or decrypt the data. Solaris x86 and OpenSSL Software Optimizations Having X86 AESNI hardware crypto instructions is all well and good, but how do we access it? The software is available with Solaris 11 and is used automatically if you are running Solaris x86 on a AESNI-capable processor. AESNI is used internally in the kernel through kernel crypto modules and is available in user space through the PKCS#11 library. For OpenSSL on Solaris 11, AESNI crypto is available directly with a new built-in OpenSSL 1.0 engine, called the "aesni engine." This is in lieu of the extra overhead of going through the Solaris OpenSSL pkcs11 engine, which accesses Solaris crypto and digest operations. Instead, AESNI assembly is included directly in the new aesni engine. Instead of including the aesni engine in a separate library in /lib/openssl/engines/, the aesni engine is "built-in", meaning it is included directly in OpenSSL's libcrypto.so.1.0.0 library. This reduces overhead and the need to manually specify the aesni engine. Since the engine is built-in (that is, in libcrypto.so.1.0.0), the openssl -engine command line flag or API call is not needed to access the engine—the aesni engine is used automatically on AESNI hardware. Ciphers and Digests supported by OpenSSL aesni engine The Openssl aesni engine auto-detects if it's running on AESNI hardware and uses AESNI encryption instructions for these ciphers: AES-128-CBC, AES-192-CBC, AES-256-CBC, AES-128-CFB128, AES-192-CFB128, AES-256-CFB128, AES-128-CTR, AES-192-CTR, AES-256-CTR, AES-128-ECB, AES-192-ECB, AES-256-ECB, AES-128-OFB, AES-192-OFB, and AES-256-OFB. Implementation of the OpenSSL aesni engine The AESNI assembly language routines are not a part of the regular Openssl 1.0.0 release. AESNI is a part of the "HEAD" ("development" or "unstable") branch of OpenSSL, for future release. But AESNI is also available as a separate patch provided by Intel to the OpenSSL project for OpenSSL 1.0.0. A minimal amount of "glue" code in the aesni engine works between the OpenSSL libcrypto.so.1.0.0 library and the assembly functions. The aesni engine code is separate from the base OpenSSL code and requires patching only a few source files to use it. That means OpenSSL can be more easily updated to future versions without losing the performance from the built-in aesni engine. OpenSSL aesni engine Performance Here's some graphs of aesni engine performance I measured by running openssl speed -evp $algorithm where $algorithm is aes-128-cbc, aes-192-cbc, and aes-256-cbc. These are using the 64-bit version of openssl on the same AESNI hardware, a Sun Fire X4170 M2 with a Intel Xeon E5620 @2.40GHz, running Solaris 11 FCS. "Before" is openssl without the aesni engine and "after" is openssl with the aesni engine. The numbers are MBytes/second. OpenSSL aesni engine performance on Sun Fire X4170 M2 (Xeon E5620 @2.40GHz) (Higher is better; "before"=OpenSSL on AESNI without AESNI engine software, "after"=OpenSSL AESNI engine) As you can see the speedup is dramatic for all 3 key lengths and for data sizes from 16 bytes to 8 Kbytes—AESNI is about 7.5-8x faster over hand-coded amd64 assembly (without aesni instructions). Verifying the OpenSSL aesni engine is present The easiest way to determine if you are running the aesni engine is to type "openssl engine" on the command line. No configuration, API, or command line options are needed to use the OpenSSL aesni engine. If you are running on Intel AESNI hardware with Solaris 11 FCS, you'll see this output indicating you are using the aesni engine: intel-westmere $ openssl engine (aesni) Intel AES-NI engine (no-aesni) (dynamic) Dynamic engine loading support (pkcs11) PKCS #11 engine support If you are running on Intel without AESNI hardware you'll see this output indicating the hardware can't support the aesni engine: intel-nehalem $ openssl engine (aesni) Intel AES-NI engine (no-aesni) (dynamic) Dynamic engine loading support (pkcs11) PKCS #11 engine support For Solaris on SPARC or older Solaris OpenSSL software, you won't see any aesni engine line at all. Third-party OpenSSL software (built yourself or from outside Oracle) will not have the aesni engine either. Solaris 11 FCS comes with OpenSSL version 1.0.0e. The output of typing "openssl version" should be "OpenSSL 1.0.0e 6 Sep 2011". 64- and 32-bit OpenSSL OpenSSL comes in both 32- and 64-bit binaries. 64-bit executable is now the default, at /usr/bin/openssl, and OpenSSL 64-bit libraries at /lib/amd64/libcrypto.so.1.0.0 and libssl.so.1.0.0 The 32-bit executable is at /usr/bin/i86/openssl and the libraries are at /lib/libcrytpo.so.1.0.0 and libssl.so.1.0.0. Availability The OpenSSL AESNI engine is available in Solaris 11 x86 for both the 64- and 32-bit versions of OpenSSL. It is not available with Solaris 10. You must have a processor that supports AESNI instructions, otherwise OpenSSL will fallback to the older, slower AES implementation without AESNI. Processors that support AESNI include most Westmere and Sandy Bridge class processor architectures. Some low-end processors (such as for mobile/laptop platforms) do not support AESNI. The easiest way to determine if the processor supports AESNI is with the isainfo -v command—look for "amd64" and "aes" in the output: $ isainfo -v 64-bit amd64 applications pclmulqdq aes sse4.2 sse4.1 ssse3 popcnt tscp ahf cx16 sse3 sse2 sse fxsr mmx cmov amd_sysc cx8 tsc fpu Conclusion The Solaris 11 OpenSSL aesni engine provides easy access to powerful Intel AESNI hardware cryptography, in addition to Solaris userland PKCS#11 libraries and Solaris crypto kernel modules.

    Read the article

  • Conversion of BizTalk Projects to Use the New WCF-SAP Adaptor

    - by Geordie
    We are in the process of upgrading our BizTalk Environment from BizTalk 2006 R2 to BizTalk 2010. The SAP adaptor in BizTalk 2010 is an all new and more powerful WCF-SAP adaptor. When my colleagues tested out the new adaptor they discovered that the format of the data extracted from SAP was not identical to the old adaptor. This is not a big deal if the structure of the messages from SAP is simple. In this case we were receiving the delivery and invoice iDocs. Both these structures are complex especially the delivery document. Over the past few years I have tweaked the delivery mapping to remove bugs from original mapping. The idea of redoing these maps did not appeal and due to the current work load was not even an option. I opted for a rather crude alternative of pulling in the iDoc in the new typed format and then adding a static map at the start of the orchestration to convert the data to the old schema.  Note WCF-SAP data formats (on the binding tab of the configuration dialog box is the ‘RecieiveIdocFormat’ field): Typed:  Returns a XML document with the hierarchy represented in XML and all fields being represented by XML tags. RFC: Returns an XML document with the hierarchy represented in XML but the iDoc lines in flat file format. String: This returns the iDoc in a format that is closest to the original flat file format but is still wrapped with some top level XML tags. The files also contained some strange characters at the end of each line. I started with the invoice document and it was quite straight forward to add the mapping but this is where my problems started. The orchestrations for these documents are dynamic and so require the identity of the partner to be able to correctly configure the orchestration. The partner identity is in the EDI_DC40 segment of the iDoc. In the old project the RECPRN node of the segment was promoted. The code to set a variable to the partner ID was now failing. After lot of head scratching I discovered the problem was due to the addition of Namespaces to the fields in the EDI_DC40 segment. To overcome this I needed to use an xPath query with a Namespace Manager. This had to be done in custom code. I now tried to repeat the process with the delivery document. Unfortunately when we tried to get sample typed data from SAP an exception was thrown. The adapter "WCF-SAP" raised an error message. Details "Microsoft.ServiceModel.Channels.Common.XmlReaderGenerationException: The segment or group definition E2EDKA1001 was not found in the IDoc metadata. The UniqueId of the IDoc type is: IDOCTYP/3/DESADV01/ZASNEXT1/640. For Receive operations, the SAP adapter does not support unreleased segments.   Our guess is that when the WCF-SAP adaptor tries to down load the data it retrieves a data schema from SAP. For some reason the schema does not match the data. This may be due to the version of SAP we are running or due to a customization. Either way resolving this problem did not look easy. When doing some research on this problem I found an article showing me how to get the data from SAP using the WCF-SAP adaptor without any XML tags. http://blogs.msdn.com/b/adapters/archive/2007/10/05/receiving-idocs-getting-the-raw-idoc-data.aspx Reproduction of Mustansir blog: Since the WCF based SAP Adapter is ... well, WCF based, all data flowing in and out of the adapter is encapsulated within a SOAP message. Which means there are those pesky xml tags all over the place. If you want to receive an Idoc from SAP, you can receive it in "Typed" format (in which case each column in each segment of the idoc appears within its own xml tag), or you can receive it in "String" format (in which case there are just 2 xml tags at the top, the raw xml data in string/flat file format, and the 2 closing xml tags). In "String" format, an incoming idoc (for ORDERS05, containing 5 data records) would look like: <ReceiveIdoc ><idocData>EDI_DC40 8000000000001064985620 E2EDK01005 800000000000106498500000100000001 E2EDK14 8000000000001064985000002000000020111000 E2EDK14 8000000000001064985000003000000020081000 E2EDK14 80000000000010649850000040000000200710 E2EDK14 80000000000010649850000050000000200600</idocData></ReceiveIdoc> (I have trimmed part of the control record so that it fits cleanly here on one line). Now, you're only interested in the IDOC data, and don't care much for the XML tags. It isn't that difficult to write your own pipeline component, or even some logic in the orchestration to remove the tags, right? Well, you don't need to write any extra code at all - the WCF Adapter can help you here! During the configuration of your one-way Receive Location using WCF-Custom, navigate to the Messages tab. Under the section "Inbound BizTalk Messge Body", select the "Path" radio button, and: (a) Enter the body path expression as: /*[local-name()='ReceiveIdoc']/*[local-name()='idocData'] (b) Choose "String" for the Node Encoding. What we've done is, used an XPATH to pull out the value of the "idocData" node from the XML. Your Receive Location will now emit text containing only the idoc data. You can at this point, for example, put the Flat File Pipeline component to convert the flat text into a different xml format based on some other schema you already have, and receive your version of the xml formatted message in your orchestration.   This was potentially a much easier solution than adding the static maps to the orchestrations and overcame the issue with ‘Typed’ delivery documents. Not quite so fast… Note: When I followed Mustansir’s blog the characters at the end of each line disappeared. After configuring the adaptor and passing the iDoc data into the original flat file receive pipelines I was receiving exceptions. There was a failure executing the receive pipeline: "PAPINETPipelines.DeliveryFlatFileReceive, CustomerIntegration2.PAPINET.Pipelines, Version=1.0.0.0, Culture=neutral, PublicKeyToken=4ca3635fbf092bbb" Source: "Pipeline " Receive Port: "recSAP_Delivery" URI: "D:\CustomerIntegration2\SAP\Delivery\*.xml" Reason: An error occurred when parsing the incoming document: "Unexpected data found while looking for: 'Z2EDPZ7' The current definition being parsed is E2EDP07GRP. The stream offset where the error occured is 8859. The line number where the error occured is 23. The column where the error occured is 0.". Although the new flat file looked the same as the old one there was a differences. In the original file all lines in the document were exactly 1064 character long. In the new file all lines were truncated to the last alphanumeric character. The final piece of the puzzle was to add a custom pipeline component to pad all the lines to 1064 characters. This component was added to the decode node of the custom delivery and invoice flat file disassembler pipelines. Execute method of the custom pipeline component: public IBaseMessage Execute(IPipelineContext pc, IBaseMessage inmsg) { //Convert Stream to a string Stream s = null; IBaseMessagePart bodyPart = inmsg.BodyPart;   // NOTE inmsg.BodyPart.Data is implemented only as a setter in the http adapter API and a //getter and setter for the file adapter. Use GetOriginalDataStream to get data instead. if (bodyPart != null) s = bodyPart.GetOriginalDataStream();   string newMsg = string.Empty; string strLine; try { StreamReader sr = new StreamReader(s); strLine = sr.ReadLine(); while (strLine != null) { //Execute padding code if (strLine != null) strLine = strLine.PadRight(1064, ' ') + "\r\n"; newMsg += strLine; strLine = sr.ReadLine(); } sr.Close(); } catch (IOException ex) { throw new Exception("Error occured trying to pad the message to 1064 charactors"); }   //Convert back to stream and set to Data property inmsg.BodyPart.Data = new MemoryStream(Encoding.UTF8.GetBytes(newMsg)); ; //reset the position of the stream to zero inmsg.BodyPart.Data.Position = 0; return inmsg; }

    Read the article

  • Segfault when iterating over a map<string, string> and drawing its contents using SDL_TTF

    - by Michael Stahre
    I'm not entirely sure this question belongs on gamedev.stackexchange, but I'm technically working on a game and working with SDL, so it might not be entirely offtopic. I've written a class called DebugText. The point of the class is to have a nice way of printing values of variables to the game screen. The idea is to call SetDebugText() with the variables in question every time they change or, as is currently the case, every time the game's Update() is called. The issue is that when iterating over the map that contains my variables and their latest updated values, I get segfaults. See the comments in DrawDebugText() below, it specifies where the error happens. I've tried splitting the calls to it-first and it-second into separate lines and found that the problem doesn't always happen when calling it-first. It alters between it-first and it-second. I can't find a pattern. It doesn't fail on every call to DrawDebugText() either. It might fail on the third time DrawDebugText() is called, or it might fail on the fourth. Class header: #ifndef CLIENT_DEBUGTEXT_H #define CLIENT_DEBUGTEXT_H #include <Map> #include <Math.h> #include <sstream> #include <SDL.h> #include <SDL_ttf.h> #include "vector2.h" using std::string; using std::stringstream; using std::map; using std::pair; using game::Vector2; namespace game { class DebugText { private: TTF_Font* debug_text_font; map<string, string>* debug_text_list; public: void SetDebugText(string var, bool value); void SetDebugText(string var, float value); void SetDebugText(string var, int value); void SetDebugText(string var, Vector2 value); void SetDebugText(string var, string value); int DrawDebugText(SDL_Surface*, SDL_Rect*); void InitDebugText(); void Clear(); }; } #endif Class source file: #include "debugtext.h" namespace game { // Copypasta function for handling the toString conversion template <class T> inline string to_string (const T& t) { stringstream ss (stringstream::in | stringstream::out); ss << t; return ss.str(); } // Initializes SDL_TTF and sets its font void DebugText::InitDebugText() { if(TTF_WasInit()) TTF_Quit(); TTF_Init(); debug_text_font = TTF_OpenFont("LiberationSans-Regular.ttf", 16); TTF_SetFontStyle(debug_text_font, TTF_STYLE_NORMAL); } // Iterates over the current debug_text_list and draws every element on the screen. // After drawing with SDL you need to get a rect specifying the area on the screen that was changed and tell SDL that this part of the screen needs to be updated. this is done in the game's Draw() function // This function sets rects_to_update to the new list of rects provided by all of the surfaces and returns the number of rects in the list. These two parameters are used in Draw() when calling on SDL_UpdateRects(), which takes an SDL_Rect* and a list length int DebugText::DrawDebugText(SDL_Surface* screen, SDL_Rect* rects_to_update) { if(debug_text_list == NULL) return 0; if(!TTF_WasInit()) InitDebugText(); rects_to_update = NULL; // Specifying the font color SDL_Color font_color = {0xff, 0x00, 0x00, 0x00}; // r, g, b, unused int row_count = 0; string line; // The iterator variable map<string, string>::iterator it; // Gets the iterator and iterates over it for(it = debug_text_list->begin(); it != debug_text_list->end(); it++) { // Takes the first value (the name of the variable) and the second value (the value of the parameter in string form) //---------THIS LINE GIVES ME SEGFAULTS----- line = it->first + ": " + it->second; //------------------------------------------ // Creates a surface with the text on it that in turn can be rendered to the screen itself later SDL_Surface* debug_surface = TTF_RenderText_Solid(debug_text_font, line.c_str(), font_color); if(debug_surface == NULL) { // A standard check for errors fprintf(stderr, "Error: %s", TTF_GetError()); return NULL; } else { // If SDL_TTF did its job right, then we now set a destination rect row_count++; SDL_Rect dstrect = {5, 5, 0, 0}; // x, y, w, h dstrect.x = 20; dstrect.y = 20*row_count; // Draws the surface with the text on it to the screen int res = SDL_BlitSurface(debug_surface,NULL,screen,&dstrect); if(res != 0) { //Just an error check fprintf(stderr, "Error: %s", SDL_GetError()); return NULL; } // Creates a new rect to specify the area that needs to be updated with SDL_Rect* new_rect_to_update = (SDL_Rect*) malloc(sizeof(SDL_Rect)); new_rect_to_update->h = debug_surface->h; new_rect_to_update->w = debug_surface->w; new_rect_to_update->x = dstrect.x; new_rect_to_update->y = dstrect.y; // Just freeing the surface since it isn't necessary anymore SDL_FreeSurface(debug_surface); // Creates a new list of rects with room for the new rect SDL_Rect* newtemp = (SDL_Rect*) malloc(row_count*sizeof(SDL_Rect)); // Copies the data from the old list of rects to the new one memcpy(newtemp, rects_to_update, (row_count-1)*sizeof(SDL_Rect)); // Adds the new rect to the new list newtemp[row_count-1] = *new_rect_to_update; // Frees the memory used by the old list free(rects_to_update); // And finally redirects the pointer to the old list to the new list rects_to_update = newtemp; newtemp = NULL; } } // When the entire map has been iterated over, return the number of lines that were drawn, ie. the number of rects in the returned rect list return row_count; } // The SetDebugText used by all the SetDebugText overloads // Takes two strings, inserts them into the map as a pair void DebugText::SetDebugText(string var, string value) { if (debug_text_list == NULL) { debug_text_list = new map<string, string>(); } debug_text_list->erase(var); debug_text_list->insert(pair<string, string>(var, value)); } // Writes the bool to a string and calls SetDebugText(string, string) void DebugText::SetDebugText(string var, bool value) { string result; if (value) result = "True"; else result = "False"; SetDebugText(var, result); } // Does the same thing, but uses to_string() to convert the float void DebugText::SetDebugText(string var, float value) { SetDebugText(var, to_string(value)); } // Same as above, but int void DebugText::SetDebugText(string var, int value) { SetDebugText(var, to_string(value)); } // Vector2 is a struct of my own making. It contains the two float vars x and y void DebugText::SetDebugText(string var, Vector2 value) { SetDebugText(var + ".x", to_string(value.x)); SetDebugText(var + ".y", to_string(value.y)); } // Empties the list. I don't actually use this in my code. Shame on me for writing something I don't use. void DebugText::Clear() { if(debug_text_list != NULL) debug_text_list->clear(); } }

    Read the article

  • Oracle @ E20 Conference Boston - Building Social Business

    - by Michael Snow
    12.00 Normal 0 false false false EN-US X-NONE X-NONE MicrosoftInternetExplorer4 /* Style Definitions */ table.MsoNormalTable {mso-style-name:"Table Normal"; mso-tstyle-rowband-size:0; mso-tstyle-colband-size:0; mso-style-noshow:yes; mso-style-priority:99; mso-style-qformat:yes; mso-style-parent:""; mso-padding-alt:0in 5.4pt 0in 5.4pt; mso-para-margin-top:0in; mso-para-margin-right:0in; mso-para-margin-bottom:10.0pt; mso-para-margin-left:0in; line-height:115%; mso-pagination:widow-orphan; font-family:"Calibri","sans-serif"; mso-ascii- mso-ascii-theme-font:minor-latin; mso-fareast-font-family:"Times New Roman"; mso-fareast-theme-font:minor-fareast; mso-hansi- mso-hansi-theme-font:minor-latin; mso-bidi-font-family:"Times New Roman"; mso-bidi-theme-font:minor-bidi;} Oracle WebCenter is The Engagement Platform Powering Exceptional Experiences for Employees, Partners and Customers &amp;amp;amp;amp;amp;amp;amp;amp;amp;amp;amp;amp;amp;amp;amp;amp;amp;amp;amp;amp;amp;amp;amp;amp;&amp;amp;amp;amp;amp;amp;amp;amp;amp;amp;amp;amp;amp;amp;amp;amp;amp;amp;amp;amp;amp;lt;span id=&amp;amp;amp;amp;amp;amp;amp;amp;amp;amp;amp;amp;amp;amp;amp;amp;amp;amp;amp;quot;XinhaEditingPostion&amp;amp;amp;amp;amp;amp;amp;amp;amp;amp;amp;amp;amp;amp;amp;amp;amp;amp;amp;quot;&amp;amp;amp;amp;amp;amp;amp;amp;amp;amp;amp;amp;amp;amp;amp;amp;amp;amp;amp;amp;amp;gt;&amp;amp;amp;amp;amp;amp;amp;amp;amp;amp;amp;amp;amp;amp;amp;amp;amp;amp;amp;amp;amp;lt;/span&amp;amp;amp;amp;amp;amp;amp;amp;amp;amp;amp;amp;amp;amp;amp;amp;amp;amp;amp;amp;amp;gt;lt;p&amp;amp;amp;amp;amp;amp;amp;amp;amp;amp;amp;amp;amp;amp;amp;amp;amp;amp;amp;amp;amp;amp;amp;amp;gt; &amp;amp;amp;amp;amp;amp;amp;amp;amp;amp;amp;amp;amp;amp;amp;amp;amp;amp;amp;amp;amp;amp;amp;amp;lt;/p&amp;amp;amp;amp;amp;amp;amp;amp;amp;amp;amp;amp;amp;amp;amp;amp;amp;amp;amp;amp;amp;amp;amp;amp;gt; The way we work is changing rapidly, offering an enormous competitive advantage to those who embrace the new tools that enable contextual, agile and simplified information exchange and collaboration to distributed workforces and  networks of partners and customers. As many of you are aware, Enterprise 2.0 is the term for the technologies and business practices that liberate the workforce from the constraints of legacy communication and productivity tools like email. It provides business managers with access to the right information at the right time through a web of inter-connected applications, services and devices. Enterprise 2.0 makes accessible the collective intelligence of many, translating to a huge  competitive advantage in the form of increased innovation, productivity and agility.The Enterprise 2.0 Conference takes a strategic perspective, emphasizing the bigger picture implications of the technology and the exploration of what is at stake for organizations trying to change not only tools, but also culture and process. Beyond discussion of the "why", there will also be in-depth opportunities for learning the "how" that will help you bring Enterprise 2.0 to your business. You won't want to miss this opportunity to learn and hear from leading experts in the fields of technology for business, collaboration, culture change and collective intelligence.Oracle was a proud Gold sponsor of the Enterprise 2.0 Conference, taking place this past week in Boston. For those of you that weren't able to make it - we've made the Oracle Social Network Presentation session available here and have posted the slides below. 12.00 Normal 0 false false false EN-US X-NONE X-NONE MicrosoftInternetExplorer4 /* Style Definitions */ table.MsoNormalTable {mso-style-name:"Table Normal"; mso-tstyle-rowband-size:0; mso-tstyle-colband-size:0; mso-style-noshow:yes; mso-style-priority:99; mso-style-qformat:yes; mso-style-parent:""; mso-padding-alt:0in 5.4pt 0in 5.4pt; mso-para-margin-top:0in; mso-para-margin-right:0in; mso-para-margin-bottom:10.0pt; mso-para-margin-left:0in; line-height:115%; mso-pagination:widow-orphan; font-family:"Calibri","sans-serif"; mso-ascii- mso-ascii-theme-font:minor-latin; mso-fareast-font-family:"Times New Roman"; mso-fareast-theme-font:minor-fareast; mso-hansi- mso-hansi-theme-font:minor-latin; mso-bidi-font-family:"Times New Roman"; mso-bidi-theme-font:minor-bidi;} 12.00 Normal 0 false false false EN-US X-NONE X-NONE MicrosoftInternetExplorer4 /* Style Definitions */ table.MsoNormalTable {mso-style-name:"Table Normal"; mso-tstyle-rowband-size:0; mso-tstyle-colband-size:0; mso-style-noshow:yes; mso-style-priority:99; mso-style-qformat:yes; mso-style-parent:""; mso-padding-alt:0in 5.4pt 0in 5.4pt; mso-para-margin-top:0in; mso-para-margin-right:0in; mso-para-margin-bottom:10.0pt; mso-para-margin-left:0in; line-height:115%; mso-pagination:widow-orphan; font-family:"Calibri","sans-serif"; mso-ascii- mso-ascii-theme-font:minor-latin; mso-fareast-font-family:"Times New Roman"; mso-fareast-theme-font:minor-fareast; mso-hansi- mso-hansi-theme-font:minor-latin; mso-bidi-font-family:"Times New Roman"; mso-bidi-theme-font:minor-bidi;} The following is intended to outline our general product direction. It is intended for information purposes only, and may not be incorporated into any contract. It is not a commitment to deliver any material, code, or functionality, and should not be relied upon in making purchasing decisions. The development, release, and timing of any features or functionality described for Oracle’s products remains at the sole discretion of Oracle. 12.00 Normal 0 false false false EN-US X-NONE X-NONE MicrosoftInternetExplorer4 /* Style Definitions */ table.MsoNormalTable {mso-style-name:"Table Normal"; mso-tstyle-rowband-size:0; mso-tstyle-colband-size:0; mso-style-noshow:yes; mso-style-priority:99; mso-style-qformat:yes; mso-style-parent:""; mso-padding-alt:0in 5.4pt 0in 5.4pt; mso-para-margin-top:0in; mso-para-margin-right:0in; mso-para-margin-bottom:10.0pt; mso-para-margin-left:0in; line-height:115%; mso-pagination:widow-orphan; font-size:11.0pt; font-family:"Calibri","sans-serif"; mso-ascii-font-family:Calibri; mso-ascii-theme-font:minor-latin; mso-fareast-font-family:"Times New Roman"; mso-fareast-theme-font:minor-fareast; mso-hansi-font-family:Calibri; mso-hansi-theme-font:minor-latin; mso-bidi-font-family:"Times New Roman"; mso-bidi-theme-font:minor-bidi;}

    Read the article

  • Physical Directories vs. MVC View Paths

    - by Rick Strahl
    This post falls into the bucket of operator error on my part, but I want to share this anyway because it describes an issue that has bitten me a few times now and writing it down might keep it a little stronger in my mind. I've been working on an MVC project the last few days, and at the end of a long day I accidentally moved one of my View folders from the MVC Root Folder to the project root. It must have been at the very end of the day before shutting down because tests and manual site navigation worked fine just before I quit for the night. I checked in changes and called it a night. Next day I came back, started running the app and had a lot of breaks with certain views. Oddly custom routes to these controllers/views worked, but stock /{controller}/{action} routes would not. After a bit of spelunking I realized that "Hey one of my View Folders is missing", which made some sense given the error messages I got. I looked in the recycle bin - nothing there, so rather than try to figure out what the hell happened, just restored from my last SVN checkin. At this point the folders are back… but… view access  still ends up breaking for this set of views. Specifically I'm getting the Yellow Screen of Death with: CS0103: The name 'model' does not exist in the current context Here's the full error: Server Error in '/ClassifiedsWeb' Application. Compilation ErrorDescription: An error occurred during the compilation of a resource required to service this request. Please review the following specific error details and modify your source code appropriately.Compiler Error Message: CS0103: The name 'model' does not exist in the current contextSource Error: Line 1: @model ClassifiedsWeb.EntryViewModel Line 2: @{ Line 3: ViewBag.Title = Model.Entry.Title + " - " + ClassifiedsBusiness.App.Configuration.ApplicationName; Source File: c:\Projects2010\Clients\GorgeNet\Classifieds\ClassifiedsWeb\Classifieds\Show.cshtml    Line: 1 Compiler Warning Messages: Show Detailed Compiler Output: Show Complete Compilation Source: Version Information: Microsoft .NET Framework Version:4.0.30319; ASP.NET Version:4.0.30319.272 Here's what's really odd about this error: The views now do exist in the /Views/Classifieds folder of the project, but it appears like MVC is trying to execute the views directly. This is getting pretty weird, man! So I hook up some break points in my controllers to see if my controller actions are getting fired - and sure enough it turns out they are not - but only for those views that were previously 'lost' and then restored from SVN. WTF? At this point I'm thinking that I must have messed up one of the config files, but after some more spelunking and realizing that all the other Controller views work, I give up that idea. Config's gotta be OK if other controllers and views are working. Root Folders and MVC Views don't mix As I mentioned the problem was the fact that I inadvertantly managed to drag my View folder to the root folder of the project. Here's what this looks like in my FUBAR'd project structure after I copied back /Views/Classifieds folder from SVN: There's the actual root folder in the /Views folder and the accidental copy that sits of the root. I of course did not notice the /Classifieds folder at the root because it was excluded and didn't show up in the project. Now, before you call me a complete idiot remember that this happened by accident - an accidental drag probably just before shutting down for the night. :-) So why does this break? MVC should be happy with views in the /Views/Classifieds folder right? While MVC might be happy, IIS is not. The fact that there is a physical folder on disk takes precedence over MVC's routing. In other words if a URL exists that matches a route the pysical path is accessed first. What happens here is that essentially IIS is trying to execute the .cshtml pages directly without ever routing to the Controller methods. In the error page I showed above my clue should have been that the view was served as: c:\Projects2010\Clients\GorgeNet\Classifieds\ClassifiedsWeb\Classifieds\Show.cshtml rather than c:\Projects2010\Clients\GorgeNet\Classifieds\ClassifiedsWeb\Views\Classifieds\Show.cshtml But of course I didn't notice that right away, just skimming to the end and looking at the file name. The reason that /classifieds/list actually fires that file is that the ASP.NET Web Pages engine looks for physical files on disk that match a path. IOW, when calling Web Pages you drop the .cshtml off the Razor page and IIS will serve that just fine. So: /classifieds/list looks and tries to find /classifieds/list.cshtml and executes that script. And that is exactly what's happening. Web Pages is trying to execute the .cshtml file and it fails because Web Pages knows nothing about the @model tag which is an MVC specific template extension. This is why my breakpoints in the controller methods didn't fire and it also explains why the error mentions that the @model key word is invalid (@model is an MVC provided template enhancement to the Razor Engine). The solution of course is super simple: Delete the accidentally created root folder and the problem is solved. Routing and Physical Paths I've run into problems with this before actually. In the past I've had a number of applications that had a physical /Admin folder which also would conflict with an MVC Admin controller. More than once I ended up wondering why the index route (/Admin/) was not working properly. If a physical /Admin folder exists /Admin will not route to the Index action (or whatever default action you have set up, but instead try to list the directory or show the default document in the folder. The only way to force the index page through MVC is to explicitly use /Admin/Index. Makes perfect sense once you realize the physical folder is there, but that's easy to forget in an MVC application. As you might imagine after a few times of running into this I gave up on the Admin folder and moved everything into MVC views to handle those operations. Still it's one of those things that can easily bite you, because the behavior and error messages seem to point at completely different  problems. Moral of the story is: If you see routing problems where routes are not reaching obvious controller methods, always check to make sure there's isn't a physical path being mapped by IIS instead. That way you won't feel stupid like I did after trying a million things for about an hour before discovering my sloppy mousing behavior :-)© Rick Strahl, West Wind Technologies, 2005-2012Posted in MVC   IIS7   Tweet !function(d,s,id){var js,fjs=d.getElementsByTagName(s)[0];if(!d.getElementById(id)){js=d.createElement(s);js.id=id;js.src="//platform.twitter.com/widgets.js";fjs.parentNode.insertBefore(js,fjs);}}(document,"script","twitter-wjs"); (function() { var po = document.createElement('script'); po.type = 'text/javascript'; po.async = true; po.src = 'https://apis.google.com/js/plusone.js'; var s = document.getElementsByTagName('script')[0]; s.parentNode.insertBefore(po, s); })();

    Read the article

  • Avoid the “Social Silo” - Learn Why and How

    - by Brian Dayton
    Normal 0 false false false EN-US X-NONE X-NONE /* Style Definitions */ table.MsoNormalTable {mso-style-name:"Table Normal"; mso-tstyle-rowband-size:0; mso-tstyle-colband-size:0; mso-style-noshow:yes; mso-style-priority:99; mso-style-qformat:yes; mso-style-parent:""; mso-padding-alt:0in 5.4pt 0in 5.4pt; mso-para-margin-top:0in; mso-para-margin-right:0in; mso-para-margin-bottom:10.0pt; mso-para-margin-left:0in; line-height:115%; mso-pagination:widow-orphan; font-size:11.0pt; font-family:"Calibri","sans-serif"; mso-ascii-font-family:Calibri; mso-ascii-theme-font:minor-latin; mso-fareast-font-family:"Times New Roman"; mso-fareast-theme-font:minor-fareast; mso-hansi-font-family:Calibri; mso-hansi-theme-font:minor-latin;} I’m not going to spend any more real estate than needed on this—social media is big. Facebook hit the Billion user mark in October, that’s 1 out of every 7 humans on the planet. This past Summer (in the Northern hemisphere) Twitter passed the 400 Million Tweet/day mark. The list of social properties and data points goes on and on. Normal 0 false false false EN-US X-NONE X-NONE /* Style Definitions */ table.MsoNormalTable {mso-style-name:"Table Normal"; mso-tstyle-rowband-size:0; mso-tstyle-colband-size:0; mso-style-noshow:yes; mso-style-priority:99; mso-style-qformat:yes; mso-style-parent:""; mso-padding-alt:0in 5.4pt 0in 5.4pt; mso-para-margin-top:0in; mso-para-margin-right:0in; mso-para-margin-bottom:10.0pt; mso-para-margin-left:0in; line-height:115%; mso-pagination:widow-orphan; font-size:11.0pt; font-family:"Calibri","sans-serif"; mso-ascii-font-family:Calibri; mso-ascii-theme-font:minor-latin; mso-fareast-font-family:"Times New Roman"; mso-fareast-theme-font:minor-fareast; mso-hansi-font-family:Calibri; mso-hansi-theme-font:minor-latin;} With social your customer, prospect, or constituent has pervasive access—through mobile—to a global audience, the ability to influence friends, friends of friends, and even people they will never meet. They also have the unique opportunity to forge a deeper relationship with your business—telling you what they like, what they don’t like, how you can help, and what they’d like to see more of. Are you listening? Normal 0 false false false EN-US X-NONE X-NONE /* Style Definitions */ table.MsoNormalTable {mso-style-name:"Table Normal"; mso-tstyle-rowband-size:0; mso-tstyle-colband-size:0; mso-style-noshow:yes; mso-style-priority:99; mso-style-qformat:yes; mso-style-parent:""; mso-padding-alt:0in 5.4pt 0in 5.4pt; mso-para-margin-top:0in; mso-para-margin-right:0in; mso-para-margin-bottom:10.0pt; mso-para-margin-left:0in; line-height:115%; mso-pagination:widow-orphan; font-size:11.0pt; font-family:"Calibri","sans-serif"; mso-ascii-font-family:Calibri; mso-ascii-theme-font:minor-latin; mso-fareast-font-family:"Times New Roman"; mso-fareast-theme-font:minor-fareast; mso-hansi-font-family:Calibri; mso-hansi-theme-font:minor-latin;} What’s the Bottom Line for Business? Businesses need to be where their customers are—on social properties. They need to be available and responsive in those channels—24x7x365. They need to engage and communicate in new ways—sometimes in less than 140 characters and with empathy, not a 1-way megaphone. Finally, businesses need to look at social as an extension of their existing business practices. Not as a silo’d communication channel limited to marketing. Social Can’t Be a Silo – Learn Why @ Oracle CloudWorld When a business is on social networks they represent the whole business. That’s how a customer, constituent, partner or potential candidate sees it. Those organizations that have moved on the opportunity to build closer relationships through social marketing have already made the first step. Social Selling, Service, eCommerce, and Recruiting are external-facing opportunities that leading organizations are moving on right now. This strategy, one of weaving social into and across your business processes—and leveraging social concepts and technologies for internal collaboration—is something you can learn about during an Oracle CloudWorld event in a city near you. You’ll hear and see social relationship management concepts, best-practices, and recommendations woven into topics, discussions, and demonstrations throughout the event—from Marketing and Sales to Service and Human Resources. Stay Tuned and Avoid Potholes By all indications social is here to stay but it’s moving fast and social business strategies are evolving rapidly. At Oracle CloudWorld you’ll also get the opportunity to learn how to avoid some of the potholes on the road to #socialbusiness. Stay tuned to this blog. In future posts I’ll cover some of those potholes including the challenges of Social@Scale and Parallel Processes. Jump-start your social business strategy or learn how to refine and expand what you’re doing already at Oracle CloudWorld. Want to learn more about what Oracle is doing in social? Check out www.oracle.com/social or, if you're looking for a quick read my co-worker, Pat Ma, has a great post on this blog summarizing some popular Social Relationship Management use cases.

    Read the article

  • CodePlex Daily Summary for Sunday, June 01, 2014

    CodePlex Daily Summary for Sunday, June 01, 2014Popular ReleasesSandcastle Help File Builder: Help File Builder and Tools v2014.5.31.0: General InformationIMPORTANT: On some systems, the content of the ZIP file is blocked and the installer may fail to run. Before extracting it, right click on the ZIP file, select Properties, and click on the Unblock button if it is present in the lower right corner of the General tab in the properties dialog. This release completes removal of the branding transformations and implements the new VS2013 presentation style that utilizes the new lightweight website format. Several breaking cha...Tooltip Web Preview: ToolTip Web Preview: Version 1.0Database Helper: Release 1.0.0.0: First Release of Database HelperCoMaSy: CoMaSy1.0.2: !Contact Management SystemImage View Slider: Image View Slider: This is a .NET component. We create this using VB.NET. Here you can use an Image Viewer with several properties to your application form. We wish somebody to improve freely. Try this out! Author : Steven Renaldo Antony Yustinus Arjuna Purnama Putra Andre Wijaya P Martin Lidau PBK GENAP 2014 - TI UKDWAspose for Apache POI: Missing Features of Apache POI WP - v 1.1: Release contain the Missing Features in Apache POI WP SDK in Comparison with Aspose.Words for dealing with Microsoft Word. What's New ?Following Examples: Insert Picture in Word Document Insert Comments Set Page Borders Mail Merge from XML Data Source Moving the Cursor Feedback and Suggestions Many more examples are yet to come here. Keep visiting us. Raise your queries and suggest more examples via Aspose Forums or via this social coding site.babelua: V1.5.6.0: V1.5.6.0 - 2014.5.30New feature: support quick-cocos2d-x project now; support text search in scripts folder now, you can use this function in Search Result Window;SEToolbox: 01.032.014 Release 1: Added fix when loading game Textures for icons causing 'Unable to read beyond the end of the stream'. Added new Resource Report, that displays all in game resources in a concise report. Added in temp directory cleaner, to keep excess files from building up. Fixed use of colors on the windows, to work better with desktop schemes. Adding base support for multilingual resources. This will allow loading of the Space Engineers resources to show localized names, and display localized date a...ClosedXML - The easy way to OpenXML: ClosedXML 0.71.2: More memory and performance improvements. Fixed an issue with pivot table field order.Fancontroller: Fancontroller: Initial releaseVi-AIO SearchBar: Vi – AIO Search Bar: Version 1.0Top Verses ( Ayat Emas ): Binary Top Verses: This one is the bin folder of the component. the .dll component is inside.Traditional Calendar Component: Traditional Calender Converter: Duta Wacana Christian University This file containing Traditional Calendar Component and Demo Aplication that using Traditional Calendar Component. This component made with .NET Framework 4 and the programming language is C# .SQLSetupHelper: 1.0.0.0: First Stable Version of SQL SetupComposite Iconote: Composite Iconote: This is a composite has been made by Microsoft Visual Studio 2013. Requirement: To develop this composite or use this component in your application, your computer must have .NET framework 4.5 or newer.Magick.NET: Magick.NET 6.8.9.101: Magick.NET linked with ImageMagick 6.8.9.1. Breaking changes: - Int/short Set methods of WritablePixelCollection are now unsigned. - The Q16 build no longer uses HDRI, switch to the new Q16-HDRI build if you need HDRI.fnr.exe - Find And Replace Tool: 1.7: Bug fixes Refactored logic for encoding text values to command line to handle common edge cases where find/replace operation works in GUI but not in command line Fix for bug where selection in Encoding drop down was different when generating command line in some cases. It was reported in: https://findandreplace.codeplex.com/workitem/34 Fix for "Backslash inserted before dot in replacement text" reported here: https://findandreplace.codeplex.com/discussions/541024 Fix for finding replacing...VG-Ripper & PG-Ripper: VG-Ripper 2.9.59: changes NEW: Added Support for 'GokoImage.com' links NEW: Added Support for 'ViperII.com' links NEW: Added Support for 'PixxxView.com' links NEW: Added Support for 'ImgRex.com' links NEW: Added Support for 'PixLiv.com' links NEW: Added Support for 'imgsee.me' links NEW: Added Support for 'ImgS.it' linksToolbox for Dynamics CRM 2011/2013: XrmToolBox (v1.2014.5.28): XrmToolbox improvement XrmToolBox updates (v1.2014.5.28)Fix connecting to a connection with custom authentication without saved password Tools improvement New tool!Solution Components Mover (v1.2014.5.22) Transfer solution components from one solution to another one Import/Export NN relationships (v1.2014.3.7) Allows you to import and export many to many relationships Tools updatesAttribute Bulk Updater (v1.2014.5.28) Audit Center (v1.2014.5.28) View Layout Replicator (v1.2014.5.28) Scrip...Microsoft Ajax Minifier: Microsoft Ajax Minifier 5.10: Fix for Issue #20875 - echo switch doesn't work for CSS CSS should honor the SASS source-file comments JS should allow multi-line comment directivesNew ProjectsCet MicroWPF: WPF-like library for simple graphic-UI application using Netduino (Plus) 2 and the FTDI FT800 Eve board.Fakemons: Some Fakmons, powered by XML, XSLT, CSS and JavascriptFling OS: Fling OS is a C# operating system project aiming to create a new, managed operating system from the ground up.MudRoom: Experimental tool sets in mud parsing and area definitionOOP-2112110158: My name's NgocDungRoslynResearch: Roslyn ResearchTHD - Control de Usuarios: control de usuarios y permisosWPF Kinect User Controls: WPF Kinect User Control project provide simple Tilt and Skeleton Tracking Parameter Controls.

    Read the article

  • EC2 instance suddenly refusing SSH connections and won't respond to ping

    - by Chris
    My instance was running fine and this morning I was able to access a Ruby on Rails app hosted on it. An hour later I suddenly wasn't able to access my site, my SSH connection attempts were refused and the server wasn't even responding to ping. I didn't change anything on my system during that hour and reboots aren't fixing it. I've never had any problems connecting or pinging the system before. Can someone please help? This is on my production system! OS: CentOS 5 AMI ID: ami-10b55379 Type: m1.small [] ~% ssh -v *****@meeteor.com OpenSSH_5.2p1, OpenSSL 0.9.8l 5 Nov 2009 debug1: Reading configuration data /etc/ssh_config debug1: Connecting to meeteor.com [184.73.235.191] port 22. debug1: connect to address 184.73.235.191 port 22: Connection refused ssh: connect to host meeteor.com port 22: Connection refused [] ~% ping meeteor.com PING meeteor.com (184.73.235.191): 56 data bytes Request timeout for icmp_seq 0 Request timeout for icmp_seq 1 Request timeout for icmp_seq 2 ^C --- meeteor.com ping statistics --- 4 packets transmitted, 0 packets received, 100.0% packet loss [] ~% ========= System Log ========= Restarting system. Linux version 2.6.16-xenU ([email protected]) (gcc version 4.0.1 20050727 (Red Hat 4.0.1-5)) #1 SMP Mon May 28 03:41:49 SAST 2007 BIOS-provided physical RAM map: Xen: 0000000000000000 - 000000006a400000 (usable) 980MB HIGHMEM available. 727MB LOWMEM available. NX (Execute Disable) protection: active IRQ lockup detection disabled Built 1 zonelists Kernel command line: root=/dev/sda1 ro 4 Enabling fast FPU save and restore... done. Enabling unmasked SIMD FPU exception support... done. Initializing CPU#0 PID hash table entries: 4096 (order: 12, 65536 bytes) Xen reported: 2599.998 MHz processor. Dentry cache hash table entries: 131072 (order: 7, 524288 bytes) Inode-cache hash table entries: 65536 (order: 6, 262144 bytes) Software IO TLB disabled vmalloc area: ee000000-f53fe000, maxmem 2d7fe000 Memory: 1718700k/1748992k available (1958k kernel code, 20948k reserved, 620k data, 144k init, 1003528k highmem) Checking if this processor honours the WP bit even in supervisor mode... Ok. Calibrating delay using timer specific routine.. 5202.30 BogoMIPS (lpj=26011526) Mount-cache hash table entries: 512 CPU: L1 I Cache: 64K (64 bytes/line), D cache 64K (64 bytes/line) CPU: L2 Cache: 1024K (64 bytes/line) Checking 'hlt' instruction... OK. Brought up 1 CPUs migration_cost=0 Grant table initialized NET: Registered protocol family 16 Brought up 1 CPUs xen_mem: Initialising balloon driver. highmem bounce pool size: 64 pages VFS: Disk quotas dquot_6.5.1 Dquot-cache hash table entries: 1024 (order 0, 4096 bytes) Initializing Cryptographic API io scheduler noop registered io scheduler anticipatory registered (default) io scheduler deadline registered io scheduler cfq registered i8042.c: No controller found. RAMDISK driver initialized: 16 RAM disks of 4096K size 1024 blocksize Xen virtual console successfully installed as tty1 Event-channel device installed. netfront: Initialising virtual ethernet driver. mice: PS/2 mouse device common for all mice md: md driver 0.90.3 MAX_MD_DEVS=256, MD_SB_DISKS=27 md: bitmap version 4.39 NET: Registered protocol family 2 Registering block device major 8 IP route cache hash table entries: 65536 (order: 6, 262144 bytes) TCP established hash table entries: 262144 (order: 9, 2097152 bytes) TCP bind hash table entries: 65536 (order: 7, 524288 bytes) TCP: Hash tables configured (established 262144 bind 65536) TCP reno registered TCP bic registered NET: Registered protocol family 1 NET: Registered protocol family 17 NET: Registered protocol family 15 Using IPI No-Shortcut mode md: Autodetecting RAID arrays. md: autorun ... md: ... autorun DONE. kjournald starting. Commit interval 5 seconds EXT3-fs: mounted filesystem with ordered data mode. VFS: Mounted root (ext3 filesystem) readonly. Freeing unused kernel memory: 144k freed *************************************************************** *************************************************************** ** WARNING: Currently emulating unsupported memory accesses ** ** in /lib/tls glibc libraries. The emulation is ** ** slow. To ensure full performance you should ** ** install a 'xen-friendly' (nosegneg) version of ** ** the library, or disable tls support by executing ** ** the following as root: ** ** mv /lib/tls /lib/tls.disabled ** ** Offending process: init (pid=1) ** *************************************************************** *************************************************************** Pausing... 5Pausing... 4Pausing... 3Pausing... 2Pausing... 1Continuing... INIT: version 2.86 booting Welcome to CentOS release 5.4 (Final) Press 'I' to enter interactive startup. Setting clock : Fri Oct 1 14:35:26 EDT 2010 [ OK ] Starting udev: [ OK ] Setting hostname localhost.localdomain: [ OK ] No devices found Setting up Logical Volume Management: [ OK ] Checking filesystems Checking all file systems. [/sbin/fsck.ext3 (1) -- /] fsck.ext3 -a /dev/sda1 /dev/sda1: clean, 275424/1310720 files, 1161123/2621440 blocks [ OK ] Remounting root filesystem in read-write mode: [ OK ] Mounting local filesystems: [ OK ] Enabling local filesystem quotas: [ OK ] Enabling /etc/fstab swaps: [ OK ] INIT: Entering runlevel: 4 Entering non-interactive startup Starting background readahead: [ OK ] Applying ip6tables firewall rules: modprobe: FATAL: Module ip6_tables not found. ip6tables-restore v1.3.5: ip6tables-restore: unable to initializetable 'filter' Error occurred at line: 3 Try `ip6tables-restore -h' or 'ip6tables-restore --help' for more information. [FAILED] Applying iptables firewall rules: [ OK ] Loading additional iptables modules: ip_conntrack_netbios_ns [ OK ] Bringing up loopback interface: [ OK ] Bringing up interface eth0: Determining IP information for eth0... done. [ OK ] Starting auditd: [FAILED] Starting irqbalance: [ OK ] Starting portmap: [ OK ] FATAL: Module lockd not found. Starting NFS statd: [ OK ] Starting RPC idmapd: FATAL: Module sunrpc not found. FATAL: Error running install command for sunrpc Error: RPC MTAB does not exist. Starting system message bus: [ OK ] Starting Bluetooth services:[ OK ] [ OK ] Can't open RFCOMM control socket: Address family not supported by protocol Mounting other filesystems: [ OK ] Starting PC/SC smart card daemon (pcscd): [ OK ] Starting hidd: Can't open HIDP control socket: Address family not supported by protocol [FAILED] Starting autofs: Starting automount: automount: test mount forbidden or incorrect kernel protocol version, kernel protocol version 5.00 or above required. [FAILED] [FAILED] Starting sshd: [ OK ] Starting cups: [ OK ] Starting sendmail: [ OK ] Starting sm-client: [ OK ] Starting console mouse services: no console device found[FAILED] Starting crond: [ OK ] Starting xfs: [ OK ] Starting anacron: [ OK ] Starting atd: [ OK ] % Total % Received % Xferd Average Speed Time Time Time Current Dload Upload Total Spent Left Speed 100 390 100 390 0 0 58130 0 --:--:-- --:--:-- --:--:-- 58130 100 390 100 390 0 0 56984 0 --:--:-- --:--:-- --:--:-- 0 Starting yum-updatesd: [ OK ] Starting Avahi daemon... [ OK ] Starting HAL daemon: [ OK ] Starting OSSEC: [ OK ] Starting smartd: [ OK ] c CentOS release 5.4 (Final) Kernel 2.6.16-xenU on an i686 domU-12-31-39-00-C4-97 login: INIT: Id "2" respawning too fast: disabled for 5 minutes INIT: Id "3" respawning too fast: disabled for 5 minutes INIT: Id "4" respawning too fast: disabled for 5 minutes INIT: Id "5" respawning too fast: disabled for 5 minutes INIT: Id "6" respawning too fast: disabled for 5 minutes

    Read the article

  • Full-text Indexing Books Online

    - by Most Valuable Yak (Rob Volk)
    While preparing for a recent SQL Saturday presentation, I was struck by a crazy idea (shocking, I know): Could someone import the content of SQL Server Books Online into a database and apply full-text indexing to it?  The answer is yes, and it's really quite easy to do. The first step is finding the installed help files.  If you have SQL Server 2012, BOL is installed under the Microsoft Help Library.  You can find the install location by opening SQL Server Books Online and clicking the gear icon for the Help Library Manager.  When the new window pops up click the Settings link, you'll get the following: You'll see the path under Library Location. Once you navigate to that path you'll have to drill down a little further, to C:\ProgramData\Microsoft\HelpLibrary\content\Microsoft\store.  This is where the help file content is kept if you downloaded it for offline use. Depending on which products you've downloaded help for, you may see a few hundred files.  Fortunately they're named well and you can easily find the "SQL_Server_Denali_Books_Online_" files.  We are interested in the .MSHC files only, and can skip the Installation and Developer Reference files. Despite the .MHSC extension, these files are compressed with the standard Zip format, so your favorite archive utility (WinZip, 7Zip, WinRar, etc.) can open them.  When you do, you'll see a few thousand files in the archive.  We are only interested in the .htm files, but there's no harm in extracting all of them to a folder.  7zip provides a command-line utility and the following will extract to a D:\SQLHelp folder previously created: 7z e –oD:\SQLHelp "C:\ProgramData\Microsoft\HelpLibrary\content\Microsoft\store\SQL_Server_Denali_Books_Online_B780_SQL_110_en-us_1.2.mshc" *.htm Well that's great Rob, but how do I put all those files into a full-text index? I'll tell you in a second, but first we have to set up a few things on the database side.  I'll be using a database named Explore (you can certainly change that) and the following setup is a fragment of the script I used in my presentation: USE Explore; GO CREATE SCHEMA help AUTHORIZATION dbo; GO -- Create default fulltext catalog for later FT indexes CREATE FULLTEXT CATALOG FTC AS DEFAULT; GO CREATE TABLE help.files(file_id int not null IDENTITY(1,1) CONSTRAINT PK_help_files PRIMARY KEY, path varchar(256) not null CONSTRAINT UNQ_help_files_path UNIQUE, doc_type varchar(6) DEFAULT('.xml'), content varbinary(max) not null); CREATE FULLTEXT INDEX ON help.files(content TYPE COLUMN doc_type LANGUAGE 1033) KEY INDEX PK_help_files; This will give you a table, default full-text catalog, and full-text index on that table for the content you're going to insert.  I'll be using the command line again for this, it's the easiest method I know: for %a in (D:\SQLHelp\*.htm) do sqlcmd -S. -E -d Explore -Q"set nocount on;insert help.files(path,content) select '%a', cast(c as varbinary(max)) from openrowset(bulk '%a', SINGLE_CLOB) as c(c)" You'll need to copy and run that as one line in a command prompt.  I'll explain what this does while you run it and watch several thousand files get imported: The "for" command allows you to loop over a collection of items.  In this case we want all the .htm files in the D:\SQLHelp folder.  For each file it finds, it will assign the full path and file name to the %a variable.  In the "do" clause, we'll specify another command to be run for each iteration of the loop.  I make a call to "sqlcmd" in order to run a SQL statement.  I pass in the name of the server (-S.), where "." represents the local default instance. I specify -d Explore as the database, and -E for trusted connection.  I then use -Q to run a query that I enclose in double quotes. The query uses OPENROWSET(BULK…SINGLE_CLOB) to open the file as a data source, and to treat it as a single character large object.  In order for full-text indexing to work properly, I have to convert the text content to varbinary. I then INSERT these contents along with the full path of the file into the help.files table created earlier.  This process continues for each file in the folder, creating one new row in the table. And that's it! 5 SQL Statements and 2 command line statements to unzip and import SQL Server Books Online!  In case you're wondering why I didn't use FILESTREAM or FILETABLE, it's simply because I haven't learned them…yet. I may return to this blog after I figure that out and update it with the steps to do so.  I believe that will make it even easier. In the spirit of exploration, I'll leave you to work on some fulltext queries of this content.  I also recommend playing around with the sys.dm_fts_xxxx DMVs (I particularly like sys.dm_fts_index_keywords, it's pretty interesting).  There are additional example queries in the download material for my presentation linked above. Many thanks to Kevin Boles (t) for his advice on (re)checking the content of the help files.  Don't let that .htm extension fool you! The 2012 help files are actually XML, and you'd need to specify '.xml' in your document type column in order to extract the full-text keywords.  (You probably noticed this in the default definition for the doc_type column.)  You can query sys.fulltext_document_types to get a complete list of the types that can be full-text indexed. I also need to thank Hilary Cotter for giving me the original idea. I believe he used MSDN content in a full-text index for an article from waaaaaaaaaaay back, that I can't find now, and had forgotten about until just a few days ago.  He is also co-author of Pro Full-Text Search in SQL Server 2008, which I highly recommend.  He also has some FTS articles on Simple Talk: http://www.simple-talk.com/sql/learn-sql-server/sql-server-full-text-search-language-features/ http://www.simple-talk.com/sql/learn-sql-server/sql-server-full-text-search-language-features,-part-2/

    Read the article

  • Next-Generation Data Integration on Oracle Exadata

    - by Julien Testut
    Normal 0 false false false EN-US X-NONE X-NONE Companies are currently faced with increasing data volumes and retention times while simultaneously batch windows are shrinking. In the ‘Next-Generation Data Integration on Oracle Exadata’ session we will be discussing how Oracle with its innovative Data Integration solution along with Exadata can help companies tackle that challenge. Oracle Data Integrator and Oracle GoldenGate provide industry-leading performance and scalability for data integration on Oracle Exadata. They are both uniquely designed to take full advantage of the power of the database and to eliminate unnecessary middle-tier components which can often be bottlenecks for data movement and transformation. Combined with the extreme performance provided by Exadata our Data Integration products help companies move towards a more efficient and flexible data integration infrastructure. Normal 0 false false false EN-US X-NONE X-NONE /* Style Definitions */ table.MsoNormalTable {mso-style-name:"Table Normal"; mso-tstyle-rowband-size:0; mso-tstyle-colband-size:0; mso-style-noshow:yes; mso-style-priority:99; mso-style-qformat:yes; mso-style-parent:""; mso-padding-alt:0in 5.4pt 0in 5.4pt; mso-para-margin-top:0in; mso-para-margin-right:0in; mso-para-margin-bottom:10.0pt; mso-para-margin-left:0in; line-height:115%; mso-pagination:widow-orphan; font-size:11.0pt; font-family:"Calibri","sans-serif"; mso-ascii-font-family:Calibri; mso-ascii-theme-font:minor-latin; mso-fareast-font-family:"Times New Roman"; mso-fareast-theme-font:minor-fareast; mso-hansi-font-family:Calibri; mso-hansi-theme-font:minor-latin; mso-bidi-font-family:"Times New Roman"; mso-bidi-theme-font:minor-bidi;} If you’re interested in hearing more about how our customers maximize the performance of their Exadata systems while minimizing batch windows, all without adding more hardware resources join us for the following session: Normal 0 false false false EN-US X-NONE X-NONE /* Style Definitions */ table.MsoNormalTable {mso-style-name:"Table Normal"; mso-tstyle-rowband-size:0; mso-tstyle-colband-size:0; mso-style-noshow:yes; mso-style-priority:99; mso-style-qformat:yes; mso-style-parent:""; mso-padding-alt:0in 5.4pt 0in 5.4pt; mso-para-margin-top:0in; mso-para-margin-right:0in; mso-para-margin-bottom:10.0pt; mso-para-margin-left:0in; line-height:115%; mso-pagination:widow-orphan; font-size:11.0pt; font-family:"Calibri","sans-serif"; mso-ascii-font-family:Calibri; mso-ascii-theme-font:minor-latin; mso-fareast-font-family:"Times New Roman"; mso-fareast-theme-font:minor-fareast; mso-hansi-font-family:Calibri; mso-hansi-theme-font:minor-latin; mso-bidi-font-family:"Times New Roman"; mso-bidi-theme-font:minor-bidi;} Normal 0 false false false EN-US X-NONE X-NONE /* Style Definitions */ table.MsoNormalTable {mso-style-name:"Table Normal"; mso-tstyle-rowband-size:0; mso-tstyle-colband-size:0; mso-style-noshow:yes; mso-style-priority:99; mso-style-qformat:yes; mso-style-parent:""; mso-padding-alt:0in 5.4pt 0in 5.4pt; mso-para-margin-top:0in; mso-para-margin-right:0in; mso-para-margin-bottom:10.0pt; mso-para-margin-left:0in; line-height:115%; mso-pagination:widow-orphan; font-size:11.0pt; font-family:"Calibri","sans-serif"; mso-ascii-font-family:Calibri; mso-ascii-theme-font:minor-latin; mso-fareast-font-family:"Times New Roman"; mso-fareast-theme-font:minor-fareast; mso-hansi-font-family:Calibri; mso-hansi-theme-font:minor-latin; mso-bidi-font-family:"Times New Roman"; mso-bidi-theme-font:minor-bidi;} Next-Generation Data Integration on Oracle Exadata  Thursday October, 4th - 11:15AM - 12:15PM Moscone West – Room 3005 We also have many other exciting sessions including 'Oracle Data Integrator Product Update and Future Strategy' on October 2nd at 1:15PM in Moscone West Room 3005. In this session we will discuss the ODI roadmap and its integration with engineered systems such as the Oracle Big Data Appliance. It's a session not to be missed! You can find a list of all the Data Integration sessions happening at Oracle OpenWorld in this document: Focus On Data Integration. If you will not be able to come to OpenWorld, for more information please check out our data sheet Oracle Data Integration Solutions and the Oracle Exadata Database Machine. /* Style Definitions */ table.MsoNormalTable {mso-style-name:"Table Normal"; mso-tstyle-rowband-size:0; mso-tstyle-colband-size:0; mso-style-noshow:yes; mso-style-priority:99; mso-style-qformat:yes; mso-style-parent:""; mso-padding-alt:0in 5.4pt 0in 5.4pt; mso-para-margin-top:0in; mso-para-margin-right:0in; mso-para-margin-bottom:10.0pt; mso-para-margin-left:0in; line-height:115%; mso-pagination:widow-orphan; font-size:11.0pt; font-family:"Calibri","sans-serif"; mso-ascii-font-family:Calibri; mso-ascii-theme-font:minor-latin; mso-fareast-font-family:"Times New Roman"; mso-fareast-theme-font:minor-fareast; mso-hansi-font-family:Calibri; mso-hansi-theme-font:minor-latin; mso-bidi-font-family:"Times New Roman"; mso-bidi-theme-font:minor-bidi;}

    Read the article

  • How can unrealscript halt event handler execution after an arbitrary number of lines with no return or error?

    - by Dan Cowell
    I have created a class that extends TcpLink and is instantiated in a custom Kismet Sequence Action. It is being instantiated correctly and is making the GET HTTP request that I need it to (I have checked my access log in apache) and Apache is responding to the request with the appropriate content. The problem I have is that I'm using the event receive mode and it appears that somehow the handler for the Opened event is halted after a specific number of lines of code have executed. Here is my code for the Opened event: event Opened() { // A connection was established WorldInfo.Game.Broadcast(self, "[DNomad_TcpLinkClient] event opened"); WorldInfo.Game.Broadcast(self, "[DNomad_TcpLinkClient] Sending simple HTTP query"); //The HTTP GET request //char(13) and char(10) are carrage returns and new lines requesttext = "userId="$userId$"&apartmentId="$apartmentId; SendText("GET /"$path$"?"$requesttext$" HTTP/1.0"); SendText(chr(13)$chr(10)); SendText("Host: "$TargetHost); SendText(chr(13)$chr(10)); SendText("Connection: Close"); SendText(chr(13)$chr(10)$chr(13)$chr(10)); //WorldInfo.Game.Broadcast(self, "[DNomad_TcpLinkClient] Sent request: "$requesttext); //WorldInfo.Game.Broadcast(self, "[DNomad_TcpLinkClient] end HTTP query"); //WorldInfo.Game.Broadcast(self, "[DNomad_TcpLinkClient] LinkState: "$LinkState); //WorldInfo.Game.Broadcast(self, "[DNomad_TcpLinkClient] LinkMode: "$LinkMode); WorldInfo.Game.Broadcast(self, "[DNomad_TcpLinkClient] ReceiveMode: "$ReceiveMode); WorldInfo.Game.Broadcast(self, "[DNomad_TcpLinkClient] Error: "$string(GetLastError())); } As you can see, a number of the Broadcast calls have been commented out. Initially, only the lines up to the Broadcast containing "[DNomad_TcpLinkClient] Sent request: " were being executed and none of the Broadcasts were commented out. After commenting out that line, the next Broadcast was successful and so on and so forth. As a test, I commented out the very first Broadcast to see if the connection closing had any effect: // A connection was established //WorldInfo.Game.Broadcast(self, "[DNomad_TcpLinkClient] event opened"); WorldInfo.Game.Broadcast(self, "[DNomad_TcpLinkClient] Sending simple HTTP query"); Upon doing that, an additional Broadcast at the end of the function executed. Thus the inference that there is an upper limit to the number of lines executed. Additionally, my ReceivedText handler is never called, despite Apache returning the correct HTTP 200 response with a body. My working hypothesis is that somehow after the Sequence Action finishes executing the garbage collector cleans up the TcpLinkClient instance. My biggest source of confusion with that is how on earth it does it during the execution of an event handler. Has anyone ever seen anything like this before? My full TcpLinkClient class is below: /* * TcpLinkClient based on an example usage of the TcpLink class by Michiel 'elmuerte' Hendriks for Epic Games, Inc. * */ class DNomad_TcpLinkClient extends TcpLink; var PlayerController PC; var string TargetHost; var int TargetPort; var string path; var string requesttext; var string userId; var string apartmentId; var string statusCode; var string responseData; event PostBeginPlay() { super.PostBeginPlay(); } function DoTcpLinkRequest(string uid, string id) //removes having to send a host { userId = uid; apartmentId = id; Resolve(targethost); } function string GetStatus() { return statusCode; } event Resolved( IpAddr Addr ) { // The hostname was resolved succefully WorldInfo.Game.Broadcast(self, "[DNomad_TcpLinkClient] "$TargetHost$" resolved to "$ IpAddrToString(Addr)); // Make sure the correct remote port is set, resolving doesn't set // the port value of the IpAddr structure Addr.Port = TargetPort; //dont comment out this log because it rungs the function bindport WorldInfo.Game.Broadcast(self, "[DNomad_TcpLinkClient] Bound to port: "$ BindPort() ); if (!Open(Addr)) { WorldInfo.Game.Broadcast(self, "[DNomad_TcpLinkClient] Open failed"); } } event ResolveFailed() { WorldInfo.Game.Broadcast(self, "[TcpLinkClient] Unable to resolve "$TargetHost); // You could retry resolving here if you have an alternative // remote host. //send failed message to scaleform UI //JunHud(JunPlayerController(PC).myHUD).JunMovie.CallSetHTML("Failed"); } event Opened() { // A connection was established //WorldInfo.Game.Broadcast(self, "[DNomad_TcpLinkClient] event opened"); WorldInfo.Game.Broadcast(self, "[DNomad_TcpLinkClient] Sending simple HTTP query"); //The HTTP GET request //char(13) and char(10) are carrage returns and new lines requesttext = "userId="$userId$"&apartmentId="$apartmentId; SendText("GET /"$path$"?"$requesttext$" HTTP/1.0"); SendText(chr(13)$chr(10)); SendText("Host: "$TargetHost); SendText(chr(13)$chr(10)); SendText("Connection: Close"); SendText(chr(13)$chr(10)$chr(13)$chr(10)); //WorldInfo.Game.Broadcast(self, "[DNomad_TcpLinkClient] Sent request: "$requesttext); //WorldInfo.Game.Broadcast(self, "[DNomad_TcpLinkClient] end HTTP query"); //WorldInfo.Game.Broadcast(self, "[DNomad_TcpLinkClient] LinkState: "$LinkState); //WorldInfo.Game.Broadcast(self, "[DNomad_TcpLinkClient] LinkMode: "$LinkMode); WorldInfo.Game.Broadcast(self, "[DNomad_TcpLinkClient] ReceiveMode: "$ReceiveMode); WorldInfo.Game.Broadcast(self, "[DNomad_TcpLinkClient] Error: "$string(GetLastError())); } event Closed() { // In this case the remote client should have automatically closed // the connection, because we requested it in the HTTP request. WorldInfo.Game.Broadcast(self, "Connection closed."); // After the connection was closed we could establish a new // connection using the same TcpLink instance. } event ReceivedText( string Text ) { WorldInfo.Game.Broadcast(self, "Received Text: "$Text); //we dont want the header info, so we split the string after two new lines Text = Split(Text, chr(13)$chr(10)$chr(13)$chr(10), true); WorldInfo.Game.Broadcast(self, "Split Text: "$Text); statusCode = Text; } event ReceivedLine( string Line ) { WorldInfo.Game.Broadcast(self, "Received Line: "$Line); } event ReceivedBinary( int Count, byte B[255] ) { WorldInfo.Game.Broadcast(self, "Received Binary of length: "$Count); } defaultproperties { TargetHost="127.0.0.1" TargetPort=80 //default for HTTP LinkMode=MODE_Text ReceiveMode=RMODE_Event path = "dnomad/datafeed.php" userId = "0"; apartmentId = "0"; statusCode = ""; send = false; }

    Read the article

  • Mobile BI Comes of Age

    - by rich.clayton(at)oracle.com
    Normal 0 false false false EN-US X-NONE X-NONE /* Style Definitions */ table.MsoNormalTable {mso-style-name:"Table Normal"; mso-tstyle-rowband-size:0; mso-tstyle-colband-size:0; mso-style-noshow:yes; mso-style-priority:99; mso-style-qformat:yes; mso-style-parent:""; mso-padding-alt:0in 5.4pt 0in 5.4pt; mso-para-margin-top:0in; mso-para-margin-right:0in; mso-para-margin-bottom:10.0pt; mso-para-margin-left:0in; line-height:115%; mso-pagination:widow-orphan; font-size:11.0pt; font-family:"Calibri","sans-serif"; mso-ascii-font-family:Calibri; mso-ascii-theme-font:minor-latin; mso-fareast-font-family:"Times New Roman"; mso-fareast-theme-font:minor-fareast; mso-hansi-font-family:Calibri; mso-hansi-theme-font:minor-latin;} Normal 0 false false false EN-US X-NONE X-NONE /* Style Definitions */ table.MsoNormalTable {mso-style-name:"Table Normal"; mso-tstyle-rowband-size:0; mso-tstyle-colband-size:0; mso-style-noshow:yes; mso-style-priority:99; mso-style-qformat:yes; mso-style-parent:""; mso-padding-alt:0in 5.4pt 0in 5.4pt; mso-para-margin-top:0in; mso-para-margin-right:0in; mso-para-margin-bottom:10.0pt; mso-para-margin-left:0in; line-height:115%; mso-pagination:widow-orphan; font-size:11.0pt; font-family:"Calibri","sans-serif"; mso-ascii-font-family:Calibri; mso-ascii-theme-font:minor-latin; mso-fareast-font-family:"Times New Roman"; mso-fareast-theme-font:minor-fareast; mso-hansi-font-family:Calibri; mso-hansi-theme-font:minor-latin;} Normal 0 false false false EN-US X-NONE X-NONE MicrosoftInternetExplorer4 /* Style Definitions */ table.MsoNormalTable {mso-style-name:"Table Normal"; mso-tstyle-rowband-size:0; mso-tstyle-colband-size:0; mso-style-noshow:yes; mso-style-priority:99; mso-style-qformat:yes; mso-style-parent:""; mso-padding-alt:0in 5.4pt 0in 5.4pt; mso-para-margin-top:0in; mso-para-margin-right:0in; mso-para-margin-bottom:10.0pt; mso-para-margin-left:0in; line-height:115%; mso-pagination:widow-orphan; font-size:11.0pt; font-family:"Calibri","sans-serif"; mso-ascii-font-family:Calibri; mso-ascii-theme-font:minor-latin; mso-fareast-font-family:"Times New Roman"; mso-fareast-theme-font:minor-fareast; mso-hansi-font-family:Calibri; mso-hansi-theme-font:minor-latin;} One of the hot topics in the Business Intelligence industry is mobility.  More specifically the question is how business can be transformed by the iPhone and the iPad.  In June 2003, Gartner predicted that Mobile BI would be obsolete and that the technology was headed for the 'trough of disillusionment'.  I agreed with them at that time.  Many vendors like MicroStrategy and Business Objects jumped into the fray attempting to show how PDA's like Palm Pilots could be integrated with BI.  Their investments resulted in interesting demos with no commercial traction.  Why, because wireless networks and mobile operating systems were primitive, immature and slow. In my opinion, Apple's iOS has changed everything in Mobile BI.  Yes Blackberry, Android and Symbian and all the rest have their place in the market but I believe that increasingly consumers (not IT departments) influence BI decision making processes.  Consumers are choosing the iPhone and the iPad. The number of iPads I see in business meetings now is staggering.  Some use it for email and note taking and others are starting to use corporate applications.  The possibilities for Mobile BI are countless and I would expect to see iPads enterprise-wide over the next few years.   These new devices will provide just-in-time access to critical business information.  Front-line managers interacting with customers, suppliers, patients or citizens will have information literally at their fingertips. I've experimented with several mobile BI tools.  They look cool but like their Executive Information System (EIS) predecessors of the 1990's these tools lack a backbone and a plausible integration strategy.  EIS was a viral technology in the early 1990's.  Executives from every industry and job function were showcasing their dashboards to fellow co-workers and colleagues at the country club.  Just like the iPad, every senior manager wanted one.  EIS wasn't a device however, it was a software application.   EIS quickly faded into the software sunset as it lacked integration with corporate information systems.  BI servers  replaced EIS because the technology focused on the heavy data lifting of integrating, normalizing, aggregating and managing large, complex data volumes.  The devices are here to stay. The cute stand-alone mobile BI tools, not so much. If all you're looking to do is put Excel files on your iPad, there are plenty of free tools on the market.  You'll look cool at your next management meeting but after a few weeks, the cool factor will fade away and you'll be wondering how you will ever maintain it.  If however you want secure, consistent, reliable information on your iPad, you need an integration strategy and a way to model the data.  BI Server technologies like the Oracle BI Foundation is a market leading approach to tackle that issue. I liken the BI mobility frenzy to buying classic cars.  Classic Cars have two buying groups - teenagers and middle-age folks looking to tinker.  Teenagers look at the pin-stripes and the paint job while middle-agers (like me)  kick the tires a bit and look under the hood to check out the quality and reliability of the engine.  Mobile BI tools sure look sexy but don't go very far without an engine and a transmission or an integration strategy. The strategic question in Mobile BI is can these startups build a motor and transmission faster than Oracle can re-paint the car?  Oracle has a great engine and a transmission that connects to all enterprise information assets.  We're working on the new paint job and are excited about the possibilities.  Just as vertical integration worked in the automotive business, it too works in the technology industry.

    Read the article

  • CodePlex Daily Summary for Monday, June 02, 2014

    CodePlex Daily Summary for Monday, June 02, 2014Popular ReleasesPortable Class Library for SQLite: Portable Class Library for SQLite - 3.8.4.4: This pull request from mattleibow addresses an issue with custom function creation (define functions in C# code and invoke them from SQLite as id they where regular SQL functions). Impact: Xamarin iOSTweetinvi a friendly Twitter C# API: Tweetinvi 0.9.3.x: Timelines- Added all the parameters available from the Timeline Endpoints in Tweetinvi. - This is available for HomeTimeline, UserTimeline, MentionsTimeline // Simple query var tweets = Timeline.GetHomeTimeline(); // Create a parameter for queries with specific parameters var timelineParameter = Timeline.GenerateHomeTimelineRequestParameter(); timelineParameter.ExcludeReplies = true; timelineParameter.TrimUser = true; var tweets = Timeline.GetHomeTimeline(timelineParameter); Tweets- Add mis...Sandcastle Help File Builder: Help File Builder and Tools v2014.5.31.0: General InformationIMPORTANT: On some systems, the content of the ZIP file is blocked and the installer may fail to run. Before extracting it, right click on the ZIP file, select Properties, and click on the Unblock button if it is present in the lower right corner of the General tab in the properties dialog. This release completes removal of the branding transformations and implements the new VS2013 presentation style that utilizes the new lightweight website format. Several breaking cha...Tooltip Web Preview: ToolTip Web Preview: Version 1.0Database Helper: Release 1.0.0.0: First Release of Database HelperCoMaSy: CoMaSy1.0.2: !Contact Management SystemImage View Slider: Image View Slider: This is a .NET component. We create this using VB.NET. Here you can use an Image Viewer with several properties to your application form. We wish somebody to improve freely. Try this out! Author : Steven Renaldo Antony Yustinus Arjuna Purnama Putra Andre Wijaya P Martin Lidau PBK GENAP 2014 - TI UKDWAspose for Apache POI: Missing Features of Apache POI WP - v 1.1: Release contain the Missing Features in Apache POI WP SDK in Comparison with Aspose.Words for dealing with Microsoft Word. What's New ?Following Examples: Insert Picture in Word Document Insert Comments Set Page Borders Mail Merge from XML Data Source Moving the Cursor Feedback and Suggestions Many more examples are yet to come here. Keep visiting us. Raise your queries and suggest more examples via Aspose Forums or via this social coding site.SEToolbox: 01.032.014 Release 1: Added fix when loading game Textures for icons causing 'Unable to read beyond the end of the stream'. Added new Resource Report, that displays all in game resources in a concise report. Added in temp directory cleaner, to keep excess files from building up. Fixed use of colors on the windows, to work better with desktop schemes. Adding base support for multilingual resources. This will allow loading of the Space Engineers resources to show localized names, and display localized date a...ClosedXML - The easy way to OpenXML: ClosedXML 0.71.2: More memory and performance improvements. Fixed an issue with pivot table field order.Vi-AIO SearchBar: Vi – AIO Search Bar: Version 1.0Top Verses ( Ayat Emas ): Binary Top Verses: This one is the bin folder of the component. the .dll component is inside.Traditional Calendar Component: Traditional Calender Converter: Duta Wacana Christian University This file containing Traditional Calendar Component and Demo Aplication that using Traditional Calendar Component. This component made with .NET Framework 4 and the programming language is C# .SQLSetupHelper: 1.0.0.0: First Stable Version of SQL SetupComposite Iconote: Composite Iconote: This is a composite has been made by Microsoft Visual Studio 2013. Requirement: To develop this composite or use this component in your application, your computer must have .NET framework 4.5 or newer.Magick.NET: Magick.NET 6.8.9.101: Magick.NET linked with ImageMagick 6.8.9.1. Breaking changes: - Int/short Set methods of WritablePixelCollection are now unsigned. - The Q16 build no longer uses HDRI, switch to the new Q16-HDRI build if you need HDRI.fnr.exe - Find And Replace Tool: 1.7: Bug fixes Refactored logic for encoding text values to command line to handle common edge cases where find/replace operation works in GUI but not in command line Fix for bug where selection in Encoding drop down was different when generating command line in some cases. It was reported in: https://findandreplace.codeplex.com/workitem/34 Fix for "Backslash inserted before dot in replacement text" reported here: https://findandreplace.codeplex.com/discussions/541024 Fix for finding replacing...VG-Ripper & PG-Ripper: VG-Ripper 2.9.59: changes NEW: Added Support for 'GokoImage.com' links NEW: Added Support for 'ViperII.com' links NEW: Added Support for 'PixxxView.com' links NEW: Added Support for 'ImgRex.com' links NEW: Added Support for 'PixLiv.com' links NEW: Added Support for 'imgsee.me' links NEW: Added Support for 'ImgS.it' linksToolbox for Dynamics CRM 2011/2013: XrmToolBox (v1.2014.5.28): XrmToolbox improvement XrmToolBox updates (v1.2014.5.28)Fix connecting to a connection with custom authentication without saved password Tools improvement New tool!Solution Components Mover (v1.2014.5.22) Transfer solution components from one solution to another one Import/Export NN relationships (v1.2014.3.7) Allows you to import and export many to many relationships Tools updatesAttribute Bulk Updater (v1.2014.5.28) Audit Center (v1.2014.5.28) View Layout Replicator (v1.2014.5.28) Scrip...Microsoft Ajax Minifier: Microsoft Ajax Minifier 5.10: Fix for Issue #20875 - echo switch doesn't work for CSS CSS should honor the SASS source-file comments JS should allow multi-line comment directivesNew Projects[ISEN] Rendu de projet Naughty3Dogs - Pong3D: Pong3D est un jeu qui reprend le principe classique du Pong en le portant dans un environnement 3D à l'aide du langage c# et du moteur Unity3DBootstrap for MVC: Bootstrap for MVC.F. A. Q. - Najczesciej zadawane pytania: FAQForuMvc: Technifutur short projecthomework456: no.iStoody: Studies organize solution, available through app for Windows and Windows Phone.liaoliao: ???????????Price Tracker: Allows a user to track prices based on parsed emailsRoslynEval: RoslynRx Hub: Rx Hub provides server side computation which initiate by subscriber requestSharepoint Online AppCache Reset: We are an IT resource company providing Virtual IT services and custom and opensource programs for everyday needs. UnitConversionLib : Smart Unit Conversion Library in C#: Conversion of units, arithmetic operation and parsing quantities with their units on run time. Smart unit converter and conversion lib for physical quantities,

    Read the article

  • Oracle Enterprise Manager Ops Center : Using Operational Profiles to Install Packages and other Content

    - by LeonShaner
    Oracle Enterprise Manager Ops Center provides numerous ways to deploy content, such as through OS Update Profiles, or as part of an OS Provisioning plan or combinations of those and other "Install Software" capabilities of Deployment Plans.  This short "how-to" blog will highlight an alternative way to deploy content using Operational Profiles. Usually we think of Operational Profiles as a way to execute a simple "one-time" script to perform a basic system administration function, which can optionally be based on user input; however, Operational Profiles can be much more powerful than that.  There is often more to performing an action than merely running a script -- sometimes configuration files, packages, binaries, and other scripts, etc. are needed to perform the action, and sometimes the user would like to leave such content on the system for later use. For shell scripts and other content written to be generic enough to work on any flavor of UNIX, converting the same scripts and configuration files into Solaris 10 SVR4 package, Solaris 11 IPS package, and/or a Linux RPM's might be seen as three times the work, for little appreciable gain.   That is where using an Operational Profile to deploy simple scripts and other generic content can be very helpful.  The approach is so powerful, that pretty much any kind of content can be deployed using an Operational Profile, provided the files involved are not overly large, and it is not necessary to convert the content into UNIX variant-specific formats. The basic formula for deploying content with an Operational Profile is as follows: Begin with a traditional script header, which is a UNIX shell script that will be responsible for decoding and extracting content, copying files into the right places, and executing any other scripts and commands needed to install and configure that content. Include steps to make the script platform-aware, to do the right thing for a given UNIX variant, or a "sorry" message if the operator has somehow tried to run the Operational Profile on a system where the script is not designed to run.  Ops Center can constrain execution by target type, so such checks at this level are an added safeguard, but also useful with the generic target type of "Operating System" where the admin wants the script to "do the right thing," whatever the UNIX variant. Include helpful output to show script progress, and any other informational messages that can help the admin determine what has gone wrong in the case of a problem in script execution.  Such messages will be shown in the job execution log. Include necessary "clean up" steps for normal and error exit conditions Set non-zero exit codes when appropriate -- a non-zero exit code will cause an Operational Profile job to be marked failed, which is the admin's cue to look into the job details for diagnostic messages in the output from the script. That first bullet deserves some explanation.  If Operational Profiles are usually simple "one-time" scripts and binary content is not allowed, then how does the actual content, packages, binaries, and other scripts get delivered along with the script?  More specifically, how does one include such content without needing to first create some kind of traditional package?   All that is required is to simply encode the content and append it to the end of the Operational Profile.  The header portion of the Operational Profile will need to contain the commands to decode the embedded content that has been appended to the bottom of the script.  The header code can do whatever else is needed, and finally clean up any intermediate files that were created during the decoding and extraction of the content. One way to encode binary and other content for inclusion in a script is to use the "uuencode" utility to convert the content into simple base64 ASCII text -- a form that is suitable to be appended to an Operational Profile.   The behavior of the "uudecode" utility is such that it will skip over any parts of the input that do not fit the uuencoded "begin" and "end" clauses.  For that reason, your header script will be skipped over, and uudecode will find your embedded content, that you will uuencode and paste at the end of the Operational Profile.  You can have as many "begin" / "end" clauses as you need -- just separate each embedded file by an empty line between "begin" and "end" clauses. Example:  Install SUNWsneep and set the system serial number Script:  deploySUNWsneep.sh ( <- right-click / save to download) Highlights: #!/bin/sh # Required variables: OC_SERIAL="$OC_SERIAL" # The user-supplied serial number for the asset ... Above is a good practice, showing right up front what kind of input the Operational Profile will require.   The right-hand side where $OC_SERIAL appears in this example will be filled in by Ops Center based on the user input at deployment time. The script goes on to restrict the use of the program to the intended OS type (Solaris 10 or older, in this example, but other content might be suitable for Solaris 11, or Linux -- it depends on the content and the script that will handle it). A temporary working directory is created, and then we have the command that decodes the embedded content from "self" which in scripting terms is $0 (a variable that expands to the name of the currently executing script): # Pass myself through uudecode, which will extract content to the current dir uudecode $0 At that point, whatever content was appended in uuencoded form at the end of the script has been written out to the current directory.  In this example that yields a file, SUNWsneep.7.0.zip, which the rest of the script proceeds to unzip, and pkgadd, followed by running "/opt/SUNWsneep/bin/sneep -s $OC_SERIAL" which is the command that stores the system serial for future use by other programs such as Explorer.   Don't get hung up on the example having used a pkgadd command.  The content started as a zip file and it could have been a tar.gz, or any other file.  This approach simply decodes the file.  The header portion of the script has to make sense of the file and do the right thing (e.g. it's up to you). The script goes on to clean up after itself, whether or not the above was successful.  Errors are echo'd by the script and a non-zero exit code is set where appropriate. Second to last, we have: # just in case, exit explicitly, so that uuencoded content will not cause error OPCleanUP exit # The rest of the script is ignored, except by uudecode # # UUencoded content follows # # e.g. for each file needed, #  $ uuencode -m {source} {source} > {target}.uu5 # then paste the {target}.uu5 files below # they will be extracted into the workding dir at $TDIR # The commentary above also describes how to encode the content. Finally we have the uuencoded content: begin-base64 444 SUNWsneep.7.0.zip UEsDBBQAAAAIAPsRy0Di3vnukAAAAMcAAAAKABUAcmVhZG1lLnR4dFVUCQADOqnVT7up ... VXgAAFBLBQYAAAAAAgACAJEAAADTNwEAAAA= ==== That last line of "====" is the base64 uuencode equivalent of a blank line, followed by "end" and as mentioned you can have as many begin/end clauses as you need.  Just separate each embedded file by a blank line after each ==== and before each begin-base64. Deploying the example Operational Profile looks like this (where I have pasted the system serial number into the required field): The job succeeded, but here is an example of the kind of diagnostic messages that the example script produces, and how Ops Center displays them in the job details: This same general approach could be used to deploy Explorer, and other useful utilities and scripts. Please let us know what you think?  Until next time...\Leon-- Leon Shaner | Senior IT/Product ArchitectSystems Management | Ops Center Engineering @ Oracle The views expressed on this [blog; Web site] are my own and do not necessarily reflect the views of Oracle. For more information, please go to Oracle Enterprise Manager  web page or  follow us at :  Twitter | Facebook | YouTube | Linkedin | Newsletter

    Read the article

  • Following my passion

    - by Maria Sandu
    Normal 0 false false false EN-US X-NONE X-NONE /* Style Definitions */ table.MsoNormalTable {mso-style-name:"Table Normal"; mso-tstyle-rowband-size:0; mso-tstyle-colband-size:0; mso-style-noshow:yes; mso-style-priority:99; mso-style-qformat:yes; mso-style-parent:""; mso-padding-alt:0cm 5.4pt 0cm 5.4pt; mso-para-margin-top:0cm; mso-para-margin-right:0cm; mso-para-margin-bottom:10.0pt; mso-para-margin-left:0cm; line-height:115%; mso-pagination:widow-orphan; font-family:"Calibri","sans-serif"; mso-ascii- mso-ascii-theme-font:minor-latin; mso-hansi- mso-hansi-theme-font:minor-latin; mso-bidi-font-family:"Times New Roman"; mso-bidi-theme-font:minor-bidi; mso-ansi-language:RO;} Normal 0 false false false EN-US X-NONE X-NONE /* Style Definitions */ table.MsoNormalTable {mso-style-name:"Table Normal"; mso-tstyle-rowband-size:0; mso-tstyle-colband-size:0; mso-style-noshow:yes; mso-style-priority:99; mso-style-qformat:yes; mso-style-parent:""; mso-padding-alt:0cm 5.4pt 0cm 5.4pt; mso-para-margin-top:0cm; mso-para-margin-right:0cm; mso-para-margin-bottom:10.0pt; mso-para-margin-left:0cm; line-height:115%; mso-pagination:widow-orphan; font-family:"Calibri","sans-serif"; mso-ascii- mso-ascii-theme-font:minor-latin; mso-hansi- mso-hansi-theme-font:minor-latin; mso-bidi-font-family:"Times New Roman"; mso-bidi-theme-font:minor-bidi; mso-ansi-language:RO;} Normal 0 false false false EN-US X-NONE X-NONE /* Style Definitions */ table.MsoNormalTable {mso-style-name:"Table Normal"; mso-tstyle-rowband-size:0; mso-tstyle-colband-size:0; mso-style-noshow:yes; mso-style-priority:99; mso-style-qformat:yes; mso-style-parent:""; mso-padding-alt:0cm 5.4pt 0cm 5.4pt; mso-para-margin-top:0cm; mso-para-margin-right:0cm; mso-para-margin-bottom:10.0pt; mso-para-margin-left:0cm; line-height:115%; mso-pagination:widow-orphan; font-family:"Calibri","sans-serif"; mso-ascii- mso-ascii-theme-font:minor-latin; mso-hansi- mso-hansi-theme-font:minor-latin; mso-bidi-font-family:"Times New Roman"; mso-bidi-theme-font:minor-bidi; mso-ansi-language:RO;} What makes you go the extra mile? What makes you move forward and be ambitious? My name is Alin Gheorghe and I am currently working as a Contracts Administrator in the Shared Service Centre in Bucharest, Romania. I have graduated from the Political Science Faculty of the National School of Political and Administrative Studies here in Bucharest and I am currently undergoing a Master Program on Security and Diplomacy at the same university. Although I have been working a full time job here at Oracle since January 2011 and also going to school after work, I am going to tell you how I spend my spare time and about my passion. I always thought that if one doesn’t have something that he would consider a passion it’s always just a matter of time until he would discover one. Looking back, I can tell you that I discovered mine when I was 14 years old and I remember watching a football game when suddenly I became fascinated by the “man in black” that all football players obeyed during the match. That year I attended and promoted a referee course within my local referee committee and about 6 months later I was delegated to my first official game at youth tournament. Almost 10 years have passed since then and I can tell you that I very much love and appreciate this activity that I have spent doing, each and every weekend, 9 months every year, acquiring more than 600 official games until now. And even if not having a real free weekend or holiday might be sound very consuming, I can say that having something I am passionate about helps me to keep myself balanced and happy while giving me an option to channel any stress or anxiety I may feel. I think it’s important to have something of your own besides work that you spend time and effort on. Whether it’s painting, writing or a sport, having a passion can only have a positive effect on your life. And as every extra thing, it’s not always easy to follow your passion, but is it worth it? Speaking from my own experience I am sure it is, and here are some tips and tricks I constantly use not to give up on my passion: Normal 0 false false false EN-US X-NONE X-NONE -"/ /* Style Definitions */ table.MsoNormalTable {mso-style-name:"Table Normal"; mso-tstyle-rowband-size:0; mso-tstyle-colband-size:0; mso-style-noshow:yes; mso-style-priority:99; mso-style-qformat:yes; mso-style-parent:""; mso-padding-alt:0cm 5.4pt 0cm 5.4pt; mso-para-margin-top:0cm; mso-para-margin-right:0cm; mso-para-margin-bottom:10.0pt; mso-para-margin-left:0cm; line-height:115%; mso-pagination:widow-orphan; font-family:"Calibri","sans-serif"; mso-ascii- mso-ascii-theme-font:minor-latin; mso-hansi- mso-hansi-theme-font:minor-latin; mso-bidi-font-family:"Times New Roman"; mso-bidi-theme-font:minor-bidi; mso-ansi-language:RO;} No matter how much time you spend at work and how much credit you get for that, it will always be the passion related achievements that will comfort you more and boost your self esteem and nothing compares to that feeling you get. I always try to keep this in mind so that each time I think about giving up I get even more ambitious to move forward. Everybody can just do what they are paid to do or what they are requested to do at work but not everybody can go that extra mile when it comes to following their passion and putting in extra work for that. By exercising this constantly you get used to also applying this attitude on the work related tasks. It takes accurate planning, anticipation and forecasting in order to combine your work with your passion. Therefore having a full schedule and keeping up with it will only help develop and exercise such skills and also will prove to you that you are up to such a challenge. I always keep in mind as a final goal that if you get very good at your passion you can actually start earning from it. And I think that is the ultimate level when you can say that you make a living by doing exactly what you are passionate about. In conclusion, by taking the easy way not only do you miss out on something nice, but life’s priceless rewards are usually given by those things that you actually believe in and know how to stand up for over time.

    Read the article

  • Why Is Vertical Resolution Monitor Resolution so Often a Multiple of 360?

    - by Jason Fitzpatrick
    Stare at a list of monitor resolutions long enough and you might notice a pattern: many of the vertical resolutions, especially those of gaming or multimedia displays, are multiples of 360 (720, 1080, 1440, etc.) But why exactly is this the case? Is it arbitrary or is there something more at work? Today’s Question & Answer session comes to us courtesy of SuperUser—a subdivision of Stack Exchange, a community-driven grouping of Q&A web sites. The Question SuperUser reader Trojandestroy recently noticed something about his display interface and needs answers: YouTube recently added 1440p functionality, and for the first time I realized that all (most?) vertical resolutions are multiples of 360. Is this just because the smallest common resolution is 480×360, and it’s convenient to use multiples? (Not doubting that multiples are convenient.) And/or was that the first viewable/conveniently sized resolution, so hardware (TVs, monitors, etc) grew with 360 in mind? Taking it further, why not have a square resolution? Or something else unusual? (Assuming it’s usual enough that it’s viewable). Is it merely a pleasing-the-eye situation? So why have the display be a multiple of 360? The Answer SuperUser contributor User26129 offers us not just an answer as to why the numerical pattern exists but a history of screen design in the process: Alright, there are a couple of questions and a lot of factors here. Resolutions are a really interesting field of psychooptics meeting marketing. First of all, why are the vertical resolutions on youtube multiples of 360. This is of course just arbitrary, there is no real reason this is the case. The reason is that resolution here is not the limiting factor for Youtube videos – bandwidth is. Youtube has to re-encode every video that is uploaded a couple of times, and tries to use as little re-encoding formats/bitrates/resolutions as possible to cover all the different use cases. For low-res mobile devices they have 360×240, for higher res mobile there’s 480p, and for the computer crowd there is 360p for 2xISDN/multiuser landlines, 720p for DSL and 1080p for higher speed internet. For a while there were some other codecs than h.264, but these are slowly being phased out with h.264 having essentially ‘won’ the format war and all computers being outfitted with hardware codecs for this. Now, there is some interesting psychooptics going on as well. As I said: resolution isn’t everything. 720p with really strong compression can and will look worse than 240p at a very high bitrate. But on the other side of the spectrum: throwing more bits at a certain resolution doesn’t magically make it better beyond some point. There is an optimum here, which of course depends on both resolution and codec. In general: the optimal bitrate is actually proportional to the resolution. So the next question is: what kind of resolution steps make sense? Apparently, people need about a 2x increase in resolution to really see (and prefer) a marked difference. Anything less than that and many people will simply not bother with the higher bitrates, they’d rather use their bandwidth for other stuff. This has been researched quite a long time ago and is the big reason why we went from 720×576 (415kpix) to 1280×720 (922kpix), and then again from 1280×720 to 1920×1080 (2MP). Stuff in between is not a viable optimization target. And again, 1440P is about 3.7MP, another ~2x increase over HD. You will see a difference there. 4K is the next step after that. Next up is that magical number of 360 vertical pixels. Actually, the magic number is 120 or 128. All resolutions are some kind of multiple of 120 pixels nowadays, back in the day they used to be multiples of 128. This is something that just grew out of LCD panel industry. LCD panels use what are called line drivers, little chips that sit on the sides of your LCD screen that control how bright each subpixel is. Because historically, for reasons I don’t really know for sure, probably memory constraints, these multiple-of-128 or multiple-of-120 resolutions already existed, the industry standard line drivers became drivers with 360 line outputs (1 per subpixel). If you would tear down your 1920×1080 screen, I would be putting money on there being 16 line drivers on the top/bottom and 9 on one of the sides. Oh hey, that’s 16:9. Guess how obvious that resolution choice was back when 16:9 was ‘invented’. Then there’s the issue of aspect ratio. This is really a completely different field of psychology, but it boils down to: historically, people have believed and measured that we have a sort of wide-screen view of the world. Naturally, people believed that the most natural representation of data on a screen would be in a wide-screen view, and this is where the great anamorphic revolution of the ’60s came from when films were shot in ever wider aspect ratios. Since then, this kind of knowledge has been refined and mostly debunked. Yes, we do have a wide-angle view, but the area where we can actually see sharply – the center of our vision – is fairly round. Slightly elliptical and squashed, but not really more than about 4:3 or 3:2. So for detailed viewing, for instance for reading text on a screen, you can utilize most of your detail vision by employing an almost-square screen, a bit like the screens up to the mid-2000s. However, again this is not how marketing took it. Computers in ye olden days were used mostly for productivity and detailed work, but as they commoditized and as the computer as media consumption device evolved, people didn’t necessarily use their computer for work most of the time. They used it to watch media content: movies, television series and photos. And for that kind of viewing, you get the most ‘immersion factor’ if the screen fills as much of your vision (including your peripheral vision) as possible. Which means widescreen. But there’s more marketing still. When detail work was still an important factor, people cared about resolution. As many pixels as possible on the screen. SGI was selling almost-4K CRTs! The most optimal way to get the maximum amount of pixels out of a glass substrate is to cut it as square as possible. 1:1 or 4:3 screens have the most pixels per diagonal inch. But with displays becoming more consumery, inch-size became more important, not amount of pixels. And this is a completely different optimization target. To get the most diagonal inches out of a substrate, you want to make the screen as wide as possible. First we got 16:10, then 16:9 and there have been moderately successful panel manufacturers making 22:9 and 2:1 screens (like Philips). Even though pixel density and absolute resolution went down for a couple of years, inch-sizes went up and that’s what sold. Why buy a 19″ 1280×1024 when you can buy a 21″ 1366×768? Eh… I think that about covers all the major aspects here. There’s more of course; bandwidth limits of HDMI, DVI, DP and of course VGA played a role, and if you go back to the pre-2000s, graphics memory, in-computer bandwdith and simply the limits of commercially available RAMDACs played an important role. But for today’s considerations, this is about all you need to know. Have something to add to the explanation? Sound off in the the comments. Want to read more answers from other tech-savvy Stack Exchange users? Check out the full discussion thread here.     

    Read the article

  • PASS: The Budget Process

    - by Bill Graziano
    Every fiscal year PASS creates a detailed budget.  This helps us set priorities and communicate to our members what we’re going to do in the upcoming year.  You can review the current budget on the PASS Governance page.  That page currently requires you to login but I’m talking with HQ to see if there are any legal issues with opening that up. The Accounting Team The PASS accounting team is two people.  The Executive Vice-President of Finance (“EVP”) and the PASS Accounting Manager.  Sandy Cherry is the accounting manager and works at PASS HQ.  Sandy has been with PASS since we switched management companies in 2007.  Throughout this document when I talk about any actual work related to the budget that’s all Sandy :)  She’s the glue that gets us through this process.  Last year we went through 32 iterations of the budget before the Board approved so it’s a pretty busy time for her us – well, mostly her. Fiscal Year The PASS fiscal year runs from July 1st through June 30th the following year.  Right now we’re in fiscal year 2011.  Our 2010 Summit actually occurred in FY2011.  We switched to this schedule from a calendar year in 2006.  Our goal was to have the Summit occur early in our fiscal year.  That gives us the rest of the year to handle any significant financial impact from the Summit.  If registrations are down we can reduce spending.  If registrations are up we can decide how much to increase our reserves and how much to spend.  Keep in mind that the Summit is budgeted to generate 82% of our revenue this year.  How it performs has a significant impact on our financials.  The other benefit of this fiscal year is that it matches the Microsoft fiscal year.  We sign an annual sponsorship agreement with Microsoft and it’s very helpful that our fiscal years match. This year our budget process will probably start in earnest in March or April.  I’d like to be done in early June so we can publish before July 1st.  I was late publishing it this year and I’m trying not to repeat that. Our Budget Our actual budget is an Excel spreadsheet with 36 sheets.  We remove some of those when we publish it since they include salary information.  The budget is broken up into various portfolios or departments.  We have 20 portfolios.  They include chapters, marketing, virtual chapters, marketing, etc.  Ideally each portfolio is assigned to a Board member.  Each portfolio also typically has a staff person assigned to it.  Portfolios that aren’t assigned to a Board member are monitored by HQ and the ExecVP-Finance (me).  These are typically smaller portfolios such as deferred membership or Summit futures.  (More on those in a later post.)  All portfolios are reviewed by all Board members during the budget approval process, when interim financials are released internally and at year-end. The Process Our first step is to budget revenues.  The Board determines a target attendee number.  We have formulas based on historical performance that convert that to an overall attendee revenue number.  Other revenue projections (such as vendor sponsorships) come from different parts of the organization.  I hope to have another post with more details on how we project revenues. The next step is to budget expenses.  Board members fill out a sample spreadsheet with their budget for the year.  They can add line items and notes describing what the amounts are for.  Each Board portfolio typically has from 10 to 30 line items.  Any new initiatives they want to pursue needs to be budgeted.  The Summit operations budget is managed by HQ.  It includes the cost for food, electrical, internet, etc.  Most of these come from our estimate of attendees and our contract with the convention center.  During this process the Board can ask for more or less to be spent on various line items.  For example, if we weren’t happy with the Internet at the last Summit we can ask them to look into different options and/or increasing the budget.  HQ will also make adjustments to these numbers based on what they see at the events and the feedback we receive on the surveys. After we have all the initial estimates we start reviewing the entire budget.  It is sent out to the Board and we can see what each portfolio requested and what the overall profit and loss number is.  We usually start with too much in expenses and need to cut.  In years past the Board started haggling over these numbers as a group.  This past year they decided I should take a first cut and present them with a reasonable budget and a list of what I changed.  That worked well and I think we’ll continue to do that in the future. We go through a number of iterations on the budget.  If I remember correctly, we went through 32 iterations before we passed the budget.  At each iteration various revenue and expense numbers can change.  Keep in mind that the PASS budget has 200+ line items spread over 20 portfolios.  Many of these depend on other numbers.  For example, if we decide increase the projected attendees that cascades through our budget.  At each iteration we list what changed and the impact.  Ideally these discussions will take place at a face-to-face Board meeting.  Many of them also take place over the phone.  Board members explain any increase they are asking for while performing due diligence on other budget requests.  Eventually a budget emerges and is passed. Publishing After the budget is passed we create a version without the formulas and salaries for posting on the web site.  Sandy also creates some charts to help our members understand the budget.  The EVP writes a nice little letter describing some of the changes from last year’s budget.  You can see my letter and our budget on the PASS Governance page. And then, eight months later, we start all over again.

    Read the article

  • ODEE Green Field (Windows) Part 4 - Documaker

    - by AndyL-Oracle
    Welcome back! We're about nearing completion of our installation of Oracle Documaker Enterprise Edition ("ODEE") in a green field. In my previous post, I covered the installation of SOA Suite for WebLogic. Before that, I covered the installation of WebLogic, and Oracle 11g database - all of which constitute the prerequisites for installing ODEE. Naturally, if your environment already has a WebLogic server and Oracle database, then you can skip all those components and go straight for the heart of the installation of ODEE. The ODEE installation is comprised of two procedures, the first covers the installation, which is running the installer and answering some questions. This will lay down the files necessary to install into the tiers (e.g. database schemas, WebLogic domains, etcetera). The second procedure is to deploy the configuration files into the various components (e.g. deploy the database schemas, WebLogic domains, SOA composites, etcetera). I will segment my posts accordingly! Let's get started, shall we? Unpack the installation files into a temporary directory location. This should extract a zip file. Extract that zip file into the temporary directory location. Navigate to and execute the installer in Disk1/setup.exe. You may have to allow the program to run if User Account Control is enabled. Once the dialog below is displayed, click Next. Select your ODEE Home - inside this directory is where all the files will be deployed. For ease of support, I recommend using the default, however you can put this wherever you want. Click Next. Select the database type, database connection type – note that the database name should match the value used for the connection type (e.g. if using SID, then the name should be IDMAKER; if using ServiceName, the name should be “idmaker.us.oracle.com”). Verify whether or not you want to enable advanced compression. Note: if you are not licensed for Oracle 11g Advanced Compression option do not use this option! Terrible, terrible calamities will befall you if you do! Click Next. Enter the Documaker Admin user name (default "dmkr_admin" is recommended for support purposes) and set the password. Update the System name and ID (must be unique) if you want/need to - since this is a green field install you should be able to use the default System ID. The only time you'd change this is if you were, for some reason, installing a new ODEE system into an existing schema that already had a system. Click Next. Enter the Assembly Line user name (default "dmkr_asline" is recommended) and set the password. Update the Assembly Line name and ID (must be unique) if you want/need to - it's quite possible that at some point you will create another assembly line, in which case you have several methods of doing so. One is to re-run the installer, and in this case you would pick a different assembly line ID and name. Click Next. Note: you can set the DB folder if needed (typically you don’t – see ODEE Installation Guide for specifics. Select the appropriate Application Server type - in this case, our green field install is going to use WebLogic - set the username to weblogic (this is required) and specify your chosen password. This credential will be used to access the application server console/control panel. Keep in mind that there are specific criteria on password choices that are required by WebLogic, but are not enforced by the installer (e.g. must contain a number, must be of a certain length, etcetera). Choose a strong password. Set the connection information for the JMS server. Note that for the 12.3.x version, the installer creates a separate JVM (WebLogic managed server) that hosts the JMS server, whereas prior editions place the JMS server on the AdminServer.  You may also specify a separate URL to the JMS server in case you intend to move the JMS resources to a separate/different server (e.g. back to AdminServer). You'll need to provide a login principal and credentials - for simplicity I usually make this the same as the WebLogic domain user, however this is not a secure practice! Make your JMS principal different from the WebLogic principal and choose a strong password, then click Next. Specify the Hot Folder(s) (comma-delimited if more than one) - this is the directory/directories that is/are monitored by ODEE for jobs to process. Click Next. If you will be setting up an SMTP server for ODEE to send emails, you may configure the connection details here. The details required are simple: hostname, port, user/password, and the sender's address (e.g. emails will appear to be sent by the address shown here so if the recipient clicks "reply", this is where it will go). Click Next. If you will be using Oracle WebCenter:Content (formerly known as Oracle UCM) you can enable this option and set the endpoints/credentials here. If you aren't sure, select False - you can always go back and enable this later. I'm almost 76% certain there will be a post sometime in the future that details how to configure ODEE + WCC:C! Click Next. If you will be using Oracle UMS for sending MMS/text messages, you can enable and set the endpoints/credentials here. As with UCM, if you're not sure, don't enable it - you can always set it later. Click Next. On this screen you can change the endpoints for the Documaker Web Service (DWS), and the endpoints for approval processing in Documaker Interactive. The deployment process for ODEE will create 3 managed WebLogic servers for hosting various Documaker components (JMS, Interactive, DWS, Dashboard, Documaker Administrator, etcetera) and it will set the ports used for each of these services. In this screen you can change these values if you know how you want to deploy these managed servers - but for now we'll just accept the defaults. Click Next. Verify the installation details and click Install. You can save the installation into a response file if you need to (which might be useful if you want to rerun this installation in an unattended fashion). Allow the installation to progress... Click Next. You can save the response file if needed (e.g. in case you forgot to save it earlier!) Click Finish. That's it, you're done with the initial installation. Have a look around the ODEE_HOME that you just installed (remember we selected c:\oracle\odee_1?) and look at the files that are laid down. Don't change anything just yet! Stay tuned for the next segment where we complete and verify the installation. 

    Read the article

  • Completing install of ruby 1.9.3 with Ruby for for Mac OS X 10.7.5 Leopard, Xcode 4.5.2 -- problems with rvm pkg install openssl

    - by user1848361
    First, many thanks in advance for any help. I'm a complete novice with programming and I'm trying to get started with this Ruby on Rails tutorial (http://ruby.railstutorial.org/ruby-on-rails-tutorial-book?version=3.2) I have been trying figure this out for about 7 hours now and since I don't have any hair left to pull out I'm turning to these hallowed pages. I have searched for solutions here again and again. System: Mac OS X 10.7.5 Leopard, Xcode 4.5.2 I installed homebrew and have updated it multiple times I used homebrew to install rvm and have updated it multiple times I installed git The standard ruby on the system (checking with $ ruby -v) is 1.8.7 My problem is that every time I try to use rvm to install a new version of Ruby ($ rvm install 1.9.3) I get the following error: Ruby (and needed base gems) for your selection will be installed shortly. Before it happens, please read and execute the instructions below. Please use a separate terminal to execute any additional commands. Notes for Mac OS X 10.7.5, Xcode 4.5.2. For JRuby: Install the JDK. See http://developer.apple.com/java/download/ # Current Java version "1.6.0_26" For IronRuby: Install Mono >= 2.6 For Ruby 1.9.3: Install libksba # If using Homebrew, 'brew install libksba' For Opal: Install Nodejs with NPM. See http://nodejs.org/download/ To use an RVM installed Ruby as default, instead of the system ruby: rvm install 1.8.7 # installs patch 357: closest supported version rvm system ; rvm gemset export system.gems ; rvm 1.8.7 ; rvm gemset import system.gems # migrate your gems rvm alias create default 1.8.7 And reopen your terminal windows. Xcode and gcc: : I have performed $ brew install libksba and when I try to do it again it tells me that libksba is installed already. When I type "$ rvm requirements" I get: Notes for Mac OS X 10.7.5, Xcode 4.5.2. For JRuby: Install the JDK. See http://developer.apple.com/java/download/ # Current Java version "1.6.0_26" For IronRuby: Install Mono >= 2.6 For Ruby 1.9.3: Install libksba # If using Homebrew, 'brew install libksba' For Opal: Install Nodejs with NPM. See http://nodejs.org/download/ To use an RVM installed Ruby as default, instead of the system ruby: rvm install 1.8.7 # installs patch 357: closest supported version rvm system ; rvm gemset export system.gems ; rvm 1.8.7 ; rvm gemset import system.gems # migrate your gems rvm alias create default 1.8.7 And reopen your terminal windows. Xcode and gcc: Right now Ruby requires gcc to compile, but Xcode 4.2 and later no longer ship with gcc. Instead they ship with llvm-gcc (to which gcc is a symlink) and clang, neither of which are supported for building Ruby. Xcode 4.1 was the last version to ship gcc, which was /usr/bin/gcc-4.2. Xcode 4.1 and earlier: - Ruby will build fine. Xcode 4.2 and later (including Command Line Tools for Xcode): - If you have gcc-4.2 (and friends) from an earlier Xcode version, Ruby will build fine. - If you don't have gcc-4.2, you have two options to get it: * Install apple-gcc42 from Homebrew * Install osx-gcc-installer Homebrew: If you are using Homebrew, you can install the apple-gcc42 and required libraries from homebrew/dupes: brew update brew tap homebrew/dupes brew install autoconf automake apple-gcc42 rvm pkg install openssl Xcode 4.2+ install or/and Command Line Tools for Xcode is required to provide make and other tools. osx-gcc-installer: If you don't use Homebrew, you can download and install osx-gcc-installer: https://github.com/kennethreitz/osx-gcc-installer. Warning: Installing osx-gcc-installer on top of a recent Xcode is known to cause problems, so you must uninstall Xcode before installing osx-gcc-installer. Afterwards you may install Xcode 4.2+ or Command Line Tools for Xcode if you desire. ** NOTE: Currently, Node.js is having issues building with osx-gcc-installer. The only fix is to install Xcode over osx-gcc-installer. So I assume I have to do something with brew update brew tap homebrew/dupes brew install autoconf automake apple-gcc42 rvm pkg install openssl Everything seemed to work fine until "$ rvm pkg install openssl", which returns: Fetching openssl-1.0.1c.tar.gz to /Users/thierinvestmentservices/.rvm/archives Extracting openssl to /Users/thierinvestmentservices/.rvm/src/openssl-1.0.1c Configuring openssl in /Users/thierinvestmentservices/.rvm/src/openssl-1.0.1c. Compiling openssl in /Users/thierinvestmentservices/.rvm/src/openssl-1.0.1c. Error running 'make', please read /Users/thierinvestmentservices/.rvm/log/openssl/make.log Please note that it's required to reinstall all rubies: rvm reinstall all --force Updating openssl certificates Error running 'update_openssl_certs', please read /Users/thierinvestmentservices/.rvm/log/openssl.certs.log Johns-MacBook-Pro:~ thierinvestmentservices$ rvm pkg install openssl Fetching openssl-1.0.1c.tar.gz to /Users/thierinvestmentservices/.rvm/archives Extracting openssl to /Users/thierinvestmentservices/.rvm/src/openssl-1.0.1c Configuring openssl in /Users/thierinvestmentservices/.rvm/src/openssl-1.0.1c. Compiling openssl in /Users/thierinvestmentservices/.rvm/src/openssl-1.0.1c. Error running 'make', please read /Users/thierinvestmentservices/.rvm/log/openssl/make.log Please note that it's required to reinstall all rubies: rvm reinstall all --force Updating openssl certificates Error running 'update_openssl_certs', please read /Users/thierinvestmentservices/.rvm/log/openssl.certs.log make.log reads "[2012-11-23 13:15:28] make /Users/thierinvestmentservices/.rvm/scripts/functions/utility: line 116: make: command not found" and openssl.certs.log reads "[2012-11-23 14:04:04] update_openssl_certs update_openssl_certs () { ( chpwd_functions="" builtin cd $rvm_usr_path/ssl && command curl -O http://curl.haxx.se/ca/cacert.pem && mv cacert.pem cert.pem ) } current path: /Users/thierinvestmentservices command(1): update_openssl_certs /Users/thierinvestmentservices/.rvm/scripts/functions/pkg: line 205: cd: /Users/thierinvestmentservices/.rvm/usr/ssl: No such file or directory" At this point the letters might as well be wingdings I have no idea what is going on. I have tried to install rvm make with something I saw on one forum post but I got a bunch of warnings. If anyone has any suggestions I would be deeply grateful, I am completely in over my head,

    Read the article

  • Projected Results

    - by Sylvie MacKenzie, PMP
    Excerpt from PROFIT - ORACLE - by Monica Mehta Yasser Mahmud has seen a revolution in project management over the past decade. During that time, the former Primavera product strategist (who joined Oracle when his company was acquired in 2008) has not only observed a transformation in the way IT systems support corporate projects but the role project portfolio management (PPM) plays in the enterprise. “15 years ago project management was the domain of project management office (PMO),” Mahmud recalls of earlier days. “But over the course of the past decade, we've seen it transform into a mission critical enterprise discipline, that has made Primavera indispensable in the board room. Now, as a senior manager, a board member, or a C-level executive you have direct and complete visibility into what’s kind of going on in the organization—at a level of detail that you're going to consume that information.” Now serving as Oracle’s vice president of product strategy and industry marketing, Mahmud shares his thoughts on how Oracle’s Primavera solutions have evolved and how best-in-class project portfolio management systems can help businesses stay competitive. Profit: What do you feel are the market dynamics that are changing project management today? Mahmud: First, the data explosion. We're generating data at twice the rate at which we can actually store it. The same concept applies for project-intensive organizations. A lot of data is gathered, but what are we really doing with it? Are we turning data into insight? Are we using that insight and turning it into foresight with analytics tools? This is a key driver that will separate the very good companies—the very competitive companies—from those that are not as competitive. Another trend is centered on the explosion of mobile computing. By the year 2013, an estimated 35 percent of the world’s workforce is going to be mobile. That’s one billion people. So the question is not if you're going to go mobile, it’s how fast you are going to go mobile. What kind of impact does that have on how the workforce participates in projects? What worked ten to fifteen years ago is not going to work today. It requires a real rethink around the interfaces and how data is actually presented. Profit: What is the role of project management in this new landscape? Mahmud: We recently conducted a PPM study with the Economist Intelligence Unit centered to determine how important project management is considered within organizations. Our target was primarily CFOs, CIOs, and senior managers and we discovered that while 95 percent of participants believed it critical to their business, only six percent were confident that projects were delivered on time and on budget. That’s a huge gap. Most organizations are looking for efficiency, especially in these volatile financial times. But senior management can’t keep track of every project in a large organization. As a result, executives are attempting to inventory the work being conducted under their watch. What is often needed is a very high-level assessment conducted at the board level to say, “Here are the 50 initiatives that we have underway. How do they line up with our strategic drivers?” This line of questioning can provide early warning that work and strategy are out of alignment; finding the gap between what the business needs to do and the actual performance scorecard. That’s low-hanging fruit for any executive looking to increase efficiency and save money. But it can only be obtained through proper assessment of existing projects—and you need a project system of record to get that done. Over the next decade or so, project management is going to transform into holistic work management. Business leaders will want make sure key projects align with corporate strategy, but also the ability to drill down into daily activity and smaller projects to make sure they line up as well. Keeping employees from working on tasks—even for a few hours—that don’t line up with corporate goals will, in many ways, become a competitive differentiator. Profit: How do all of these market challenges and shifting trends impact Oracle’s Primavera solutions and meeting customers’ needs? Mahmud: For Primavera, it’s a transformation from being a project management application to a PPM system in the enterprise. Also making that system a mission-critical application by connecting to other key applications within the ecosystem, such as the enterprise resource planning (ERP), supply chain, and CRM systems. Analytics have also become a huge component. Business analytics have made Oracle’s Primavera applications pertinent in the boardroom. Now, as a senior manager, a board member, a CXO, CIO, or CEO, you have direct visibility into what’s going on in the organization at a level that you're able to consume that information. In addition, all of this information pairs up really well with your financials and other data. Certainly, when you're an Oracle shop, you have that visibility that you didn’t have before from a project execution perspective. Profit: What new strategies and tools are being implemented to create a more efficient workplace for users? Mahmud: We believe very strongly that just because you call something an enterprise project portfolio management system doesn’t make it so—you have to get people to want to participate in the system. This can’t be mandated down from the top. It simply doesn’t work that way. A truly adoptable solution is one that makes it super easy for all types users to participate, by providing them interfaces where they live. Keeping that in mind, a major area of development has been alternative user interfaces. This is increasingly resulting in the creation of lighter weight, targeted interfaces such as iOS applications, and smartphones interfaces such as for iPhone and Android platform. Profit: How does this translate into the development of Oracle’s Primavera solutions? Mahmud: Let me give you a few examples. We recently announced the launch of our Primavera P6 Team Member application, which is a native iOS application for the iPhone. This interface makes it easier for team members to do their jobs quickly and effectively. Similarly, we introduced the Primavera analytics application, which can be consumed via mobile devices, and when married with Oracle Spatial capabilities, users can get a geographical view of what’s going on and which projects are occurring in various locations around the world. Lastly, we introduced advanced email integration that allows project team members to status work via E-mail. This functionality leverages the fact that users are in E-mail system throughout the day and allows them to status their work without the need to launch the Primavera application. It comes back to a mantra: provide as many alternative user interfaces as possible, so you can give people the ability to work, to participate, to raise issues, to create projects, in the places where they live. Do it in such a way that it’s non-intrusive, do it in such a way that it’s easy and intuitive and they can get it done in a short amount of time. If you do that, workers can get back to doing what they're actually getting paid for.

    Read the article

  • MVC 3 Remote Validation jQuery error on submit

    - by Richard Reddy
    I seem to have a weird issue with remote validation on my project. I am doing a simple validation check on an email field to ensure that it is unique. I've noticed that unless I put the cursor into the textbox and then remove it to trigger the validation at least once before submitting my form I will get a javascript error. e[h] is not a function jquery.min.js line 3 If I try to resubmit the form after the above error is returned everything works as expected. It's almost like the form tried to submit before waiting for the validation to return or something. Am I required to silently fire off a remote validation request on submit before submitting my form? Below is a snapshot of the code I'm using: (I've also tried GET instead of POST but I get the same result). As mentioned above, the code works fine but the form returns a jquery error unless the validation is triggered at least once. Model: public class RegisterModel { [Required] [Remote("DoesUserNameExist", "Account", HttpMethod = "POST", ErrorMessage = "User name taken.")] [Display(Name = "User name")] public string UserName { get; set; } [Required] [Display(Name = "Firstname")] public string Firstname { get; set; } [Display(Name = "Surname")] public string Surname { get; set; } [Required] [Remote("DoesEmailExist", "Account", HttpMethod = "POST", ErrorMessage = "Email taken.", AdditionalFields = "UserName")] [Display(Name = "Email address")] public string Email { get; set; } [StringLength(100, ErrorMessage = "The {0} must be at least {2} characters long.", MinimumLength = 8)] [DataType(DataType.Password)] [Display(Name = "Password")] public string Password { get; set; } [StringLength(100, ErrorMessage = "The {0} must be at least {2} characters long.", MinimumLength = 8)] [DataType(DataType.Password)] [Display(Name = "Confirm password")] public string ConfirmPassword { get; set; } [Display(Name = "Approved?")] public bool IsApproved { get; set; } } public class UserRoleModel { [Display(Name = "Assign Roles")] public IEnumerable<RoleViewModel> AllRoles { get; set; } public RegisterModel RegisterUser { get; set; } } Controller: // POST: /Account/DoesEmailExist // passing in username so that I can ignore the same email address for the same user on edit page [HttpPost] public JsonResult DoesEmailExist([Bind(Prefix = "RegisterUser.Email")]string Email, [Bind(Prefix = "RegisterUser.UserName")]string UserName) { var user = Membership.GetUserNameByEmail(Email); if (!String.IsNullOrEmpty(UserName)) { if (user == UserName) return Json(true); } return Json(user == null); } View: <script src="//ajax.googleapis.com/ajax/libs/jquery/1.7.1/jquery.min.js" type="text/javascript"></script> <script src="//ajax.googleapis.com/ajax/libs/jqueryui/1.8.17/jquery-ui.min.js" type="text/javascript"></script> <script type="text/javascript" src="/Content/web/js/jquery.unobtrusive-ajax.min.js"></script> <script type="text/javascript" src="/Content/web/js/jquery.validate.min.js"></script> <script type="text/javascript" src="/Content/web/js/jquery.validate.unobtrusive.min.js"></script> ...... @using (Html.BeginForm()) { @Html.AntiForgeryToken() <div class="titleh"> <h3>Edit a user account</h3> </div> <div class="body"> @Html.HiddenFor(model => model.RegisterUser.UserName) @Html.Partial("_CreateOrEdit", Model) <div class="st-form-line"> <span class="st-labeltext">@Html.LabelFor(model => model.RegisterUser.IsApproved)</span> @Html.RadioButtonFor(model => model.RegisterUser.IsApproved, true, new { @class = "uniform" }) Active @Html.RadioButtonFor(model => model.RegisterUser.IsApproved, false, new { @class = "uniform" }) Disabled <div class="clear"></div> </div> <div class="button-box"> <input type="submit" name="submit" value="Save" class="st-button"/> @Html.ActionLink("Back to List", "Index", null, new { @class = "st-clear" }) </div> </div> } CreateEdit Partial View @model Project.Domain.Entities.UserRoleModel <div class="st-form-line"> <span class="st-labeltext">@Html.LabelFor(m => m.RegisterUser.Firstname)</span> @Html.TextBoxFor(m => m.RegisterUser.Firstname, new { @class = "st-forminput", @style = "width:300px" }) @Html.ValidationMessageFor(m => m.RegisterUser.Firstname) <div class="clear"></div> </div> <div class="st-form-line"> <span class="st-labeltext">@Html.LabelFor(m => m.RegisterUser.Surname)</span> @Html.TextBoxFor(m => m.RegisterUser.Surname, new { @class = "st-forminput", @style = "width:300px" }) @Html.ValidationMessageFor(m => m.RegisterUser.Surname) <div class="clear"></div> </div> <div class="st-form-line"> <span class="st-labeltext">@Html.LabelFor(m => m.RegisterUser.Email)</span> @Html.TextBoxFor(m => m.RegisterUser.Email, new { @class = "st-forminput", @style = "width:300px" }) @Html.ValidationMessageFor(m => m.RegisterUser.Email) <div class="clear"></div> </div> Thanks, Rich

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • Java Box Class: Unsolvable: aligning components to the left or right

    - by user323186
    I have been trying to left align buttons contained in a Box to the left, with no success. They align left alright, but for some reason dont shift all the way left as one would imagine. I attach the code below. Please try compiling it and see for yourself. Seems bizarre to me. Thanks, Eric import java.awt.Dimension; import java.awt.event.ActionEvent; import java.awt.event.ActionListener; import java.io.BufferedReader; import java.io.File; import java.io.FileNotFoundException; import java.io.FileReader; import java.io.IOException; import javax.swing.Box; import javax.swing.BoxLayout; import javax.swing.JButton; import javax.swing.JFileChooser; import javax.swing.JFrame; import javax.swing.JMenu; import javax.swing.JMenuBar; import javax.swing.JMenuItem; import javax.swing.JScrollPane; import javax.swing.JTextArea; public class MainGUI extends Box implements ActionListener{ //Create GUI Components Box centerGUI=new Box(BoxLayout.X_AXIS); Box bottomGUI=new Box(BoxLayout.X_AXIS); //centerGUI subcomponents JTextArea left=new JTextArea(), right=new JTextArea(); JScrollPane leftScrollPane = new JScrollPane(left), rightScrollPane = new JScrollPane(right); //bottomGUI subcomponents JButton encrypt=new JButton("Encrypt"), decrypt=new JButton("Decrypt"), close=new JButton("Close"), info=new JButton("Info"); //Create Menubar components JMenuBar menubar=new JMenuBar(); JMenu fileMenu=new JMenu("File"); JMenuItem open=new JMenuItem("Open"), save=new JMenuItem("Save"), exit=new JMenuItem("Exit"); int returnVal =0; public MainGUI(){ super(BoxLayout.Y_AXIS); initCenterGUI(); initBottomGUI(); initFileMenu(); add(centerGUI); add(bottomGUI); addActionListeners(); } private void addActionListeners() { open.addActionListener(this); save.addActionListener(this); exit.addActionListener(this); encrypt.addActionListener(this); decrypt.addActionListener(this); close.addActionListener(this); info.addActionListener(this); } private void initFileMenu() { fileMenu.add(open); fileMenu.add(save); fileMenu.add(exit); menubar.add(fileMenu); } public void initCenterGUI(){ centerGUI.add(leftScrollPane); centerGUI.add(rightScrollPane); } public void initBottomGUI(){ bottomGUI.setAlignmentX(LEFT_ALIGNMENT); //setBorder(BorderFactory.createLineBorder(Color.BLACK)); bottomGUI.add(encrypt); bottomGUI.add(decrypt); bottomGUI.add(close); bottomGUI.add(info); } @Override public void actionPerformed(ActionEvent arg0) { // find source of the action Object source=arg0.getSource(); //if action is of such a type do the corresponding action if(source==close){ kill(); } else if(source==open){ //CHOOSE FILE File file1 =chooseFile(); String input1=readToString(file1); System.out.println(input1); left.setText(input1); } else if(source==decrypt){ //decrypt everything in Right Panel and output in left panel decrypt(); } else if(source==encrypt){ //encrypt everything in left panel and output in right panel encrypt(); } else if(source==info){ //show contents of info file in right panel doInfo(); } else { System.out.println("Error"); //throw new UnimplementedActionException(); } } private void doInfo() { // TODO Auto-generated method stub } private void encrypt() { // TODO Auto-generated method stub } private void decrypt() { // TODO Auto-generated method stub } private String readToString(File file) { FileReader fr = null; try { fr = new FileReader(file); } catch (FileNotFoundException e1) { e1.printStackTrace(); } BufferedReader br=new BufferedReader(fr); String line = null; try { line = br.readLine(); } catch (IOException e) { e.printStackTrace(); } String input=""; while(line!=null){ input=input+"\n"+line; try { line=br.readLine(); } catch (IOException e) { e.printStackTrace(); } } return input; } private File chooseFile() { //Create a file chooser final JFileChooser fc = new JFileChooser(); returnVal = fc.showOpenDialog(fc); return fc.getSelectedFile(); } private void kill() { System.exit(0); } public static void main(String[] args) { // TODO Auto-generated method stub MainGUI test=new MainGUI(); JFrame f=new JFrame("Tester"); f.setDefaultCloseOperation(JFrame.EXIT_ON_CLOSE); f.setJMenuBar(test.menubar); f.setPreferredSize(new Dimension(600,400)); //f.setUndecorated(true); f.add(test); f.pack(); f.setVisible(true); } }

    Read the article

< Previous Page | 290 291 292 293 294 295 296 297 298 299 300 301  | Next Page >