Search Results

Search found 234 results on 10 pages for 'tc'.

Page 3/10 | < Previous Page | 1 2 3 4 5 6 7 8 9 10  | Next Page >

  • "previousMode": Controling the Pin Action of a TopComponent

    - by Geertjan
    An excellent thing I learned today is that you, as a developer of a NetBeans module or NetBeans Platform application, can control the pin button. Up until today, whenever I had a TopComponent defined to appear in "rightSlidingSide" mode and then I clicked the "pin" button, as shown here... ...the TopComponent would then find itself pinned in the "explorer" mode. Would make more sense if it would be pinned in the "properties" mode, which is the docked mode closest to the "rightSlidingSide" mode. Not being able to control the "pin" button has been a recurring question (including in my own head) over several years. But the NetBeans Team's window system guru Stan Aubrecht informed me today that a "previousMode" attribute exists in the "tc-ref" file of the TopComponent. Since a few releases, that file is generated via the annotations in the TopComponent. However, "previousMode" is currently not one of the attributes exposed by the @TopComponent.Registration annotation. Therefore, what I did was this: Set "rightSlidingSide" in the "mode" attribute of the @TopComponent.Registration. Build the module. Find the "generated-layer.xml" (in the Files window) and move the layer registration of the TopComponent, including its action and menu item for opening the TopComponent, into my own manual layer within the module. Then remove all the TopComponent annotations from the TopComponent, though you can keep @ConvertAsProperties and @Messages. Then add the "previousMode" attribute, as highlighted below, into my own layer file, i.e., within the tags copied from the "generated-layer.xml": <folder name="Modes"> <folder name="rightSlidingSide"> <file name="ComparatorTopComponent.wstcref"> <![CDATA[<?xml version="1.0" encoding="UTF-8"?> <!DOCTYPE tc-ref PUBLIC "-//NetBeans//DTD Top Component in Mode Properties 2.0//EN" "http://www.netbeans.org/dtds/tc-ref2_0.dtd"> <tc-ref version="2.0"> <tc-id id="ComparatorTopComponent"/> <state opened="false"/> <previousMode name="properties" index="0" /> </tc-ref> ]]> </file> </folder> </folder> Now when you run the application and pin the specific TopComponent defined above, i.e., in the above case, named "ComparatorTopComponent", you will find it is pinned into the "properties" mode! That's pretty cool and if you agree, then you're a pretty cool NetBeans Platform developer, and I'd love to find out more about the application/s you're creating on the NetBeans Platform! Meanwhile, I'm going to create an issue for exposing the "previousMode" attribute in the @TopComponent.Registration annotation.

    Read the article

  • Reading a POP3 server with only TcpClient and StreamWriter/StreamReader[SOLVED]

    - by WebDevHobo
    I'm trying to read mails from my live.com account, via the POP3 protocol. I've found the the server is pop3.live.com and the port if 995. I'm not planning on using a pre-made library, I'm using NetworkStream and StreamReader/StreamWriter for the job. I need to figure this out. So, any of the answers given here: http://stackoverflow.com/questions/44383/reading-email-using-pop3-in-c are not usefull. It's part of a larger program, but I made a small test to see if it works. Eitherway, i'm not getting anything. Here's the code I'm using, which I think should be correct. EDIT: this code is old, please refer to the second block problem solved. public Program() { string temp = ""; using(TcpClient tc = new TcpClient(new IPEndPoint(IPAddress.Parse("127.0.0.1"),8000))) { tc.Connect("pop3.live.com",995); using(NetworkStream nws = tc.GetStream()) { using(StreamReader sr = new StreamReader(nws)) { using(StreamWriter sw = new StreamWriter(nws)) { sw.WriteLine("USER " + user); sw.Flush(); sw.WriteLine("PASS " + pass); sw.Flush(); sw.WriteLine("LIST"); sw.Flush(); while(temp != ".") { temp += sr.ReadLine(); } } } } } Console.WriteLine(temp); } Visual Studio debugger constantly falls over tc.Connect("pop3.live.com",995); Which throws an "A socket operation was attempted to an unreachable network 65.55.172.253:995" error. So, I'm sending from port 8000 on my machine to port 995, the hotmail pop3 port. And I'm getting nothing, and I'm out of ideas. Second block: Problem was apparently that I didn't write the quit command. The Code: public Program() { string str = string.Empty; string strTemp = string.Empty; using(TcpClient tc = new TcpClient()) { tc.Connect("pop3.live.com",995); using(SslStream sl = new SslStream(tc.GetStream())) { sl.AuthenticateAsClient("pop3.live.com"); using(StreamReader sr = new StreamReader(sl)) { using(StreamWriter sw = new StreamWriter(sl)) { sw.WriteLine("USER " + user); sw.Flush(); sw.WriteLine("PASS " + pass); sw.Flush(); sw.WriteLine("LIST"); sw.Flush(); sw.WriteLine("QUIT "); sw.Flush(); while((strTemp = sr.ReadLine()) != null) { if(strTemp == "." || strTemp.IndexOf("-ERR") != -1) { break; } str += strTemp; } } } } } Console.WriteLine(str); }

    Read the article

  • TrueCrypt drive letter not available

    - by Tono Nam
    With c# or a batch file I mount a trueCrypt volume located at A:\volumeTrueCrypt.tc With c# I do: static void Main(string[] args) { var p = Process.Start( fileName:@"C:\Program Files\TrueCrypt\TrueCrypt.exe", arguments:@"/v a:\volumetruecrypt.tc /lw /a /p truecrypt" ); p.WaitForExit(); } the alternative is to run the command on the command line as: C:\Windows\system32>"C:\Program Files\TrueCrypt\TrueCrypt.exe" /v "a:\volumetruecrypt.tc" /lw /a /p truecrypt Either way I get the error: Why do I get that error? I was able to run that command the first time. The moment I dismounted the volume and tryied to mount it again I got that error. I know that drive letter W is available because it shows as an available letter on true crypt if I where to open it manually: If I where then click on the button mount and then type the password truecrypt (truecrypt is the password) then it will successfully mount on drive w. Why I am not able to mount it from the command line!? If I change the drive letter on the command line it works. I want to use the drive W though. In other words executing "C:\Program Files\TrueCrypt\TrueCrypt.exe" /v "a:\volumetruecrypt.tc" /lz /a /p truecrypt will successfully mount that volume on drive z but I do not want to mount it on drive z I want to mount it on drive w. The first time I ran the batch it ran fine. Also if I restart my computer I believe it should work. More info on how to use trueCrypt through the command line can be found at: http://www.truecrypt.org/docs/?s=command-line-usage Edit I was also investivating when does this error occures. In order to generate this error you need to follow this steps. 1) execute the command: (note the /q argument at the end for quiet) "C:\Program Files\TrueCrypt\TrueCrypt.exe" /v "a:\volumetruecrypt.tc" /ln /a /p truecrypt /q "C...TrueCrypt.exe" = location where trueCrypt is located /v "path" = location where volume is located /n = drive letter n /p truecrypt = password is "trueCrypt" /q = execute in quiet mode. do not show window note I am mounting to drive letter n 2) now volume should be mounted. 3) Open trueCrypt and manually dismount that volume (without using command line) 4) Attempt to run the same command line (without the /q so you see the error) "C:\Program Files\TrueCrypt\TrueCrypt.exe" /v "a:\volumetruecrypt.tc" /ln /a /p truecrypt 5) an error should show up So the problem ocures when I manually dismount the volume. If I dismount it from the command line I get no errors. But I think this is a bug from trueCrypt

    Read the article

  • Simulating a low-bandwidth, high-latency network connection on Linux

    - by Justin L.
    I'd like to simulate a high-latency, low-bandwidth network connection on my Linux machine. Limiting bandwidth has been discussed before, e.g. here, but I can't find any posts which address limiting both bandwidth and latency. I can get either high latency or low bandwidth using tc. But I haven't been able to combine these into a single connection. In particular, the example rate control script here doesn't work for me: # tc qdisc add dev lo root handle 1:0 netem delay 100ms # tc qdisc add dev lo parent 1:1 handle 10: tbf rate 256kbit buffer 1600 limit 3000 RTNETLINK answers: Operation not supported How can I create a low-bandwidth, high-latency connection, using tc or any other readily-available tool?

    Read the article

  • How to declare strings in enum in C

    - by Sridevi
    Hello, typedef enum testCaseId { "TC-HIW-0019" = 0, "TC-HIW-0020", "TC-HIW-0021" } testCaseId; I need my test cases to be represented in enum. In my test function, I need to switch between the test cases like: void testfunc(uint8_t no) { switch(no) { case 0: case 1: default: } } So can anyone help on how to use enum to declare strings.

    Read the article

  • Surface (Pro) Soft Keyboard + Hardware Keyboard Issue

    - by Matt Clark
    When I got my Surface Pro 2, I loved it, and everything seemed to work flawlessly, until, wait for it, windows updates... The issue that I am having is the following, I primarily use the TC (TypeCover), as the Pro is an out-of-office laptop replacement for me, that I can still use to do whatever I need, but there are times when I will flip the cover, and use the system in tablet mode. The problem is that even when the TC is attached, any text field I click on, causes the OSK (on screen keyboard) to appear, as if I was running the system in tablet mode. As soon as I press a single button on the TC, the OSK is dismissed. When I first got the system, this was NOT the case, and it functioned as it should, where the OSK will only appear if the TC was not present. The biggest problem that I am having is the fact that the OSK causes the windows to be resized. Maximized windows will be shrunk, and stretched to their previous state, however a window that is not maximized will stay in its shrunken state, after the OSK has been dismissed. Below are pictures that show what is happening. Has anyone else experienced this issue? And is there any way to fix it? As you might imagine, having spent a pretty penny on a device like this, it it quite an annoying bug that needs fixing. I have been dealing with this issue for about 3 months now.

    Read the article

  • XNA Xbox 360 Content Manager Thread freezing Draw Thread

    - by Alikar
    I currently have a game that takes in large images, easily bigger than 1MB, to serve as backgrounds. I know exactly when this transition is supposed to take place, so I made a loader class to handle loading these large images in the background, but when I load the images it still freezes the main thread where the drawing takes place. Since this code runs on the 360 I move the thread to the 4th hardware thread, but that doesn't seem to help. Below is the class I am using. Any thoughts as to why my new content manager which should be in its own thread is interrupting the draw in my main thread would be appreciated. namespace FileSystem { /// <summary> /// This is used to reference how many objects reference this texture. /// Everytime someone references a texture we increase the iNumberOfReferences. /// When a class calls remove on a specific texture we check to see if anything /// else is referencing the class, if it is we don't remove it. If there isn't /// anything referencing the texture its safe to dispose of. /// </summary> class TextureContainer { public uint uiNumberOfReferences = 0; public Texture2D texture; } /// <summary> /// This class loads all the files from the Content. /// </summary> static class FileManager { static Microsoft.Xna.Framework.Content.ContentManager Content; static EventWaitHandle wh = new AutoResetEvent(false); static Dictionary<string, TextureContainer> Texture2DResourceDictionary; static List<Texture2D> TexturesToDispose; static List<String> TexturesToLoad; static int iProcessor = 4; private static object threadMutex = new object(); private static object Texture2DMutex = new object(); private static object loadingMutex = new object(); private static bool bLoadingTextures = false; /// <summary> /// Returns if we are loading textures or not. /// </summary> public static bool LoadingTexture { get { lock (loadingMutex) { return bLoadingTextures; } } } /// <summary> /// Since this is an static class. This is the constructor for the file loadeder. This is the version /// for the Xbox 360. /// </summary> /// <param name="_Content"></param> public static void Initalize(IServiceProvider serviceProvider, string rootDirectory, int _iProcessor ) { Content = new Microsoft.Xna.Framework.Content.ContentManager(serviceProvider, rootDirectory); Texture2DResourceDictionary = new Dictionary<string, TextureContainer>(); TexturesToDispose = new List<Texture2D>(); iProcessor = _iProcessor; CreateThread(); } /// <summary> /// Since this is an static class. This is the constructor for the file loadeder. /// </summary> /// <param name="_Content"></param> public static void Initalize(IServiceProvider serviceProvider, string rootDirectory) { Content = new Microsoft.Xna.Framework.Content.ContentManager(serviceProvider, rootDirectory); Texture2DResourceDictionary = new Dictionary<string, TextureContainer>(); TexturesToDispose = new List<Texture2D>(); CreateThread(); } /// <summary> /// Creates the thread incase we wanted to set up some parameters /// Outside of the constructor. /// </summary> static public void CreateThread() { Thread t = new Thread(new ThreadStart(StartThread)); t.Start(); } // This is the function that we thread. static public void StartThread() { //BBSThreadClass BBSTC = (BBSThreadClass)_oData; FileManager.Execute(); } /// <summary> /// This thread shouldn't be called by the outside world. /// It allows the File Manager to loop. /// </summary> static private void Execute() { // Make sure our thread is on the correct processor on the XBox 360. #if WINDOWS #else Thread.CurrentThread.SetProcessorAffinity(new int[] { iProcessor }); Thread.CurrentThread.IsBackground = true; #endif // This loop will load textures into ram for us away from the main thread. while (true) { wh.WaitOne(); // Locking down our data while we process it. lock (threadMutex) { lock (loadingMutex) { bLoadingTextures = true; } bool bContainsKey = false; for (int con = 0; con < TexturesToLoad.Count; con++) { // If we have already loaded the texture into memory reference // the one in the dictionary. lock (Texture2DMutex) { bContainsKey = Texture2DResourceDictionary.ContainsKey(TexturesToLoad[con]); } if (bContainsKey) { // Do nothing } // Otherwise load it into the dictionary and then reference the // copy in the dictionary else { TextureContainer TC = new TextureContainer(); TC.uiNumberOfReferences = 1; // We start out with 1 referece. // Loading the texture into memory. try { TC.texture = Content.Load<Texture2D>(TexturesToLoad[con]); // This is passed into the dictionary, thus there is only one copy of // the texture in memory. // There is an issue with Sprite Batch and disposing textures. // This will have to wait until its figured out. lock (Texture2DMutex) { bContainsKey = Texture2DResourceDictionary.ContainsKey(TexturesToLoad[con]); Texture2DResourceDictionary.Add(TexturesToLoad[con], TC); } // We don't have the find the reference to the container since we // already have it. } // Occasionally our texture will already by loaded by another thread while // this thread is operating. This mainly happens on the first level. catch (Exception e) { // If this happens we don't worry about it since this thread only loads // texture data and if its already there we don't need to load it. } } Thread.Sleep(100); } } lock (loadingMutex) { bLoadingTextures = false; } } } static public void LoadTextureList(List<string> _textureList) { // Ensuring that we can't creating threading problems. lock (threadMutex) { TexturesToLoad = _textureList; } wh.Set(); } /// <summary> /// This loads a 2D texture which represents a 2D grid of Texels. /// </summary> /// <param name="_textureName">The name of the picture you wish to load.</param> /// <returns>Holds the image data.</returns> public static Texture2D LoadTexture2D( string _textureName ) { TextureContainer temp; lock (Texture2DMutex) { bool bContainsKey = false; // If we have already loaded the texture into memory reference // the one in the dictionary. lock (Texture2DMutex) { bContainsKey = Texture2DResourceDictionary.ContainsKey(_textureName); if (bContainsKey) { temp = Texture2DResourceDictionary[_textureName]; temp.uiNumberOfReferences++; // Incrementing the number of references } // Otherwise load it into the dictionary and then reference the // copy in the dictionary else { TextureContainer TC = new TextureContainer(); TC.uiNumberOfReferences = 1; // We start out with 1 referece. // Loading the texture into memory. try { TC.texture = Content.Load<Texture2D>(_textureName); // This is passed into the dictionary, thus there is only one copy of // the texture in memory. } // Occasionally our texture will already by loaded by another thread while // this thread is operating. This mainly happens on the first level. catch(Exception e) { temp = Texture2DResourceDictionary[_textureName]; temp.uiNumberOfReferences++; // Incrementing the number of references } // There is an issue with Sprite Batch and disposing textures. // This will have to wait until its figured out. Texture2DResourceDictionary.Add(_textureName, TC); // We don't have the find the reference to the container since we // already have it. temp = TC; } } } // Return a reference to the texture return temp.texture; } /// <summary> /// Go through our dictionary and remove any references to the /// texture passed in. /// </summary> /// <param name="texture">Texture to remove from texture dictionary.</param> public static void RemoveTexture2D(Texture2D texture) { foreach (KeyValuePair<string, TextureContainer> pair in Texture2DResourceDictionary) { // Do our references match? if (pair.Value.texture == texture) { // Only one object or less holds a reference to the // texture. Logically it should be safe to remove. if (pair.Value.uiNumberOfReferences <= 1) { // Grabing referenc to texture TexturesToDispose.Add(pair.Value.texture); // We are about to release the memory of the texture, // thus we make sure no one else can call this member // in the dictionary. Texture2DResourceDictionary.Remove(pair.Key); // Once we have removed the texture we don't want to create an exception. // So we will stop looking in the list since it has changed. break; } // More than one Object has a reference to this texture. // So we will not be removing it from memory and instead // simply marking down the number of references by 1. else { pair.Value.uiNumberOfReferences--; } } } } /*public static void DisposeTextures() { int Count = TexturesToDispose.Count; // If there are any textures to dispose of. if (Count > 0) { for (int con = 0; con < TexturesToDispose.Count; con++) { // =!THIS REMOVES THE TEXTURE FROM MEMORY!= // This is not like a normal dispose. This will actually // remove the object from memory. Texture2D is inherited // from GraphicsResource which removes it self from // memory on dispose. Very nice for game efficency, // but "dangerous" in managed land. Texture2D Temp = TexturesToDispose[con]; Temp.Dispose(); } // Remove textures we've already disposed of. TexturesToDispose.Clear(); } }*/ /// <summary> /// This loads a 2D texture which represnets a font. /// </summary> /// <param name="_textureName">The name of the font you wish to load.</param> /// <returns>Holds the font data.</returns> public static SpriteFont LoadFont( string _fontName ) { SpriteFont temp = Content.Load<SpriteFont>( _fontName ); return temp; } /// <summary> /// This loads an XML document. /// </summary> /// <param name="_textureName">The name of the XML document you wish to load.</param> /// <returns>Holds the XML data.</returns> public static XmlDocument LoadXML( string _fileName ) { XmlDocument temp = Content.Load<XmlDocument>( _fileName ); return temp; } /// <summary> /// This loads a sound file. /// </summary> /// <param name="_fileName"></param> /// <returns></returns> public static SoundEffect LoadSound( string _fileName ) { SoundEffect temp = Content.Load<SoundEffect>(_fileName); return temp; } } }

    Read the article

  • Windows Server 2008 Static IP Address

    - by Gauls
    I have Win 2008 Server VM and want to set static IP address so that i can RDP into instead of using VM player (mouse gets out of focus as the size of the VM increases). Now while making the changes i see two TC/IPv6 and TC/IPv4 i try changing the IPaddress from obtain autimatically, but it always goes to "Unidentified Network". If i leave it to automatically obtain IP,i still cannot RDP into it. I have tired disabling TC/IPv6 from reistry. Any other suggestions? BTW the same setting works fine with WIN XP and i can RDP into all Win XP VM's Cheers Gauls

    Read the article

  • Time Capsule + Ubee Router?

    - by Charlie
    I can't for the life of me figure this out. I recently had TWC installed in my house, and wanted to disable the NAT and router functions of it. I have a Time Capsule hooked up to it from LAN1 (on the Ubee) to the WAN port on the TC. The problems started occurring here. I figured the settings would be these: Ubee Configuration mode: Bridge DHCP: Off TC IPv4: 192.168.100.2 Subnet Mask: 255.255.255.0 Router Address: 192.168.100.1 DNS Servers: 8.8.8.8, 8.8.4.4 Router Mode: DHCP and NAT But using those settings, my TC says "Double NAT", so I have to change it all around to the default settings of the Ubee using NAT. This leads me to believe bridge mode doesn't actually turn off NAT...

    Read the article

  • Convert text to table

    - by Quattro
    I would like convert text into a table. Here is a link to the text http://www.tcdb.org/public/tcdb Short example: >gnl|TC-DB|A0CIB0|1.A.17.3.1 Chromosome undetermined scaffold_19, whole genome shotgun sequence OS=Paramecium tetraurelia GN=GSPATT00007662001 PE=4 SV=1 MDDQNQPILQEQPKPKQKKPLLNTKMVKKQKMQNKKEENLREILNFYTNQVDARKFLQKM KAVVDSNQQEKKYQDDFLNPNEYNEMQDIYEDYNMGDLVIVFPNPDADGVKNPPITYKEA PLTKTNFYSKIGNVSYENDIDELCVDEMEYLRNMRNVDGEHMDQDHVKEEI >gnl|TC-DB|A0CS82|9.B.82.1.5 Chromosome undetermined scaffold_26, whole genome shotgun sequence - Paramecium tetraurelia. MIIEEQIEEKMIYKAIHRVKVNYQKKIDRYILYKKSRWFFNLLLMLLYAYRIQNIGGFYI VTYIYCVYQLQLLIDYFTPLGLPPVNLEDEEEDDDQFQNDFSELPTTLSNKNELNDKEFR PLLRTTSEFKVWQKSVFSVIFAYFCTYIPIWDIPVYWPFLFCYFFVIVGMSIRKYIKHMK KYGYTILDFTKKK I wanted to have columns for example delimited with pipe | or ; |>gnl|TC-DB|A0CIB0|1.A.17.3.1| Chromosome undetermined scaffold_19, whole genome shotgun sequence OS=Paramecium tetraurelia GN=GSPATT00007662001 PE=4 SV=1| MDDQNQPILQEQPKPKQKKPLLNTKMVKKQKMQNKKEENLREILNFYTNQVDARKFLQKM KAVVDSNQQEKKYQDDFLNPNEYNEMQDIYEDYNMGDLVIVFPNPDADGVKNPPITYKEA PLTKTNFYSKIGNVSYENDIDELCVDEMEYLRNMRNVDGEHMDQDHVKEEI I am working with Windows and I don't know how to do it I just know every row starts with > I want to substitute the first whitespace in a row with a delimiter like | or ; after the first regular expression new line in a row, I want also a delimiter everything between the regular expression first new line and > should go into a new column (it's a sequence of a protein)

    Read the article

  • Java Hint in NetBeans for Identifying JOptionPanes

    - by Geertjan
    I tend to have "JOptionPane.showMessageDialogs" scattered through my code, for debugging purposes. Now I have a way to identify all of them and remove them one by one, since some of them are there for users of the application so shouldn't be removed, via the Refactoring window: Identifying instances of code that I'm interested in is really trivial: import org.netbeans.spi.editor.hints.ErrorDescription; import org.netbeans.spi.java.hints.ConstraintVariableType; import org.netbeans.spi.java.hints.ErrorDescriptionFactory; import org.netbeans.spi.java.hints.Hint; import org.netbeans.spi.java.hints.HintContext; import org.netbeans.spi.java.hints.TriggerPattern; import org.openide.util.NbBundle.Messages; @Hint( displayName = "#DN_ShowMessageDialogChecker", description = "#DESC_ShowMessageDialogChecker", category = "general") @Messages({ "DN_ShowMessageDialogChecker=Found \"ShowMessageDialog\"", "DESC_ShowMessageDialogChecker=Checks for JOptionPane.showMes" }) public class ShowMessageDialogChecker { @TriggerPattern(value = "$1.showMessageDialog", constraints = @ConstraintVariableType(variable = "$1", type = "javax.swing.JOptionPane")) @Messages("ERR_ShowMessageDialogChecker=Are you sure you need this statement?") public static ErrorDescription computeWarning(HintContext ctx) { return ErrorDescriptionFactory.forName( ctx, ctx.getPath(), Bundle.ERR_ShowMessageDialogChecker()); } } Stick the above class, which seriously isn't much code at all, in a module and run it, with this result: Bit trickier to do the fix, i.e., add a bit of code to let the user remove the statement, but I looked in the NetBeans sources and used the System.out fix, which does the same thing:  import com.sun.source.tree.BlockTree; import com.sun.source.tree.StatementTree; import com.sun.source.util.TreePath; import java.util.ArrayList; import java.util.Iterator; import java.util.List; import org.netbeans.api.java.source.CompilationInfo; import org.netbeans.api.java.source.WorkingCopy; import org.netbeans.spi.editor.hints.ErrorDescription; import org.netbeans.spi.editor.hints.Fix; import org.netbeans.spi.java.hints.ConstraintVariableType; import org.netbeans.spi.java.hints.ErrorDescriptionFactory; import org.netbeans.spi.java.hints.Hint; import org.netbeans.spi.java.hints.HintContext; import org.netbeans.spi.java.hints.JavaFix; import org.netbeans.spi.java.hints.TriggerPattern; import org.openide.util.NbBundle.Messages; @Hint( displayName = "#DN_ShowMessageDialogChecker", description = "#DESC_ShowMessageDialogChecker", category = "general") @Messages({ "DN_ShowMessageDialogChecker=Found \"ShowMessageDialog\"", "DESC_ShowMessageDialogChecker=Checks for JOptionPane.showMes" }) public class ShowMessageDialogChecker { @TriggerPattern(value = "$1.showMessageDialog", constraints = @ConstraintVariableType(variable = "$1", type = "javax.swing.JOptionPane")) @Messages("ERR_ShowMessageDialogChecker=Are you sure you need this statement?") public static ErrorDescription computeWarning(HintContext ctx) { Fix fix = new FixImpl(ctx.getInfo(), ctx.getPath()).toEditorFix(); return ErrorDescriptionFactory.forName( ctx, ctx.getPath(), Bundle.ERR_ShowMessageDialogChecker(), fix); } private static final class FixImpl extends JavaFix { public FixImpl(CompilationInfo info, TreePath tp) { super(info, tp); } @Override @Messages("FIX_ShowMessageDialogChecker=Remove the statement") protected String getText() { return Bundle.FIX_ShowMessageDialogChecker(); } @Override protected void performRewrite(TransformationContext tc) throws Exception { WorkingCopy wc = tc.getWorkingCopy(); TreePath statementPath = tc.getPath(); TreePath blockPath = tc.getPath().getParentPath(); while (!(blockPath.getLeaf() instanceof BlockTree)) { statementPath = blockPath; blockPath = blockPath.getParentPath(); if (blockPath == null) { return; } } BlockTree blockTree = (BlockTree) blockPath.getLeaf(); List<? extends StatementTree> statements = blockTree.getStatements(); List<StatementTree> newStatements = new ArrayList<StatementTree>(); for (Iterator<? extends StatementTree> it = statements.iterator(); it.hasNext();) { StatementTree statement = it.next(); if (statement != statementPath.getLeaf()) { newStatements.add(statement); } } BlockTree newBlockTree = wc.getTreeMaker().Block(newStatements, blockTree.isStatic()); wc.rewrite(blockTree, newBlockTree); } } } Aside from now being able to use "Inspect & Refactor" to identify and fix all instances of JOptionPane.showMessageDialog at the same time, you can also do the fixes per instance within the editor:

    Read the article

  • Customizing the Test Status on the TFS 2010 SSRS Stories Overview Report

    - by Bob Hardister
    This post shows how to customize the SQL query used by the Team Foundation Server 2010 SQL Server Reporting Services (SSRS) Stories Overview Report. The objective is to show test status for the current version while including user story status of the current and prior versions.  Why? Because we don’t copy completed user stories into the next release. We only want one instance of a user story for the product because we believe copies can get out of sync when they are supposed to be the same. In the example below, work items for the current version are on the area path root and prior versions are not on the area path root. However, you can use area path or iteration path criteria in the query as suits your needs. In any case, here’s how you do it: 1. Download a copy of the report RDL file as a backup 2. Open the report by clicking the edit down arrow and selecting “Edit in Report Builder” 3. Right click on the dsOverview Dataset and select Dataset Properties 4. Update the following SQL per the comments in the code: Customization 1 of 3 … -- Get the list deliverable workitems that have Test Cases linked DECLARE @TestCases Table (DeliverableID int, TestCaseID int); INSERT @TestCases     SELECT h.ID, flh.TargetWorkItemID     FROM @Hierarchy h         JOIN FactWorkItemLinkHistory flh             ON flh.SourceWorkItemID = h.ID                 AND flh.WorkItemLinkTypeSK = @TestedByLinkTypeSK                 AND flh.RemovedDate = CONVERT(DATETIME, '9999', 126)                 AND flh.TeamProjectCollectionSK = @TeamProjectCollectionSK         JOIN [CurrentWorkItemView] wi ON flh.TargetWorkItemID = wi.[System_ID]                  AND wi.[System_WorkItemType] = @TestCase             AND wi.ProjectNodeGUID  = @ProjectGuid              --  Customization 1 of 3: only include test status information when test case area path = root. Added the following 2 statements              AND wi.AreaPath = '{the root area path of the team project}'  …          Customization 2 of 3 … -- Get the Bugs linked to the deliverable workitems directly DECLARE @Bugs Table (ID int, ActiveBugs int, ResolvedBugs int, ClosedBugs int, ProposedBugs int) INSERT @Bugs     SELECT h.ID,         SUM (CASE WHEN wi.[System_State] = @Active THEN 1 ELSE 0 END) Active,         SUM (CASE WHEN wi.[System_State] = @Resolved THEN 1 ELSE 0 END) Resolved,         SUM (CASE WHEN wi.[System_State] = @Closed THEN 1 ELSE 0 END) Closed,         SUM (CASE WHEN wi.[System_State] = @Proposed THEN 1 ELSE 0 END) Proposed     FROM @Hierarchy h         JOIN FactWorkItemLinkHistory flh             ON flh.SourceWorkItemID = h.ID             AND flh.TeamProjectCollectionSK = @TeamProjectCollectionSK         JOIN [CurrentWorkItemView] wi             ON wi.[System_WorkItemType] = @Bug             AND wi.[System_Id] = flh.TargetWorkItemID             AND flh.RemovedDate = CONVERT(DATETIME, '9999', 126)             AND wi.[ProjectNodeGUID] = @ProjectGuid              --  Customization 2 of 3: only include test status information when test case area path = root. Added the following statement              AND wi.AreaPath = '{the root area path of the team project}'       GROUP BY h.ID … Customization 2 of 3 … -- Add the Bugs linked to the Test Cases which are linked to the deliverable workitems -- Walks the links from the user stories to test cases (via the tested by link), and then to -- bugs that are linked to the test case. We don't need to join to the test case in the work -- item history view. -- --    [WIT:User Story/Requirement] --> [Link:Tested By]--> [Link:any type] --> [WIT:Bug] INSERT @Bugs SELECT tc.DeliverableID,     SUM (CASE WHEN wi.[System_State] = @Active THEN 1 ELSE 0 END) Active,     SUM (CASE WHEN wi.[System_State] = @Resolved THEN 1 ELSE 0 END) Resolved,     SUM (CASE WHEN wi.[System_State] = @Closed THEN 1 ELSE 0 END) Closed,     SUM (CASE WHEN wi.[System_State] = @Proposed THEN 1 ELSE 0 END) Proposed FROM @TestCases tc     JOIN FactWorkItemLinkHistory flh         ON flh.SourceWorkItemID = tc.TestCaseID         AND flh.RemovedDate = CONVERT(DATETIME, '9999', 126)         AND flh.TeamProjectCollectionSK = @TeamProjectCollectionSK     JOIN [CurrentWorkItemView] wi         ON wi.[System_Id] = flh.TargetWorkItemID         AND wi.[System_WorkItemType] = @Bug         AND wi.[ProjectNodeGUID] = @ProjectGuid         --  Customization 3 of 3: only include test status information when test case area path = root. Added the following statement         AND wi.AreaPath = '{the root area path of the team project}'     GROUP BY tc.DeliverableID … 5. Save the report and you’re all set. Note: you may need to re-apply custom parameter changes like pre-selected sprints.

    Read the article

  • How can parallelism affect number of results?

    - by spender
    I have a fairly complex query that looks something like this: create table Items(SomeOtherTableID int,SomeField int) create table SomeOtherTable(Id int,GroupID int) with cte1 as ( select SomeOtherTableID,COUNT(*) SubItemCount from Items t where t.SomeField is not null group by SomeOtherTableID ),cte2 as ( select tc.SomeOtherTableID,ROW_NUMBER() over (partition by a.GroupID order by tc.SubItemCount desc) SubItemRank from Items t inner join SomeOtherTable a on a.Id=t.SomeOtherTableID inner join cte1 tc on tc.SomeOtherTableID=t.SomeOtherTableID where t.SomeField is not null ),cte3 as ( select SomeOtherTableID from cte2 where SubItemRank=1 ) select * from cte3 t1 inner join cte3 t2 on t1.SomeOtherTableID<t2.SomeOtherTableID option (maxdop 1) The query is such that cte3 is filled with 6222 distinct results. In the final select, I am performing a cross join on cte3 with itself, (so that I can compare every value in the table with every other value in the table at a later point). Notice the final line : option (maxdop 1) Apparently, this switches off parallelism. So, with 6222 results rows in cte3, I would expect (6222*6221)/2, or 19353531 results in the subsequent cross joining select, and with the final maxdop line in place, that is indeed the case. However, when I remove the maxdop line, the number of results jumps to 19380454. I have 4 cores on my dev box. WTF? Can anyone explain why this is? Do I need to reconsider previous queries that cross join in this way?

    Read the article

  • TabControl winform c#

    - by Steve
    Hi, Does anyone know why my tabcontrol will not display on this form? Have a feeling it maybe something simple but at the moment i just get a blank form. Thanks using System; using System.Collections.Generic; using System.ComponentModel; using System.Data; using System.Drawing; using System.Linq; using System.Text; using System.Windows.Forms; namespace test_project_3 { public partial class TabTest : Form { public TabTest() { InitializeComponent(); WebBrowser WB = new WebBrowser(); WB.Navigate("www.google.com"); TabControl tc = new TabControl(); tc.Dock = DockStyle.Fill; tc.Show(); TabPage tp = new TabPage(); tp.Text = "test"; tp.Show(); tp.Controls.Add(WB); tc.TabPages.Add(tp); } } }

    Read the article

  • oracle query with inconsistent results

    - by Spencer Stejskal
    Im having a very strange problem, i have a complicated view that returns incorrect data when i query on a particular column. heres an example: select empname, has_garnishment from timecard_v2 where empname = 'Testerson, Testy'; this returns the single result 'Testerson, Testy', 'N' however, if i use the query: select empname, has_garnishment from timecard_v2 where empname = 'Testerson, Testy' and has_garnishment = 'Y'; this returns the single result 'Testerson, Testy', 'Y' The second query should return a subset of the first query, but it returns a different answer. I have dissected the view and determined that this section of the view definition is where the problem arises(Note, I removed all of the select clause except the parts of interests for clarity, in the full query all joined tables are required): SELECT e.fullname empname , NVL2(ded.has_garn, 'Y', 'N') has_garnishment FROM timecard tc , orderdetail od , orderassign oa , employee e , employee3 e3 , customer10 c10 , order_misc om, (SELECT COUNT(*) has_garn, v_ssn FROM deductions WHERE yymmdd_stop = 0 OR (LENGTH(yymmdd_stop) = 7 AND to_date(SUBSTR(yymmdd_stop, 2), 'YYMMDD') sysdate) GROUP BY v_ssn ) ded WHERE oa.lrn(+) = tc.lrn_order AND om.lrn(+) = od.lrn AND od.orderno = oa.orderno AND e.ssn = tc.ssn AND c10.custno = tc.custno AND e.lrn = e3.lrn AND e.ssn = ded.v_ssn(+) One thing of note about the definition of the 'ded' subquery. The v_ssn field is a virtual field on the deductions table. I am not a DBA im a software developer but we recently lost our DBA and the new one is still getting up to speed so im trying to debug this issue. That being said, please explain things a little more thoroughly then you would for a fellow oracle expert. thanks

    Read the article

  • How to pass multiple different records (not class due to delphi limitations) to a function?

    - by mingo
    Hi to all. I have a number of records I cannot convert to classes due to Delphi limitation (all of them uses class operators to implement comparisons). But I have to pass to store them in a class not knowing which record type I'm using. Something like this: type R1 = record begin x :Mytype; class operator Equal(a,b:R1) end; type R2 = record begin y :Mytype; class operator Equal(a,b:R2) end; type Rn = record begin z :Mytype; class operator Equal(a,b:Rn) end; type TC = class begin x : TObject; y : Mytype; function payload (n:TObject) end; function TC.payload(n:TObject) begin x := n; end; program: c : TC; x : R1; y : R2; ... c := TC.Create(): n:=TOBject(x); c.payload(n); Now, Delphi do not accept typecast from record to TObject, and I cannot make them classes due to Delphi limitation. Anyone knows a way to pass different records to a function and recognize their type when needed, as we do with class: if x is TMyClass then TMyClass(x) ... ???

    Read the article

  • PyGTK: Trouble with size of ScrolledWindow

    - by canavanin
    Hi everyone! I am using PyGTK and the gtk.Assistant. On one page I have placed a treeview (one column, just strings) in a gtk.ScrolledWindow (I wanted the vertical scrollbar, since the list contains about 35 items). Everything is working fine; the only thing that bugs me is that I have not been able to figure out from the documentation how to set the size of the scrolled window. Currently only three items are displayed at a time; I would like to set this number to 10 or so. Below is the code. As you can see I have tried using a gtk.Adjustment to influence the scrolled window's size, but as - once more - I have been incompetent at retrieving the required info from the documentation, I don't actually know what values should be put into there. self.page7 = gtk.VBox() # The gtk.Adjustment: page_size = gtk.Adjustment(lower=10, page_size=100) # just used some arbitrary numbers here >_< scrolled_win = gtk.ScrolledWindow(page_size) scrolled_win.set_policy(gtk.POLICY_AUTOMATIC, gtk.POLICY_AUTOMATIC) # only display scroll bars when required self.character_traits_treeview = gtk.TreeView() self.character_traits_treestore = gtk.TreeStore(str) self.character_traits_treeview.set_model(self.character_traits_treestore) tc = gtk.TreeViewColumn("Character traits") self.character_traits_treeview.append_column(tc) cr = gtk.CellRendererText() tc.pack_start(cr, True) tc.add_attribute(cr, "text", 0) self.character_trait_selection = self.character_traits_treeview.get_selection() self.character_trait_selection.connect('changed', self.check_number_of_character_trait_selections) self.character_trait_selection.set_mode(gtk.SELECTION_MULTIPLE) self.make_character_traits_treestore() # adding the treeview to the scrolled window: scrolled_win.add(self.character_traits_treeview) self.page7.pack_start(scrolled_win, False, False, 0) self.assistant.append_page(self.page7) self.assistant.set_page_title(self.page7, "Step 7: Select 2-3 character traits") self.assistant.set_page_type(self.page7, gtk.ASSISTANT_PAGE_CONTENT) self.assistant.set_page_complete(self.page7, False) def check_number_of_character_trait_selections(self, blah): # ... def make_character_traits_treestore(self): # ... I know I should RTFM, but as I can't make head or tail of it, and as further searching, too, has been to no avail, I'm just hoping that someone on here can give me a hint. Thanks a lot in advance! PS: Here are the links to: the gtk.ScrolledWindow documentation the gtk.Adjustment documentation

    Read the article

  • Proxy setings for web service(client or service hosted server)

    - by tc
    I am trying to add the a web service through Web reference, i am able to find the service while trying to add it, not able to add, the option is disabled. I suspect this is because of the proxy settings, What do you suggest? While mentioning he proxy in the the client application which proxy should i mention,the proxy of my machine in which client application is hosted which is consuming the web service or the proxy of the machine in which the web service is hosted?

    Read the article

  • How to generate DELETE statements in PL/SQL, based on the tables FK relations?

    - by The chicken in the kitchen
    Is it possible via script/tool to generate authomatically many delete statements based on the tables fk relations, using Oracle PL/SQL? In example: I have the table: CHICKEN (CHICKEN_CODE NUMBER) and there are 30 tables with fk references to its CHICKEN_CODE that I need to delete; there are also other 150 tables foreign-key-linked to that 30 tables that I need to delete first. Is there some tool/script PL/SQL that I can run in order to generate all the necessary delete statements based on the FK relations for me? (by the way, I know about cascade delete on the relations, but please pay attention: I CAN'T USE IT IN MY PRODUCTION DATABASE, because it's dangerous!) I'm using Oracle DataBase 10G R2. This is the result I've written, but it is not recursive: This is a view I have previously written, but of course it is not recursive! CREATE OR REPLACE FORCE VIEW RUN ( OWNER_1, CONSTRAINT_NAME_1, TABLE_NAME_1, TABLE_NAME, VINCOLO ) AS SELECT OWNER_1, CONSTRAINT_NAME_1, TABLE_NAME_1, TABLE_NAME, '(' || LTRIM ( EXTRACT (XMLAGG (XMLELEMENT ("x", ',' || COLUMN_NAME)), '/x/text()'), ',') || ')' VINCOLO FROM ( SELECT CON1.OWNER OWNER_1, CON1.TABLE_NAME TABLE_NAME_1, CON1.CONSTRAINT_NAME CONSTRAINT_NAME_1, CON1.DELETE_RULE, CON1.STATUS, CON.TABLE_NAME, CON.CONSTRAINT_NAME, COL.POSITION, COL.COLUMN_NAME FROM DBA_CONSTRAINTS CON, DBA_CONS_COLUMNS COL, DBA_CONSTRAINTS CON1 WHERE CON.OWNER = 'TABLE_OWNER' AND CON.TABLE_NAME = 'TABLE_OWNED' AND ( (CON.CONSTRAINT_TYPE = 'P') OR (CON.CONSTRAINT_TYPE = 'U')) AND COL.TABLE_NAME = CON1.TABLE_NAME AND COL.CONSTRAINT_NAME = CON1.CONSTRAINT_NAME --AND CON1.OWNER = CON.OWNER AND CON1.R_CONSTRAINT_NAME = CON.CONSTRAINT_NAME AND CON1.CONSTRAINT_TYPE = 'R' GROUP BY CON1.OWNER, CON1.TABLE_NAME, CON1.CONSTRAINT_NAME, CON1.DELETE_RULE, CON1.STATUS, CON.TABLE_NAME, CON.CONSTRAINT_NAME, COL.POSITION, COL.COLUMN_NAME) GROUP BY OWNER_1, CONSTRAINT_NAME_1, TABLE_NAME_1, TABLE_NAME; ... and it contains the error of using DBA_CONSTRAINTS instead of ALL_CONSTRAINTS... Please pay attention to this: http://stackoverflow.com/questions/485581/generate-delete-statement-from-foreign-key-relationships-in-sql-2008/2677145#2677145 Another user has just written it in SQL SERVER 2008, anyone is able to convert to Oracle 10G PL/SQL? I am not able to... :-( This is the code written by another user in SQL SERVER 2008: DECLARE @COLUMN_NAME AS sysname DECLARE @TABLE_NAME AS sysname DECLARE @IDValue AS int SET @COLUMN_NAME = '<Your COLUMN_NAME here>' SET @TABLE_NAME = '<Your TABLE_NAME here>' SET @IDValue = 123456789 DECLARE @sql AS varchar(max) ; WITH RELATED_COLUMNS AS ( SELECT QUOTENAME(c.TABLE_SCHEMA) + '.' + QUOTENAME(c.TABLE_NAME) AS [OBJECT_NAME] ,c.COLUMN_NAME FROM PBANKDW.INFORMATION_SCHEMA.COLUMNS AS c WITH (NOLOCK) INNER JOIN PBANKDW.INFORMATION_SCHEMA.TABLES AS t WITH (NOLOCK) ON c.TABLE_CATALOG = t.TABLE_CATALOG AND c.TABLE_SCHEMA = t.TABLE_SCHEMA AND c.TABLE_NAME = t.TABLE_NAME AND t.TABLE_TYPE = 'BASE TABLE' INNER JOIN ( SELECT rc.CONSTRAINT_CATALOG ,rc.CONSTRAINT_SCHEMA ,lkc.TABLE_NAME ,lkc.COLUMN_NAME FROM PBANKDW.INFORMATION_SCHEMA.REFERENTIAL_CONSTRAINTS rc WITH (NOLOCK) INNER JOIN PBANKDW.INFORMATION_SCHEMA.KEY_COLUMN_USAGE lkc WITH (NOLOCK) ON lkc.CONSTRAINT_CATALOG = rc.CONSTRAINT_CATALOG AND lkc.CONSTRAINT_SCHEMA = rc.CONSTRAINT_SCHEMA AND lkc.CONSTRAINT_NAME = rc.CONSTRAINT_NAME INNER JOIN PBANKDW.INFORMATION_SCHEMA.TABLE_CONSTRAINTS tc WITH (NOLOCK) ON rc.CONSTRAINT_CATALOG = tc.CONSTRAINT_CATALOG AND rc.CONSTRAINT_SCHEMA = tc.CONSTRAINT_SCHEMA AND rc.UNIQUE_CONSTRAINT_NAME = tc.CONSTRAINT_NAME INNER JOIN PBANKDW.INFORMATION_SCHEMA.KEY_COLUMN_USAGE rkc WITH (NOLOCK) ON rkc.CONSTRAINT_CATALOG = tc.CONSTRAINT_CATALOG AND rkc.CONSTRAINT_SCHEMA = tc.CONSTRAINT_SCHEMA AND rkc.CONSTRAINT_NAME = tc.CONSTRAINT_NAME WHERE rkc.COLUMN_NAME = @COLUMN_NAME AND rkc.TABLE_NAME = @TABLE_NAME ) AS j ON j.CONSTRAINT_CATALOG = c.TABLE_CATALOG AND j.CONSTRAINT_SCHEMA = c.TABLE_SCHEMA AND j.TABLE_NAME = c.TABLE_NAME AND j.COLUMN_NAME = c.COLUMN_NAME ) SELECT @sql = COALESCE(@sql, '') + 'DELETE FROM ' + [OBJECT_NAME] + ' WHERE ' + [COLUMN_NAME] + ' = ' + CONVERT(varchar, @IDValue) + CHAR(13) + CHAR(10) FROM RELATED_COLUMNS PRINT @sql Thank to Charles, this is the latest not working release of the software, I have added a parameter with the OWNER because the referential integrities propagate through about 5 other Oracle users (!!!): CREATE OR REPLACE PROCEDURE delete_cascade ( parent_table VARCHAR2, parent_table_owner VARCHAR2) IS cons_name VARCHAR2 (30); tab_name VARCHAR2 (30); tab_name_owner VARCHAR2 (30); parent_cons VARCHAR2 (30); parent_col VARCHAR2 (30); delete1 VARCHAR (500); delete2 VARCHAR (500); delete_command VARCHAR (4000); CURSOR cons_cursor IS SELECT constraint_name, r_constraint_name, table_name, constraint_type FROM all_constraints WHERE constraint_type = 'R' AND r_constraint_name IN (SELECT constraint_name FROM all_constraints WHERE constraint_type IN ('P', 'U') AND table_name = parent_table AND owner = parent_table_owner) AND delete_rule = 'NO ACTION'; CURSOR tabs_cursor IS SELECT DISTINCT table_name FROM all_cons_columns WHERE constraint_name = cons_name; CURSOR child_cols_cursor IS SELECT column_name, position FROM all_cons_columns WHERE constraint_name = cons_name AND table_name = tab_name; BEGIN FOR cons IN cons_cursor LOOP cons_name := cons.constraint_name; parent_cons := cons.r_constraint_name; SELECT DISTINCT table_name, owner INTO tab_name, tab_name_owner FROM all_cons_columns WHERE constraint_name = cons_name; delete_cascade (tab_name, tab_name_owner); delete_command := ''; delete1 := ''; delete2 := ''; FOR col IN child_cols_cursor LOOP SELECT DISTINCT column_name INTO parent_col FROM all_cons_columns WHERE constraint_name = parent_cons AND position = col.position; IF delete1 IS NULL THEN delete1 := col.column_name; ELSE delete1 := delete1 || ', ' || col.column_name; END IF; IF delete2 IS NULL THEN delete2 := parent_col; ELSE delete2 := delete2 || ', ' || parent_col; END IF; END LOOP; delete_command := 'delete from ' || tab_name_owner || '.' || tab_name || ' where (' || delete1 || ') in (select ' || delete2 || ' from ' || parent_table_owner || '.' || parent_table || ');'; INSERT INTO ris VALUES (SEQUENCE_COMANDI.NEXTVAL, delete_command); COMMIT; END LOOP; END; / In the cursor CONS_CURSOR I have added the condition: AND delete_rule = 'NO ACTION'; in order to avoid deletion in case of referential integrities with DELETE_RULE = 'CASCADE' or DELETE_RULE = 'SET NULL'. Now I have tried to turn from stored procedure to stored function, but the delete statements are not correct: CREATE OR REPLACE FUNCTION deletecascade ( parent_table VARCHAR2, parent_table_owner VARCHAR2) RETURN VARCHAR2 IS cons_name VARCHAR2 (30); tab_name VARCHAR2 (30); tab_name_owner VARCHAR2 (30); parent_cons VARCHAR2 (30); parent_col VARCHAR2 (30); delete1 VARCHAR (500); delete2 VARCHAR (500); delete_command VARCHAR (4000); AT_LEAST_ONE_ITERATION NUMBER DEFAULT 0; CURSOR cons_cursor IS SELECT constraint_name, r_constraint_name, table_name, constraint_type FROM all_constraints WHERE constraint_type = 'R' AND r_constraint_name IN (SELECT constraint_name FROM all_constraints WHERE constraint_type IN ('P', 'U') AND table_name = parent_table AND owner = parent_table_owner) AND delete_rule = 'NO ACTION'; CURSOR tabs_cursor IS SELECT DISTINCT table_name FROM all_cons_columns WHERE constraint_name = cons_name; CURSOR child_cols_cursor IS SELECT column_name, position FROM all_cons_columns WHERE constraint_name = cons_name AND table_name = tab_name; BEGIN FOR cons IN cons_cursor LOOP AT_LEAST_ONE_ITERATION := 1; cons_name := cons.constraint_name; parent_cons := cons.r_constraint_name; SELECT DISTINCT table_name, owner INTO tab_name, tab_name_owner FROM all_cons_columns WHERE constraint_name = cons_name; delete1 := ''; delete2 := ''; FOR col IN child_cols_cursor LOOP SELECT DISTINCT column_name INTO parent_col FROM all_cons_columns WHERE constraint_name = parent_cons AND position = col.position; IF delete1 IS NULL THEN delete1 := col.column_name; ELSE delete1 := delete1 || ', ' || col.column_name; END IF; IF delete2 IS NULL THEN delete2 := parent_col; ELSE delete2 := delete2 || ', ' || parent_col; END IF; END LOOP; delete_command := 'delete from ' || tab_name_owner || '.' || tab_name || ' where (' || delete1 || ') in (select ' || delete2 || ' from ' || parent_table_owner || '.' || parent_table || ');' || deletecascade (tab_name, tab_name_owner); INSERT INTO ris VALUES (SEQUENCE_COMANDI.NEXTVAL, delete_command); COMMIT; END LOOP; IF AT_LEAST_ONE_ITERATION = 1 THEN RETURN ' where COD_CHICKEN = V_CHICKEN AND COD_NATION = V_NATION;'; ELSE RETURN NULL; END IF; END; / Please assume that V_CHICKEN and V_NATION are the criteria to select the CHICKEN to delete from the root table: the condition is: "where COD_CHICKEN = V_CHICKEN AND COD_NATION = V_NATION" on the root table.

    Read the article

  • What's the correct terminology for something that isn't quite classification nor regression?

    - by TC
    Let's say that I have a problem that is basicly classification. That is, given some input and a number of possible output classes, find the correct class for the given input. Neural networks and decision trees are some of the algorithms that may be used to solve such problems. These algorithms typically only emit a single result however: the resulting classification. Now what if I weren't only interested in one classification, but in the posterior probabilities that the input belongs to each of the classes. I.E., instead of the answer "This input belongs in class A", I want the answer "This input belongs to class A with 80%, class B with 15% and class C with 5%". My question is not on how to obtain these posterior probabilities, but rather on the correct terminology to describe the process of finding them. You could call it regression, since we are now trying to estimate a number of real valued numbers, but I am not quite sure if that's right. I feel it's not exactly classification either, it's something in between the two. Is there a word that describes the process of finding the class conditional posterior probabilities that some input belongs in each of the possible output classes? P.S. I'm not exactly sure if this question is enough of a programming question, but since it's about machine learning and machine learning generally involves a decent amount of programming, let's give it a shot.

    Read the article

  • How can I write a function template for all types with a particular type trait?

    - by TC
    Consider the following example: struct Scanner { template <typename T> T get(); }; template <> string Scanner::get() { return string("string"); } template <> int Scanner::get() { return 10; } int main() { Scanner scanner; string s = scanner.get<string>(); int i = scanner.get<int>(); } The Scanner class is used to extract tokens from some source. The above code works fine, but fails when I try to get other integral types like a char or an unsigned int. The code to read these types is exactly the same as the code to read an int. I could just duplicate the code for all other integral types I'd like to read, but I'd rather define one function template for all integral types. I've tried the following: struct Scanner { template <typename T> typename enable_if<boost::is_integral<T>, T>::type get(); }; Which works like a charm, but I am unsure how to get Scanner::get<string>() to function again. So, how can I write code so that I can do scanner.get<string>() and scanner.get<any integral type>() and have a single definition to read all integral types? Update: bonus question: What if I want to accept more than one range of classes based on some traits? For example: how should I approach this problem if I want to have three get functions that accept (i) integral types (ii) floating point types (iii) strings, respectively.

    Read the article

  • Why does obj.getBounds().height give a larger height than obj.height?

    - by TC
    I'm new to Flash and ActionScript, but managing quite nicely. One thing that is continuously getting in my way are the width and height properties of DisplayObject(Container)s. I'm finally starting to get my head around them and learned that the width and height of a Sprite are determined solely by their contents for example. I do not understand the following though: I've got a Sprite that I add a bunch of Buttons to. The buttons all have a height of 30 and an y of 0. As such, I'd expect the height of the containing Sprite to be 30. Surprisingly, the height is 100. The Adobe documentation of the height property of a DisplayObject states: Indicates the height of the display object, in pixels. The height is calculated based on the bounds of the content of the display object. Apparently, the 'bounds' of the object are important. So I went ahead and wrote this little test in the Sprite that contains the Buttons: for (var i:int = 0; i < numChildren; ++i) { trace("Y: " + getChildAt(i).y + " H: " + getChildAt(i).height); trace("BOUNDS H: " + getChildAt(i).getBounds(this).height); } trace("SCALEY: " + scaleY + " TOTAL HEIGHT: " + height); This code iterates through all the objects that are added to its display list and shows their y, height and getBounds().height values. Surprisingly, the output is: Y: 0 H: 30 BOUNDS H: 100 ... (5x) SCALEY: 1 TOTAL HEIGHT: 100 This shows that the bounds of the buttons are actually larger than their height (and the height that they appear to be, visually). I have no clue why this is the case however. So my questions are: Why are the bounds of my buttons larger than their height? How can I set the bounds of my buttons so that my Sprite isn't larger than I'd expect it to be based on the position and size of the objects it contains? By the way, the buttons are created as follows: var control:Button = new Button(); control.setSize(90, 30); addChild(control);

    Read the article

  • How to display different value with ComboBoxTableCell?

    - by Philippe Jean
    I try to use ComboxBoxTableCell without success. The content of the cell display the right value for the attribute of an object. But when the combobox is displayed, all items are displayed with the toString object method and not the attribute. I tryed to override updateItem of ComboBoxTableCell or to provide a StringConverter but nothing works. Do you have some ideas to custom comboxbox list display in a table cell ? I put a short example below to see quickly the problem. Execute the app and click in the cell, you will see the combobox with toString value of the object. package javafx2; import javafx.application.Application; import javafx.beans.property.adapter.JavaBeanObjectPropertyBuilder; import javafx.beans.value.ObservableValue; import javafx.collections.FXCollections; import javafx.collections.ObservableList; import javafx.scene.Scene; import javafx.scene.control.TableCell; import javafx.scene.control.TableColumn; import javafx.scene.control.TableColumn.CellDataFeatures; import javafx.scene.control.TableView; import javafx.scene.control.cell.ComboBoxTableCell; import javafx.stage.Stage; import javafx.util.Callback; import javafx.util.StringConverter; public class ComboBoxTableCellTest extends Application { public class Product { private String name; public Product(String name) { this.name = name; } public String getName() { return name; } public void setName(String name) { this.name = name; } } public class Command { private Integer quantite; private Product product; public Command(Product product, Integer quantite) { this.product = product; this.quantite = quantite; } public Integer getQuantite() { return quantite; } public void setQuantite(Integer quantite) { this.quantite = quantite; } public Product getProduct() { return product; } public void setProduct(Product product) { this.product = product; } } public static void main(String[] args) { launch(args); } @Override public void start(Stage stage) throws Exception { Product p1 = new Product("Product 1"); Product p2 = new Product("Product 2"); final ObservableList<Product> products = FXCollections.observableArrayList(p1, p2); ObservableList<Command> commands = FXCollections.observableArrayList(new Command(p1, 20)); TableView<Command> tv = new TableView<Command>(); tv.setItems(commands); TableColumn<Command, Product> tc = new TableColumn<Command, Product>("Product"); tc.setMinWidth(140); tc.setCellValueFactory(new Callback<TableColumn.CellDataFeatures<Command,Product>, ObservableValue<Product>>() { @Override public ObservableValue<Product> call(CellDataFeatures<Command, Product> cdf) { try { JavaBeanObjectPropertyBuilder<Product> jbdpb = JavaBeanObjectPropertyBuilder.create(); jbdpb.bean(cdf.getValue()); jbdpb.name("product"); return (ObservableValue) jbdpb.build(); } catch (NoSuchMethodException e) { System.err.println(e.getMessage()); } return null; } }); final StringConverter<Product> converter = new StringConverter<ComboBoxTableCellTest.Product>() { @Override public String toString(Product p) { return p.getName(); } @Override public Product fromString(String s) { // TODO Auto-generated method stub return null; } }; tc.setCellFactory(new Callback<TableColumn<Command,Product>, TableCell<Command,Product>>() { @Override public TableCell<Command, Product> call(TableColumn<Command, Product> tc) { return new ComboBoxTableCell<Command, Product>(converter, products) { @Override public void updateItem(Product product, boolean empty) { super.updateItem(product, empty); if (product != null) { setText(product.getName()); } } }; } }); tv.getColumns().add(tc); tv.setEditable(true); Scene scene = new Scene(tv, 140, 200); stage.setScene(scene); stage.show(); } }

    Read the article

  • ASPX has image from portal.mxlogic.com

    - by codie
    I have a aspx page I'm trying to (remotely) debug. It should add an image and set the src. The value seems correct if i msgbox the value that should be used for the "ImageUrl" But viewing the page there is no image and the src is: http://portal.mxlogic.com/images/transparent.gif This is a mcaffee page so is this some security thing...that is just a wild\crazy guess. Maybe i'm missing something very obvious...I did not write the code and I'm not really a aspx developer. Any ideas?? llf as requested some code... TableCell tc = new TableCell(); {code to create imgurl ... very specific to this situation} MessageBox(imgurl); //The imgurl value here is correct if (imgurl != null) { image.ImageUrl = imgurl; } else { MessageBox("image url is null"); } tc.Controls.Add(image); tr.Cells.Add(tc); Table1.Rows.Add(tr)

    Read the article

  • Problem with mysql query to replace a string

    - by alex
    I've used mysql's update replace function before, but even though I think I'm following the same syntax, I can't get this to work. Here's what I'm trying to do: UPDATE contained_widgets SET preference_values = REPLACE(preference_values, '<li><a_href="/enewsletter"><span class="not-tc">eNewsletter</span></a></li>', '<li><a_href="/enewsletter"><span class="not-tc">eNewsletter</span></a></li> <li> <a_href="/projects"><span class="not-tc">Projects</span></a></li>'); Query OK, 0 rows affected (0.00 sec) Rows matched: 77 Changed: 0 Warnings: 0 I don't see what I'm missing. Any help is appreciated. I edited "a " to "a_" because the site thinks I'm posting spam links otherwise.

    Read the article

< Previous Page | 1 2 3 4 5 6 7 8 9 10  | Next Page >