Search Results

Search found 36327 results on 1454 pages for 'text streaming'.

Page 30/1454 | < Previous Page | 26 27 28 29 30 31 32 33 34 35 36 37  | Next Page >

  • Modifying text files and executing programs with command line parameters in c# or c++ on Linux

    - by Robert Harvey
    I have a need to create a utility in Suze Linux. The utility will make modifications to some text files, and then use the information in those text files to program a device in the computer using a different executable which accepts command line parameters. I am fluent in c#, but have never worked with Linux. Should I take the time to learn Gnu C++ to do this, or install Mono? How would I execute the programming utility and pass it command line parameters?

    Read the article

  • How to Enable Full-Text Index on Sql Server 2008 Table

    - by michaeldelorenzo
    Not sure what's happening with this, but here's my question. I have a Sql Server 2008 database that I need to be able to do full-text indexing/searching but when I try to setup my indices on the table, I get the following: I've tried running this stored procedure on my database and it's successful: EXEC sp_fulltext_database @action = 'enable' But I still get the above window and my full-text searches don't return any results when they should. What am I missing?

    Read the article

  • How to convert Xml files to Text Files 2

    - by John
    Hi all, I have around 8000 xml files that needs to be converted into text files. The text file must contain title, description and keywords of the xml file without the tags and removing other elements and attributes as well. In other words, i need to create 8000 text files containing the title,description and keywords of the xml file. I need codings for this to be done systematically. Any help would be greatly appreciated. Thanks in advance. Hey all thank you all so so much with your replies. Here's a sample of what my xml looks like: <?xml version="1.0"?> <metadata> <identifier>43productionsNightatthegraveyard</identifier> <title>Night at the graveyard</title> <collection>opensource_movies</collection> <mediatype>movies</mediatype> <resource>movies</resource> <upload_application appid="ccPublisher" version="2.2.1"/> <uploader>[email protected]</uploader> <description>una noche en el cementerio (terror)</description> <license>http://creativecommons.org/licenses/by-nc/3.0/</license> <title>Night at the graveyard</title> <format>Video</format> <adder>[email protected]</adder> <licenseurl>http://creativecommons.org/licenses/by-nc/3.0/</licenseurl> <year>2007</year> <keywords>Night,at,the,graveyard,43,productions</keywords> <holder>43 productions</holder> <publicdate>2007-04-11 19:52:28</publicdate> </metadata> And this would be the output: una noche en el cementerio (terror) Night at the graveyard Night,at,the,graveyard,43,productions This need to be saved with the same name but in text format. Thanks all so much if any more suggestions would be much appreciated.

    Read the article

  • Writing text file on local server MVC 2.0

    - by Liado
    Hi, i'm trying to write a text file on remote server, i'm using the following code: [AcceptVerbs(HttpVerbs.Post)] public ActionResult Index(UserModels model) { if (!ModelState.IsValid) { return View("Index"); } try { using (StreamWriter w = new StreamWriter(Server.MapPath(TEXT_FILE_NAME), true)) { w.WriteLine(model.Email.ToString()); // Write the text } } catch { } the folder is still empty, can someone help? what should be the problem? Thanks

    Read the article

  • Reading a Text file in xcode

    - by Nicolaj Zefting
    First off, I'm a complete beginner. This might be a stupid question, but here it goes: I'm currently working on an App than contains Latin texts that the users can view and read. I'm using Xcode 4 with the storybord function. Theway the app is built: user selects author - then the book - then app shows the text. I am kind of confused because i need to have various text files, depending on the users choice.

    Read the article

  • Generating text file from database

    - by Goldmember
    I have a requirement to hand-code an text file from data residing in a SQL table. Just wondering if there are any best practices here. Should I write it as an XMLDocument first and transform using XSL or just use Streamwriter and skip transformation altogether? The generated text file will be in EDIFACT format, so layout is very specific.

    Read the article

  • Text extra aliased(jagged) in IE - looks terrible - but OK in FF and Chrome

    - by jon
    I am building a website - http://www.efficaxdevelopment.com As you can see when you load the page(in IE) the text on the page that isn't an image or the menu looks terrible, while in FF and Chrome the text looks fine. you can view the source on the page and the css is here http://www.efficaxdevelopment.com/styles/mainstyle.css Also, the sliding bar over the menu appears a few pixels left of where it appears in FF and IE. Any ideas?

    Read the article

  • Find More Streaming TV Online with Clicker.tv

    - by DigitalGeekery
    Looking for a way to access more of your favorite TV Shows and other online entertainment? Today we’ll take a look at Clicker.tv which offers an awesome way to find tons of TV programs and movies. Clicker.tv Clicker.tv is an HTML5 web application that indexes both free and premium content from sources like Hulu, Netflix, Amazon, iTunes, and more. Some movies or episodes, such as those from Netflix and Amazon.com’s Video on Demand, will require viewers to have a membership, or pay a fee to access content. There is also a Clicker.tv app for Boxee.   Navigation Navigating in Clicker.tv is rather easy with your keyboard. Directional Keys: navigate up, down, left, and right. Enter: make a selection Backspace: return to previous screen Escape: return to the Clicker.tv home screen. Note: You can also navigate through Clicker.tv with your PC remote. Recommended Browsers Firefox 3.6 + Safari 4.0 + Internet Explorer 8 + Google Chrome Note: You’ll need the latest version of Flash installed to play the majority of content. Earlier versions of the above browsers may work, but for full keyboard functionality, stick with the recommendations. Using Clicker.tv The first time you go to Clicker.tv, (link below) you’ll be met with a welcome screen and some helpful hints. Click Enter when finished.   The Home screen feature Headliners, Trending Shows, and Trending Episodes. You can scroll through the different options and category links along the left side.   The Search link pulls up an onscreen keyboard so you can enter search terms with a remote as well as a keyboard. Type in your search terms and matching items are displayed on the screen.   You can also browse by a wide variety of categories. Select TV to browse only available TV programs. Or, browse only Movies in the movie category. There are also links for Web content and Music.   Creating an Account You can access all Clicker.tv content without an account, but a Clicker account allows users to create playlists and subscribe to shows and have them automatically added to their playlist. You’ll need to go to Clicker.com and create an account. You’ll find the link at the upper right of the page. Enter a username, password and email address. There also an option to link with Facebook, or you can simply Skip this step.   Go to Clicker.tv and sign in. You can manually type in your credentials or use the onscreen keyboard with your remote.   Settings If you’d prefer not to display content from premium sites or Netflix, you can remove them through the Settings. Toggle Amazon, iTunes and Netflix on or off.   Watching Episodes To watch an episode, select the image to begin playing from the default source, or select one of the other options. You can see in the example below that you can choose to watch the episode from Fox, Hulu, or Amazon Video on Demand.   Your episode will then launch and begin playing from your chosen source. If you choose a premium content source such as iTunes or Amazon’s VOD, you’ll be taken to the Amazon’s website or iTunes and prompted to purchase the content.   Playlists Once you’ve created an account and signed in, you can begin adding Shows to your playlist. Choose a series and select Add to Playlist.   You’ll see in the example below that Family Guy has been Added and the number 142 is shown next to the playlist icon to indicate that 142 episodes has been added to your playlist. Underneath the listings for each episode in your playlist you can mark as Watched, or Remove individual episodes.   You can also view the playlist or make any changes from the Clicker.com website. Click on “Playlist” on the top right of the Clicker.com site to access your playlists. You can select individual episodes from your playlists, remove them, or mark them as watched or unwatched. Clicker.TV and Boxee Boxee offers a Clicker.TV app that features a limited amount of the Clicker.TV content. You’ll find Clicker.TV located in the Boxee Apps Library. Select the Clicker App and then choose Start. From the Clicker App interface you can search or browse for available content. Select an episode you’d like to view… Then select play in the pop up window. You can also add it to your Boxee queue, share it, or add a shortcut, just as you can from other Boxee apps. When you click play your episode will launch and begin playing in Boxee. Conclusion Clicker.TV is currently still in Beta and has some limitations. Typical remotes won’t work completely in all external websites. So, you’ll still need a keyboard to be able to perform some operations such as switching to full screen mode. The Boxee app offers a more fully remote friendly environment, but unfortunately lacks a good portion of the Clicker.tv content. As with many content sites, availability of certain programming may be limited by your geographic location. Want to add Clicker.TV functionality to Windows Media Center? You can do so through the Boxee Integration for Windows 7 Media Center plug-in. Clicker.tv Clicker.com Similar Articles Productive Geek Tips Share Digital Media With Other Computers on a Home Network with Windows 7Stream Music and Video Over the Internet with Windows Media Player 12Listen to Online Radio with AntennaEnable Media Streaming in Windows Home Server to Windows Media PlayerNorton Internet Security 2010 [Review] TouchFreeze Alternative in AutoHotkey The Icy Undertow Desktop Windows Home Server – Backup to LAN The Clear & Clean Desktop Use This Bookmarklet to Easily Get Albums Use AutoHotkey to Assign a Hotkey to a Specific Window Latest Software Reviews Tinyhacker Random Tips HippoRemote Pro 2.2 Xobni Plus for Outlook All My Movies 5.9 CloudBerry Online Backup 1.5 for Windows Home Server Nice Websites To Watch TV Shows Online 24 Million Sites Windows Media Player Glass Icons (icons we like) How to Forecast Weather, without Gadgets Outlook Tools, one stop tweaking for any Outlook version Zoofs, find the most popular tweeted YouTube videos

    Read the article

  • Appcelerator Titanium - auto height table views break with shortish text

    - by ceejayoz
    I posted this on the Appcelerator Titanium dev Q&A site, but maybe someone here has had this issue... KitchenSink 1.1 illustrates this issue. In table_view_api_auto_height.js, changing row: addRow(0,'This is some long text. This is some long text. This is some long text. This is some long text. This is some long text. This is some long text. This is some long text. This is some long text. This is some long text. This is some long text. This is some long text. This is some long text. This is some long text. This is some long text. This is some long text. This is some long text. This is some long text. This is some long text.'); to something like: addRow(0,'This is some long text. This is some long text.'); results in incorrect left padding on the row. See screenshot:

    Read the article

  • Webrat says it can't find some text, but the text is actually there

    - by Jason
    I have a webpage that has a form button on it called "delete", and a cuke scenario that has the line: And I should see "delete" When I run the scenario, I get this error: expected the following element's content to include "delete" ...and it dumps the webrat page to stdout and the "delete" is, in fact, not there. So far so good. However, when I tell webrat to show me the page before the error happens: Then show me the page And I should see "delete" ...Safari fires up and shows me the page, and in Safari there's the "delete" button, totally there. Why is webrat not finding the form button? I've also had this same problem with form fields, such as text inputs that have a value in them when the page loads, but webrat says there's nothing there. Looking at it in Safari shows, again, that the field does have the right text in it. Is this a bug, or is webrat just not suitable for checking form elements? Is there a different way to do this? Thanks!

    Read the article

  • PandoraBar Packs Pandora Radio Client into a Compact Case

    - by Jason Fitzpatrick
    This stylish and compact build makes it easy to enjoy streaming radio without the bulk and overhead of running your entire computer to do so. Check out the video to see the compact streaming radio box in action. Courtesy of tinker blog Engscope, we find this clean Pandora-client-in-box build. Currently the project blog has a cursory overview of the project with the demo video but promises future updates detailing the software and hardware components of the build. If you can’t wait that long, make sure to check out some of the previous Wi-Fi radio builds we’ve shared: DIY Wi-Fi Radio Brings Wireless Tunes Anywhere in Your House and Wi-Fi Speakers Stream Music Anywhere. Pandobar [via Hacked Gadgets] How To Create a Customized Windows 7 Installation Disc With Integrated Updates How to Get Pro Features in Windows Home Versions with Third Party Tools HTG Explains: Is ReadyBoost Worth Using?

    Read the article

  • Change input text to regular text on blur and ability to edit jQuery

    - by eknown
    I'm creating a form where I'm eliminating the use of a save button. The form is made up of input text boxes and textareas. After the user enters data into the input field, I want to trigger an onBlur function and change the input into a span that contains the information that the user entered. I also want to have the ability to edit this information, so if the user clicks on the newly created span with text, it will turn back into the input field with the current information for their editing pleasure. For reference, I'm looking to have a functionality pretty much like on editing a photo title on Flickr. If possible, I'd also like to have the textbox show "saving..." for half a second after the blur to reflect interaction with server.

    Read the article

  • ASP.NET Conditionally Change ButtonField text at runTime

    - by Rodney Vinyard
    ASP.NET Conditionally Change ButtonField text at runTime   <asp:ButtonField CommandName="Edit" HeaderText="" Text="Edit" ButtonType="Link" />       protected void gvRequests_RowDataBound(object sender, GridViewRowEventArgs e)     {         if (e.Row.RowType == DataControlRowType.DataRow)         {             //----------------------------------------------------             // If status = "Saved", change buttonField.LinkButton.Text to "Copy"             //----------------------------------------------------             if (e.Row.Cells[(int)gCol.Status].Text == "Saved")             {                 //----------------------------------------------------                 // no !                 //----------------------------------------------------                 //string x = e.Row.Cells[(int)gCol.EditLink].Text;                 //e.Row.Cells[(int)gCol.EditLink].Text = "Copy";                   //----------------------------------------------------                 // yes !                 //----------------------------------------------------                 LinkButton linkButton = (LinkButton)e.Row.Cells[(int)gCol.EditLink].Controls[0];                 linkButton.Text = "Copy";             }         }     }

    Read the article

  • Issue with parsed text with HTMLCleaner - spaces at the begining of text

    - by ansol90
    Im able to get text using HTMLCleaner from website. The problem is that when I set the text to a TextView it shows the beginning of the text with a big space on it. Here is the screenshot of what im talking about. I have tried android:gravity but nothing happened. Please help. Here is my Code: private class SiteParser extends AsyncTask<String, Void, String> { protected String doInBackground(String... arg) { String output = null; try { HtmlHelper hh = new HtmlHelper(new URL(arg[0])); List<TagNode> news = hh.getnewsByClass("TextoPrint"); for (Iterator<TagNode> iterator = newss.iterator(); iterator .hasNext();) { TagNode divElement = (TagNode) iterator.next(); output = divElement.getText().toString(); } } catch (Exception e) { e.printStackTrace(); } return output; } protected void onPostExecute(String output) { Bundle bundle=new Bundle(); bundle.putString("body",output); Intent mainIntent = new Intent(act, MyView.class); mainIntent.putExtras(bundle); startActivity(mainIntent); act.finish(); } } public class HtmlHelper { TagNode rootNode; public HtmlHelper(URL htmlPage) throws IOException, XPatherException { HtmlCleaner cleaner = new HtmlCleaner(); rootNode = cleaner.clean(htmlPage); } List<TagNode> getnewsByClass(String Classname){ List<TagNode> newsList = new ArrayList<TagNode>(); TagNode divElements[] = rootNode.getElementsByName("div", true); for (int i = 0; divElements != null && i < divElements.length; i++) { String classType = divElements[i].getAttributeByName("id"); if (classType != null && classType.equals(Classname)) { newsList.add(divElements[i]); } } return newsList; } }

    Read the article

  • Send SMS text messages for FREE using Java ME

    - by hinkmond
    Here's a way to get around those nasty SMS text messages charges (and maybe a way to get around the Pakistan SMS text censors too!). Use this Java ME SMS text app for your Java ME mobile phone, called JaxtrSMS: See: JaxtrSMS free Java ME SMS Here's a quote: JaxtrSMS lets you send FREE SMS and txt messages to any mobile phone in the world. Best of all, the receiver does not have to have the JaxtrSMS app. International and local SMS/texting can be expensive but with JaxtrSMS you can text anyone in the world for FREE! Great! Now, you can send 2,000 text messages from your phone every month and not worry about a huge bill. You don't send 2,000 text message in a month? Well, get it for your teenage kids then. They certainly send 2,000 text messages in a month... Hinkmond

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • knockout bind text label to dropdown value selected option text

    - by Adam Levitt
    Is there a simple way to bind the textbox of a div to change based on the text value of the selected option in a dropdown on the same page? <div data-bind="text: dropdownValue"></div> <select> <option value="1">Value1</option> <option value="2">Value2</option> </select> Please note, I don't want to put the values into the select element using javascript. I'd like to bind to the value straight from the HTML. I can also include jQuery to make it work.

    Read the article

  • Changing Text colour in text field by dropdown menu - Visual Studio 2008

    - by Wayne
    Hey, i'm just doing some testing on Visual Studio 2008, what i'm trying to do is to change the text colour inside the multi-textfield which isn't working and I don't know why... Public Class Form1 Dim ColourValue As Color Private Sub Form1_Load(ByVal sender As System.Object, ByVal e As System.EventArgs) Handles MyBase.Load rbBlue.Checked = False rbRed.Checked = False rbGreen.Checked = False End Sub Private Sub rbRed_CheckedChanged(ByVal sender As System.Object, ByVal e As System.EventArgs) Handles rbRed.CheckedChanged txtSpace.BackColor = Color.Red End Sub Private Sub rbBlue_CheckedChanged(ByVal sender As System.Object, ByVal e As System.EventArgs) Handles rbBlue.CheckedChanged txtSpace.BackColor = Color.Blue End Sub Private Sub rbGreen_CheckedChanged(ByVal sender As System.Object, ByVal e As System.EventArgs) Handles rbGreen.CheckedChanged txtSpace.BackColor = Color.Green End Sub Private Sub cbColours_SelectedValueChanged(ByVal sender As Object, ByVal e As System.EventArgs) Handles cbColours.SelectedValueChanged ColourValue = cbColours.SelectedValue txtSpace.BackColor = ColourValue End Sub End Class Basically i have the radio buttons that would change the background colour of the textfield, but i just need the dropdown menu to change the text colour. Many thanks :)

    Read the article

  • Ask the Readers: Have You Cut the Cable Cord?

    - by Jason Fitzpatrick
    The proliferation of streaming services and diverse media content has made cutting the cable cord an appetizing option for many people. Have you cut the cord, stuck with traditional services, or mixed the two together? It’s easier than ever to ditch the cable subscription and still keep watching your favorite TV shows and movies (but still tricky to catch live events and television without a cable subscription). This week we’re interested in hearing all about your media arrangements: Do you have a traditional cable bundle? Ditched it for a Netflix-only experience? Pay for both because you just can’t get enough of live TV and streaming content? Sounds off in the comments with the state of your media setup, the more detailed the better, and then check back in on Friday for the What You Said roundup. 6 Ways Windows 8 Is More Secure Than Windows 7 HTG Explains: Why It’s Good That Your Computer’s RAM Is Full 10 Awesome Improvements For Desktop Users in Windows 8

    Read the article

  • When page loads display 1st image text - hide all other text

    - by Jonah1289
    Hi I have created http://techavid.com/design/test3.html and when you load the page you see there are 3 images. The sun image is focused(in color), while the others are greyed out until clicked. That is how it should be for the images. Also when you load the page you see under each image it's own text(i.e. 1st: Sun, 2nd: Airplane, 3rd: Nano), but on page load I only want 1st:Sun to display and hide all other text until their respective image is clicked. Any idea how to do this? thanks :) J

    Read the article

< Previous Page | 26 27 28 29 30 31 32 33 34 35 36 37  | Next Page >