Search Results

Search found 7706 results on 309 pages for 'inner join'.

Page 306/309 | < Previous Page | 302 303 304 305 306 307 308 309  | Next Page >

• ASP.NET how to save textbox in database?

  - by mahsoon

  I used some textboxes to get some info from users + a sqldatasource <tr> <td class="style3" colspan="3" style="font-size: medium; font-family: 'B Nazanin'; font-weight: bold; position: relative; right: 170px" > &nbsp; ????? ??????? ????</td> </tr> <tr> <td class="style3"> &nbsp;&nbsp;&nbsp; <asp:Label ID="Label1" runat="server" Text=" ???: " Font-Bold="True" Font-Names="B Nazanin" Font-Size="Medium"></asp:Label> </td> <td class="style2"> <asp:TextBox ID="FirstName" runat="server"></asp:TextBox> </td> <td class="style4"> <asp:RequiredFieldValidator ID="RequiredFieldValidator1" runat="server" Display="Dynamic" ErrorMessage="???? ???? ??? ?????? ???" ControlToValidate="FirstName">*</asp:RequiredFieldValidator> </td> </tr> <tr> <td class="style3"> &nbsp;&nbsp;&nbsp;<asp:Label ID="Label2" runat="server" Text=" ??? ????????: " Font-Bold="True" Font-Names="B Nazanin" Font-Size="Medium"></asp:Label> </td> <td class="style2"> <asp:TextBox ID="LastName" runat="server"></asp:TextBox> </td> <td class="style4"> <asp:RequiredFieldValidator ID="RequiredFieldValidator2" runat="server" Display="Dynamic" ErrorMessage="???? ???? ??? ???????? ?????? ???" ControlToValidate="LastName">*</asp:RequiredFieldValidator> </td> </tr> <tr> <td class="style3"> &nbsp;&nbsp;&nbsp;<asp:Label ID="Label3" runat="server" Text=" ????? ???????? : " Font-Bold="True" Font-Names="B Nazanin" Font-Size="Medium"></asp:Label> </td> <td class="style2"> <asp:TextBox ID="StudentNumber" runat="server"></asp:TextBox> </td> <td class="style4"> <asp:RequiredFieldValidator ID="RequiredFieldValidator3" runat="server" Display="Dynamic" ErrorMessage="???? ???? ????? ???????? ?????? ???" ControlToValidate="StudentNumber">*</asp:RequiredFieldValidator> </td> </tr> <tr> <td class="style3"> &nbsp;&nbsp;<asp:Label ID="Label4" runat="server" Text="  ????? ???? : " Font-Bold="True" Font-Names="B Nazanin" Font-Size="Medium"></asp:Label> </td> <td class="style2"> <asp:TextBox ID="DateOfBirth" runat="server"></asp:TextBox> </td> <td class="style4"> <asp:CompareValidator ID="CompareValidator1" runat="server" Display="Dynamic" ErrorMessage="????? ???? ?????? ?? ???? ??????" Operator="DataTypeCheck" Type="Date" ControlToValidate="dateOfBirth"></asp:CompareValidator> </td> </tr> <tr> <td class="style3"> &nbsp;</td> <td class="style2"> <asp:Button ID="SaveButton" runat="server" Text=" ????? ???????" Width="102px" style="margin-right: 15px; height: 26px;" /> </td> <td class="style4"> <asp:SqlDataSource ID="SqlDataSource1" runat="server" ConnectionString="<%$ ConnectionStrings:ASPNETDBConnectionString1 %>" SelectCommand="SELECT aspnet_personalInformation.FirstName, aspnet_personalInformation.LastName, aspnet_personalInformation.StudentNumber, aspnet_personalInformation.DateOfBirth FROM aspnet_personalInformation INNER JOIN aspnet_Users ON aspnet_personalInformation.UserId = aspnet_Users.UserId WHERE aspnet_personalInformation.UserId=aspnet_Users.UserId ORDER BY aspnet_personalInformation.LastName" InsertCommand="INSERT INTO aspnet_PersonalInformation(UserId) SELECT UserId FROM aspnet_Profile"> </asp:SqlDataSource> </td> </tr> </table> i wanna save firstname lastname studentnumber and dateofbirth in aspnet_personalinformation table in database but before that, i fill one column of aspnet_personalinformation table named UserId by inserting sql command with aspnet_profile.userid now by running this code my table has still blankes protected void SaveButton_Click(object sender, EventArgs e) { string str= "Data Source=.\\SQLEXPRESS;AttachDbFilename=|DataDirectory|\\ASPNETDB.MDF;Integrated Security=True;User Instance=True"; SqlConnection con = new SqlConnection(str); con.Open(); string query = "INSERT INTO aspnet_PersonalInformation( FirstName, LastName,StudentNumber,DateOfBirth) VALUES ('" + this.FirstName.Text + "','" + this.LastName.Text + "','" + this.StudentNumber.Text + "','" + this.DateOfBirth.Text + "') where aspnet_PersonalInformation.UserId=aspnet_Profile.UserID"; SqlCommand cmd=new SqlCommand(query,con); cmd.ExecuteNonQuery(); con.Close(); } but it doesn't work help me plz

  Read the article

• Parse a text file into multiple text file

  - by Vijay Kumar Singh

  I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

  Read the article

• Transaction issue in java with hibernate - latest entries not pulled from database

  - by Gearóid

  Hi, I'm having what seems to be a transactional issue in my application. I'm using Java 1.6 and Hibernate 3.2.5. My application runs a monthly process where it creates billing entries for a every user in the database based on their monthly activity. These billing entries are then used to create Monthly Bill object. The process is: Get users who have activity in the past month Create the relevant billing entries for each user Get the set of billing entries that we've just created Create a Monthly Bill based on these entries Everything works fine until Step 3 above. The Billing Entries are correctly created (I can see them in the database if I add a breakpoint after the Billing Entry creation method), but they are not pulled out of the database. As a result, an incorrect Monthly Bill is generated. If I run the code again (without clearing out the database), new Billing Entries are created and Step 3 pulls out the entries created in the first run (but not the second run). This, to me, is very confusing. My code looks like the following: for (User user : usersWithActivities) { createBillingEntriesForUser(user.getId()); userBillingEntries = getLastMonthsBillingEntriesForUser(user.getId()); createXMLBillForUser(user.getId(), userBillingEntries); } The methods called look like the following: @Transactional public void createBillingEntriesForUser(Long id) { UserManager userManager = ManagerFactory.getUserManager(); User user = userManager.getUser(id); List<AccountEvent> events = getLastMonthsAccountEventsForUser(id); BillingEntry entry = new BillingEntry(); if (null != events) { for (AccountEvent event : events) { if (event.getEventType().equals(EventType.ENABLE)) { Calendar cal = Calendar.getInstance(); Date eventDate = event.getTimestamp(); cal.setTime(eventDate); double startDate = cal.get(Calendar.DATE); double numOfDaysInMonth = cal.getActualMaximum(Calendar.DAY_OF_MONTH); double numberOfDaysInUse = numOfDaysInMonth - startDate; double fractionToCharge = numberOfDaysInUse/numOfDaysInMonth; BigDecimal amount = BigDecimal.valueOf(fractionToCharge * Prices.MONTHLY_COST); amount.scale(); entry.setAmount(amount); entry.setUser(user); entry.setTimestamp(eventDate); userManager.saveOrUpdate(entry); } } } } @Transactional public Collection<BillingEntry> getLastMonthsBillingEntriesForUser(Long id) { if (log.isDebugEnabled()) log.debug("Getting all the billing entries for last month for user with ID " + id); //String queryString = "select billingEntry from BillingEntry as billingEntry where billingEntry>=:firstOfLastMonth and billingEntry.timestamp<:firstOfCurrentMonth and billingEntry.user=:user"; String queryString = "select be from BillingEntry as be join be.user as user where user.id=:id and be.timestamp>=:firstOfLastMonth and be.timestamp<:firstOfCurrentMonth"; //This parameter will be the start of the last month ie. start of billing cycle SearchParameter firstOfLastMonth = new SearchParameter(); firstOfLastMonth.setTemporalType(TemporalType.DATE); //this parameter holds the start of the CURRENT month - ie. end of billing cycle SearchParameter firstOfCurrentMonth = new SearchParameter(); firstOfCurrentMonth.setTemporalType(TemporalType.DATE); Query query = super.entityManager.createQuery(queryString); query.setParameter("firstOfCurrentMonth", getFirstOfCurrentMonth()); query.setParameter("firstOfLastMonth", getFirstOfLastMonth()); query.setParameter("id", id); List<BillingEntry> entries = query.getResultList(); return entries; } public MonthlyBill createXMLBillForUser(Long id, Collection<BillingEntry> billingEntries) { BillingHistoryManager manager = ManagerFactory.getBillingHistoryManager(); UserManager userManager = ManagerFactory.getUserManager(); MonthlyBill mb = new MonthlyBill(); User user = userManager.getUser(id); mb.setUser(user); mb.setTimestamp(new Date()); Set<BillingEntry> entries = new HashSet<BillingEntry>(); entries.addAll(billingEntries); String xml = createXmlForMonthlyBill(user, entries); mb.setXmlBill(xml); mb.setBillingEntries(entries); MonthlyBill bill = (MonthlyBill) manager.saveOrUpdate(mb); return bill; } Help with this issue would be greatly appreciated as its been wracking my brain for weeks now! Thanks in advance, Gearoid.

  Read the article

• Perl LWP::UserAgent mishandling UTF-8 response

  - by RedGrittyBrick

  When I use LWP::UserAgent to retrieve content encoded in UTF-8 it seems LWP::UserAgent doesn't handle the encoding correctly. Here's the output after setting the Command Prompt window to Unicode by the command chcp 65001 Note that this initially gives the appearance that all is well, but I think it's just the shell reassembling bytes and decoding UTF-8, From the other output you can see that perl itself is not handling wide characters correctly. C:\perl getutf8.pl ====================================================================== HTTP/1.1 200 OK Connection: close Date: Fri, 31 Dec 2010 19:24:04 GMT Accept-Ranges: bytes Server: Apache/2.2.8 (Win32) PHP/5.2.6 Content-Length: 75 Content-Type: application/xml; charset=utf-8 Last-Modified: Fri, 31 Dec 2010 19:20:18 GMT Client-Date: Fri, 31 Dec 2010 19:24:04 GMT Client-Peer: 127.0.0.1:80 Client-Response-Num: 1 <?xml version="1.0" encoding="UTF-8"? <nameBudejovický Budvar</name ====================================================================== response content length is 33 ....v....1....v....2....v....3....v....4 <nameBudejovický Budvar</name . . . . v . . . . 1 . . . . v . . . . 2 . . . . v . . . . 3 . . . . 3c6e616d653e427564c49b6a6f7669636bc3bd204275647661723c2f6e616d653e < n a m e B u d ? ? j o v i c k ? ? B u d v a r < / n a m e Above you can see the payload length is 31 characters but Perl thinks it is 33. For confirmation, in the hex, we can see that the UTF-8 sequences c49b and c3bd are being interpreted as four separate characters and not as two Unicode characters. Here's the code #!perl use strict; use warnings; use LWP::UserAgent; my $ua = LWP::UserAgent-new(); my $response = $ua-get('http://localhost/Bud.xml'); if (! $response-is_success) { die $response-status_line; } print '='x70,"\n",$response-as_string(), '='x70,"\n"; my $r = $response-decoded_content((charset = 'UTF-8')); $/ = "\x0d\x0a"; # seems to be \x0a otherwise! chomp($r); # Remove any xml prologue $r =~ s/^<\?.*\?\x0d\x0a//; print "Response content length is ", length($r), "\n\n"; print "....v....1....v....2....v....3....v....4\n"; print $r,"\n"; print ". . . . v . . . . 1 . . . . v . . . . 2 . . . . v . . . . 3 . . . . \n"; print unpack("H*", $r), "\n"; print join(" ", split("", $r)), "\n"; Note that Bud.xml is UTF-8 encoded without a BOM. How can I persuade LWP::UserAgent to do the right thing? P.S. Ultimately I want to translate the Unicode data into an ASCII encoding, even if it means replacing each non-ASCII character with one question mark or other marker. I have accepted Ysth's "upgrade" answer - because I know it is the right thing to do when possible. However I am going to use a work-around (which may depress Tom further): $r = encode("cp437", decode("utf8", $r));

  Read the article

• Facebook like button not going back side on the fixed div

  - by Lahiru Chathuranga

  I added a Facebook like button to my website.My website has a fixed div on top of the page(blue color div in the image). The like button is below that(in a div which can scroll) My problem is when the page is scroll down the like button comes on top of the fixed div(blue color).I want to scroll it from the backside of the div.How can I do that? There are couple of screenshots I added Before Scroll After Scroll Here is my code of the fixed div <script type="text/javascript"> function got_to_signup(){ window.location.href = "view/policy"; } </script> <div id="fb-root"></div> <script>(function(d, s, id) { var js, fjs = d.getElementsByTagName(s)[0]; if (d.getElementById(id)) return; js = d.createElement(s); js.id = id; js.src = "//connect.facebook.net/en_GB/all.js#xfbml=1&appId=368003049941951"; fjs.parentNode.insertBefore(js, fjs); }(document, 'script', 'facebook-jssdk'));</script> <div style="width:100%;background-color:#0094d6;" > <div id="dd" style="background-color:#0094d6; width:100%; height:75px;position:fixed; " class="center "><div id="a" style="width:1010px; height:75px; background-color:#000000;background:url(xx.png); background-repeat:no-repeat; font-family:Arial, Helvetica, sans-serif; font-size:11px; color:#003; " class="inner div_border"> <table width="1010" border="0" > <tr > <td width="15%" rowspan="2"><a href="" style="cursor:pointer; cursor:hand;"><div style="width:200px; height:50px;background-color:none;"></div></a></td> <td width="22%" height="14">&nbsp;</td> <td width="5%">&nbsp;</td> <td width="5%">&nbsp;</td> <td width="28%">&nbsp;</td> <td width="2%">&nbsp;</td> <td width="23%">&nbsp;</td> </tr> <tr> <td colspan="4"> </td> <td colspan="2"><span style="float: right; " ><div style="background-color:#006d9e;border-radius:3px; width:250px; height:34px; display: table; vertical-align: middle; color:#FFF; "> <table width="100%" border="0" > <tr > <td width="43%" style="text-align:center"> Start to bump !</td> <td width="29%"><div id='basic-modal'><span style="float: right; " ><input name="login_btn" type="button" class="login_button basic" id="login_btn" value="Sign in" /></span></div></td> <td width="28%"><span style="float: right; " ><form id="form_reg" method="post"><input name="register_btn" type="button" class="register_button" id="register_btn" value="Sign up" onclick="got_to_signup()"/></form></span></td> </tr> </table> </div></span></td> </tr> <tr> <td>&nbsp;</td> <td>&nbsp;</td> <td>&nbsp;</td> <td>&nbsp;</td> <td>&nbsp;</td> <td>&nbsp;</td> <td style="color:#FFF; font:Arial, Helvetica, sans-serif; font-size:9px; text-align:right;"> Beta Version </td> </tr> </table> </div></div></div> here is my facebook like button code </script> <div id="fb-root"></div> <script>(function(d, s, id) { var js, fjs = d.getElementsByTagName(s)[0]; if (d.getElementById(id)) return; js = d.createElement(s); js.id = id; js.src = "//connect.facebook.net/en_GB/all.js#xfbml=1&appId=368003049941951"; fjs.parentNode.insertBefore(js, fjs); }(document, 'script', 'facebook-jssdk'));</script> <td height="21" colspan="2"> <table width="187" style="margin-left:3px;font-size:1px;background-image:url(share_back.png);background-repeat:no-repeat;border-radius:3px;" > <!--tweeter button--> <tr><td width="71"><a href="https://twitter.com/bump_lk" class="twitter-follow-button" data-show-count="false" style="float:right;">Follow @bump_lk</a> <script>!function(d,s,id){var js,fjs=d.getElementsByTagName(s)[0];if(!d.getElementById(id)){js=d.createElement(s);js.id=id;js.src="//platform.twitter.com/widgets.js";fjs.parentNode.insertBefore(js,fjs);}}(document,"script","twitter-wjs");</script></td> <!--facebook like button--> <td width="48"><div class="fb-like" data-href="https://www.facebook.com/Bump.lk" data-send="false" data-layout="button_count" data-width="10" data-show-faces="false" style="position:relative;"></div> </td></tr></table></td> <td>&nbsp;</td> <td>&nbsp;</td> <td >

  Read the article

• if isset PHP not working?

  - by Ellie

  Okay, Im trying to set a captcha up, However with this code in, it breaks. if(isset($_POST["captcha"])) if($_SESSION["captcha"]==$_POST["captcha"]) When i do it with out it, the page works, but the captcha is letting incorrect submits through. Parse error: syntax error, unexpected '"', expecting T_STRING or T_VARIABLE or T_NUM_STRING in /hermes/waloraweb085/b2027/moo.lutarinet/jointest.php on line 71 <?php $pagetitle = "Home"; $checkrank = 0; include ($_SERVER['DOCUMENT_ROOT'].'/header.inc.php'); ECHO <<<END <br><br> <b><center><i><u>DO NOT</u> USE YOUR NEOPETS PASSWORD OR PIN NUMBER!!!</b></i></center> <p> ?> <?php session_start() ?> <center><P><FORM ACTION="join.pro.php" enctype="multipart/form-data" METHOD=POST> <table width="393" height="188" border="0" cellpadding="0" cellspacing="0"> <td width="150">Username</td> <td width="243"><input type=text name="name" value="" size=32 maxlength=15></td> </tr> <tr> <td>Password</td> <td><input type=password name="pass1" VALUE="" maxlength=15></td> </tr> <tr> <td>Confirm Password</td> <td><input type=password name="pass2" VALUE="" size=32 maxlength=15></td> </tr> <tr> <td>Security Code (4 Diget Number)</td> <td><input type=password name="security" VALUE="" size=32 maxlength=4></td> </tr> <tr> <td>Email Address</td> <td><INPUT TYPE=text NAME="email" VALUE="" SIZE=32 maxlength=100></td> </tr> <tr> <td height="41" colspan="2" valign="middle"><p><p><center> By registering an account here you agree to all of our <A HREF="$baseurl/tos.php">Terms and Conditions</A>. You can also view our <A HREF="$baseurl/privacy.php">Privacy Policy</A>. </center></p></td> </tr> <tr><td align="center">CAPTCHA:<br> (antispam code, 3 black symbols)<br> <table><tr><td><img src="captcha.php" alt="captcha image"></td><td><input type="text" name="captcha" size="3" maxlength="3"></td></tr></table> </td></tr> <td height="27" colspan="2" valign="middle"> <center><input type=submit name=Submit value="Register"></center> </td> </table> </form> <?php if(isset($_POST["captcha"])) if($_SESSION["captcha"]==$_POST["captcha"]) { //CAPTHCA is valid; proceed the message: save to database, send by e-mail ... echo 'CAPTHCA is valid; proceed the message'; } else { echo 'CAPTHCA is not valid; ignore submission'; } ?> <?php END; include ($_SERVER['DOCUMENT_ROOT'].'/footer.inc.php'); ?> captcha.php <?php session_start(); header("Expires: Mon, 26 Jul 1997 05:00:00 GMT"); header("Last-Modified: " . gmdate("D, d M Y H:i:s") . " GMT"); header("Cache-Control: no-store, no-cache, must-revalidate"); header("Cache-Control: post-check=0, pre-check=0", false); header("Pragma: no-cache"); function _generateRandom($length=6) { $_rand_src = array( array(48,57) //digits , array(97,122) //lowercase chars // , array(65,90) //uppercase chars ); srand ((double) microtime() * 1000000); $random_string = ""; for($i=0;$i<$length;$i++){ $i1=rand(0,sizeof($_rand_src)-1); $random_string .= chr(rand($_rand_src[$i1][0],$_rand_src[$i1][1])); } return $random_string; } $im = @imagecreatefromjpeg("http://sketchedneo.com/images/sitedesigns/captcha.jpg"); $rand = _generateRandom(3); $_SESSION['captcha'] = $rand; ImageString($im, 5, 2, 2, $rand[0]." ".$rand[1]." ".$rand[2]." ", ImageColorAllocate ($im, 0, 0, 0)); $rand = _generateRandom(3); ImageString($im, 5, 2, 2, " ".$rand[0]." ".$rand[1]." ".$rand[2], ImageColorAllocate ($im, 255, 0, 0)); Header ('Content-type: image/jpeg'); imagejpeg($im,NULL,100); ImageDestroy($im); ?> Help please anyone? Line 71: if(isset($_POST["captcha"])) Line 72: if($_SESSION["captcha"]==$_POST["captcha"])

  Read the article

• A "Trig" Calculating Class

  - by Clinton Scott

  I have been trying to create a gui that calculates trigonometric functions based off of the user's input. I have had success in the GUI part, but my class that I wrote to hold information using inheritance seems to be messed up, because when I run it gives an error saying: Exception in thread "main" java.lang.RuntimeException: Uncompilable source code - constructor ArcTrigCalcCon in class TrigCalc.ArcTrigCalcCon cannot be applied to given types; required: double,double,double,double,double,double found: java.lang.Double,java.lang.Double,java.lang.Double reason: actual and formal argument lists differ in length at TrigCalc.TrigCalcGUI.(TrigCalcGUI.java:31) at TrigCalc.TrigCalcGUI.main(TrigCalcGUI.java:87) Java Result: 1 and says it is the object causing the problem. Below Will be my code. First I will put up my inheritance class with cosecant secant and cotangent and then my original class with the original 3 trig functions: { public ArcTrigCalcCon(double s, double cs, double t, double csc, double sc, double ct) { // Inherit from the Trig Calc class super(s, cs, t); cosecant = 1/s; secant = 1/cs; cotangent = 1/t; } public void setCsc(double csc) { cosecant = csc; } public void setSec(double sc) { secant = sc; } public void setCot(double ct) { cotangent = ct; } } Here is the first Trigonometric class: public class TrigCalcCon { public double sine; public double cosine; public double tangent; public TrigCalcCon(double s, double cs, double t) { sine = s; cosine = cs; tangent = t; } public void setSin(double s) { sine = s; } public void setCos(double cs) { cosine = cs; } public void setTan(double t) { tangent = t; } public void set(double s, double cs, double t) { sine = s; cosine = cs; tangent = t; } public double getSin() { return Math.sin(sine); } public double getCos() { return Math.cos(cosine); } public double getTan() { return Math.tan(tangent); } } and here is the demo class to run the gui: public class TrigCalcGUI extends JFrame implements ActionListener { // Instance Variables private String input; private Double s, cs, t, csc, sc, ct; private JPanel mainPanel, sinPanel, cosPanel, tanPanel, cscPanel, secPanel, cotPanel, buttonPanel, inputPanel, displayPanel; // Panel Display private JLabel sinLabel, cosLabel, tanLabel, secLabel, cscLabel, cotLabel, inputLabel; private JTextField sinTF, cosTF, tanTF, secTF, cscTF, cotTF, inputTF; //Text Fields for sin, cos, and tan, and inverse private JButton calcButton, clearButton; // Calculate and Exit Buttons // Object ArcTrigCalcCon trC = new ArcTrigCalcCon(s, cs, t); public TrigCalcGUI() { // title bar text. super("Trig Calculator"); // Corner exit button action. setDefaultCloseOperation(JFrame.EXIT_ON_CLOSE); // Create main panel to add each panel to mainPanel = new JPanel(); mainPanel.setLayout(new GridLayout(3,2)); displayPanel = new JPanel(); displayPanel.setLayout(new GridLayout(3,2)); // Assign Panel to each variable inputPanel = new JPanel(); sinPanel = new JPanel(); cosPanel = new JPanel(); tanPanel = new JPanel(); cscPanel = new JPanel(); secPanel = new JPanel(); cotPanel = new JPanel(); buttonPanel = new JPanel(); // Call each constructor buildInputPanel(); buildSinCosTanPanels(); buildCscSecCotPanels(); buildButtonPanel(); // Add each panel to content pane displayPanel.add(sinPanel); displayPanel.add(cscPanel); displayPanel.add(cosPanel); displayPanel.add(secPanel); displayPanel.add(tanPanel); displayPanel.add(cotPanel); // Add three content panes to GUI mainPanel.add(inputPanel, BorderLayout.NORTH); mainPanel.add(displayPanel, BorderLayout.CENTER); mainPanel.add(buttonPanel, BorderLayout.SOUTH); //add mainPanel this.add(mainPanel); // size of window to content this.pack(); // display window setVisible(true); } public static void main(String[] args) { new TrigCalcGUI(); } private void buildInputPanel() { inputLabel = new JLabel("Enter a Value: "); inputTF = new JTextField(5); inputPanel.add(inputLabel); inputPanel.add(inputTF); } // Building Constructor for sinPanel cosPanel, and tanPanel private void buildSinCosTanPanels() { // Set layout and border for sinPanel sinPanel.setLayout(new GridLayout(2,2)); sinPanel.setBorder(BorderFactory.createTitledBorder("Sine")); // sinTF = new JTextField(5); sinTF.setEditable(false); sinPanel.add(sinTF); // Set layout and border for cosPanel cosPanel.setLayout(new GridLayout(2,2)); cosPanel.setBorder(BorderFactory.createTitledBorder("Cosine")); cosTF = new JTextField(5); cosTF.setEditable(false); cosPanel.add(cosTF); // Set layout and border for tanPanel tanPanel.setLayout(new GridLayout(2,2)); tanPanel.setBorder(BorderFactory.createTitledBorder("Tangent")); tanTF = new JTextField(5); tanTF.setEditable(false); tanPanel.add(tanTF); } // Building Constructor for cscPanel secPanel, and cotPanel private void buildCscSecCotPanels() { // Set layout and border for cscPanel cscPanel.setLayout(new GridLayout(2,2)); cscPanel.setBorder(BorderFactory.createTitledBorder("Cosecant")); // cscTF = new JTextField(5); cscTF.setEditable(false); cscPanel.add(cscTF); // Set layout and border for secPanel secPanel.setLayout(new GridLayout(2,2)); secPanel.setBorder(BorderFactory.createTitledBorder("Secant")); secTF = new JTextField(5); secTF.setEditable(false); secPanel.add(secTF); // Set layout and border for cotPanel cotPanel.setLayout(new GridLayout(2,2)); cotPanel.setBorder(BorderFactory.createTitledBorder("Cotangent")); cotTF = new JTextField(5); cotTF.setEditable(false); cotPanel.add(cotTF); } private void buildButtonPanel() { // Create buttons and add events calcButton = new JButton("Calculate"); calcButton.addActionListener(new CalcButtonListener()); clearButton = new JButton("Clear"); clearButton.addActionListener(new ClearButtonListener()); buttonPanel.add(calcButton); buttonPanel.add(clearButton); } @Override public void actionPerformed(ActionEvent e) { } private class CalcButtonListener implements ActionListener { public void actionPerformed(ActionEvent ae) { // Declare boolean variable boolean incorrect = true; // Set input variable to input text field text input = inputTF.getText(); ImageIcon newIcon; ImageIcon frowny = new ImageIcon(TrigCalcGUI.class.getResource("/Sad_Face.png")); Image gm = frowny.getImage(); Image newFrowny = gm.getScaledInstance(100, 100, java.awt.Image.SCALE_FAST); newIcon = new ImageIcon(newFrowny); // If boolean is true, throw exception if(incorrect) { try{Double.parseDouble(input); incorrect = false;} catch(NumberFormatException nfe) { String s = "Invalid Input " + "/n Input Must Be a Numerical value." + "/nPlease Press Ok and Try Again"; JOptionPane.showMessageDialog(null, s, "Invalid", JOptionPane.ERROR_MESSAGE, newIcon); inputTF.setText(""); inputTF.requestFocus(); } } // If boolean is not true, proceed with output if (incorrect != true) { /* Set each text field's output to the String double value * of inputTF */ sinTF.setText(input); cosTF.setText(input); tanTF.setText(input); cscTF.setText(input); secTF.setText(input); cotTF.setText(input); } } } /** * Private inner class that handles the event when * the user clicks the Exit button. */ private class ClearButtonListener implements ActionListener { public void actionPerformed(ActionEvent ae) { // Clear field sinTF.setText(""); cosTF.setText(""); tanTF.setText(""); cscTF.setText(""); secTF.setText(""); cotTF.setText(""); // Clear textfield and set cursor focus to field inputTF.setText(""); inputTF.requestFocus(); } } }

  Read the article

• Create an axpanding image with CSS and div or span

  - by user1594895

  I have a complex image cutted up in alot of slice. You can see http://jsfiddle.net/yefQR/ <!--Force IE6 into quirks mode with this comment tag--> <!DOCTYPE html PUBLIC "-//W3C//DTD XHTML 1.0 Transitional//EN" "http://www.w3.org/TR/xhtml1/DTD/xhtml1-transitional.dtd"> <html xmlns="http://www.w3.org/1999/xhtml" lang="en" xml:lang="en"> <head> <meta http-equiv="Content-Type" content="text/html; charset=iso-8859-1" /> <title>Page Title</title> <style type="text/css"> body{ margin: 0; padding: 0; border: 0; overflow: hidden; height: 100%; max-height: 100%; } #framecontentTop, #framecontentBottom{ position: absolute; top: 0; left: 0; width: 100%; height: 130px; /*Height of top frame div*/ overflow: hidden; /*Disable scrollbars. Set to "scroll" to enable*/ background-color: navy; color: white; } #framecontentBottom{ top: auto; bottom: 0; height: 110px; /*Height of bottom frame div*/ overflow: hidden; /*Disable scrollbars. Set to "scroll" to enable*/ background-color: navy; color: white; } #maincontent{ position: fixed; top: 130px; /*Set top value to HeightOfTopFrameDiv*/ left: 0; right: 0; bottom: 110px; /*Set bottom value to HeightOfBottomFrameDiv*/ overflow: auto; background: #fff; } .innertube{ margin: 15px; /*Margins for inner DIV inside each DIV (to provide padding)*/ } * html body{ /*IE6 hack*/ padding: 130px 0 110px 0; /*Set value to (HeightOfTopFrameDiv 0 HeightOfBottomFrameDiv 0)*/ } * html #maincontent{ /*IE6 hack*/ height: 100%; width: 100%; } </style> </head> <body> <div id="framecontentTop"> <div class="innertube"> <div id="screenshot%20tsam%20900r2c2" style=" background-color: green;position:absolute; left:4px; top:6px; width:20px; height:68px; z-index:1; visibility:visible; "> </div> <div id="screenshot%20tsam%20900r2c3" style="background-color: yellow; position:absolute; left:24px; top:6px;width:47px; height:68px;z-index:2; visibility:visible;"></div> <div id="screenshot%20tsam%20900r2c4" style="background-color: red; position:absolute; left:71px; top:6px;width:165px; height:68px;z-index:3; visibility:visible;"></div> <div id="screenshot%20tsam%20900r2c5" style="background-color: black; position:absolute; left:236px; top:6px;width:62px; height:68px;z-index:4; visibility:visible;"></div> <div id="screenshot%20tsam%20900r2c6" style="background-color: pink; position:absolute; left:298px; top:6px;width:147px; height:68px;z-index:5; visibility:visible;"></div> <div id="screenshot%20tsam%20900r2c7" style="background-color: orange; position:absolute; left:445px; top:6px;width:311px; height:37px;z-index:6; visibility:visible;"></div> <div id="screenshot%20tsam%20900r2c9" style="background-color: cyan; position:absolute; left:756px; top:6px;width:108px; height:37px;z-index:7; visibility:visible;"></div> <div id="screenshot%20tsam%20900r2c11" style="background-color: white; position:absolute; left:864px; top:6px;width:27px; height:37px;z-index:8; visibility:visible;"></div> <div id="screenshot%20tsam%20900r3c7" style="background-color: DodgerBlue; position:absolute; left:445px; top:43px;width:8px; height:31px;z-index:9; visibility:visible;"></div> <div id="screenshot%20tsam%20900r3c8" style="background-color: Gold; position:absolute; left:453px; top:43px;width:355px; height:31px;z-index:10; visibility:visible;"></div> <div id="screenshot%20tsam%20900r3c10" style="background-color: LightCyan ; position:absolute; left:808px; top:43px;width:83px; height:31px;z-index:11; visibility:visible;"></div> </div> </div> <div id="framecontentBottom"> <div class="innertube"> <h3>Sample text here</h3> </div> </div> <div id="maincontent"> <div class="innertube"> <h1>Lorem</h1> <p> Lorem ipsum </p> <p style="text-align: center">Vestibulum </p> </div> </div> </body> </html> Id like to make : 1) the header image autoexpanding using the repeated-y css property of DodgerBlue color and Orange div because thy are the only 2 part of image axpandible. 2) Is it possible to define a minimum size of header, and is possible to make the entire body minimum size based that size so the browser cant get smaller an if the window get smaller, scrollbar is show.

  Read the article

• Hibernate without primary keys generated by db?

  - by Michael Jones

  I'm building a data warehouse and want to use InfiniDB as the storage engine. However, it doesn't allow primary keys or foreign key constraints (or any constraints for that matter). Hibernate complains "The database returned no natively generated identity value" when I perform an insert. Each table is relational, and contains a unique integer column that was previously used as the primary key - I want to keep that, but just not have the constraint in the db that the column is the primary key. I'm assuming the problem is that Hibernate expects the db to return a generated key. Is it possible to override this behaviour so I can set the primary key field's value myself and keep Hibernate happy? -- edit -- Two of the mappings are as follows: <?xml version="1.0"?> <!DOCTYPE hibernate-mapping PUBLIC "-//Hibernate/Hibernate Mapping DTD 3.0//EN" "http://hibernate.sourceforge.net/hibernate-mapping-3.0.dtd"> <!-- Generated Jun 1, 2010 2:49:51 PM by Hibernate Tools 3.2.1.GA --> <hibernate-mapping> <class name="com.example.project.Visitor" table="visitor" catalog="orwell"> <id name="id" type="java.lang.Long"> <column name="id" /> <generator class="identity" /> </id> <property name="firstSeen" type="timestamp"> <column name="first_seen" length="19" /> </property> <property name="lastSeen" type="timestamp"> <column name="last_seen" length="19" /> </property> <property name="sessionId" type="string"> <column name="session_id" length="26" unique="true" /> </property> <property name="userId" type="java.lang.Long"> <column name="user_id" /> </property> <set name="visits" inverse="true"> <key> <column name="visitor_id" /> </key> <one-to-many class="com.example.project.Visit" /> </set> </class> </hibernate-mapping> and: <?xml version="1.0"?> <!DOCTYPE hibernate-mapping PUBLIC "-//Hibernate/Hibernate Mapping DTD 3.0//EN" "http://hibernate.sourceforge.net/hibernate-mapping-3.0.dtd"> <!-- Generated Jun 1, 2010 2:49:51 PM by Hibernate Tools 3.2.1.GA --> <hibernate-mapping> <class name="com.example.project.Visit" table="visit" catalog="orwell"> <id name="id" type="java.lang.Long"> <column name="id" /> <generator class="identity" /> </id> <many-to-one name="visitor" class="com.example.project.Visitor" fetch="join" cascade="all"> <column name="visitor_id" /> </many-to-one> <property name="visitId" type="string"> <column name="visit_id" length="20" unique="true" /> </property> <property name="startTime" type="timestamp"> <column name="start_time" length="19" /> </property> <property name="endTime" type="timestamp"> <column name="end_time" length="19" /> </property> <property name="userAgent" type="string"> <column name="user_agent" length="65535" /> </property> <set name="pageViews" inverse="true"> <key> <column name="visit_id" /> </key> <one-to-many class="com.example.project.PageView" /> </set> </class> </hibernate-mapping>

  Read the article

• Having trouble returning a value from a method call when sending an array and the program is error out when run in reference to the sort

  - by programmerNOOB

  I am getting the following output when this program is run: Please enter the Social Security Number for taxpayer 0: 111111111 Please enter the gross income for taxpayer 0: 20000 Please enter the Social Security Number for taxpayer 1: 555555555 Please enter the gross income for taxpayer 1: 50000 Please enter the Social Security Number for taxpayer 2: 333333333 Please enter the gross income for taxpayer 2: 5464166 Please enter the Social Security Number for taxpayer 3: 222222222 Please enter the gross income for taxpayer 3: 645641 Please enter the Social Security Number for taxpayer 4: 444444444 Please enter the gross income for taxpayer 4: 29000 Taxpayer # 1 SSN: 111111111, Income is $20,000.00, Tax is $0.00 Taxpayer # 2 SSN: 555555555, Income is $50,000.00, Tax is $0.00 Taxpayer # 3 SSN: 333333333, Income is $5,464,166.00, Tax is $0.00 Taxpayer # 4 SSN: 222222222, Income is $645,641.00, Tax is $0.00 Taxpayer # 5 SSN: 444444444, Income is $29,000.00, Tax is $0.00 Unhandled Exception: System.InvalidOperationException: Failed to compare two elements in the array. --- System.ArgumentException: At least one object must implement IComparable. at System.Collections.Comparer.Compare(Object a, Object b) at System.Collections.Generic.ObjectComparer`1.Compare(T x, T y) at System.Collections.Generic.ArraySortHelper`1.SwapIfGreaterWithItems(T[] keys, IComparer`1 comparer, Int32 a, Int32 b) at System.Collections.Generic.ArraySortHelper`1.QuickSort(T[] keys, Int32 left, Int32 right, IComparer`1 comparer) at System.Collections.Generic.ArraySortHelper`1.Sort(T[] keys, Int32 index, Int32 length, IComparer`1 comparer) --- End of inner exception stack trace --- at System.Collections.Generic.ArraySortHelper`1.Sort(T[] keys, Int32 index, Int32 length, IComparer`1 comparer) at System.Array.Sort[T](T[] array, Int32 index, Int32 length, IComparer`1 comparer) at System.Array.Sort[T](T[] array) at Assignment5.Taxpayer.Main(String[] args) in Program.cs:line 150 Notice the 0s at the end of the line that should be the tax amount??? Here is the code: using System; using System.Collections.Generic; using System.Linq; using System.Text; namespace taxes { class Rates { // Create a class named rates that has the following data members: private int incLimit; private double lowTaxRate; private double highTaxRate; // use read-only accessor public int IncomeLimit { get { return incLimit; } } public double LowTaxRate { get { return lowTaxRate; } } public double HighTaxRate { get { return highTaxRate; } } //A class constructor that assigns default values public Rates() { int limit = 30000; double lowRate = .15; double highRate = .28; incLimit = limit; lowTaxRate = lowRate; highTaxRate = highRate; } //A class constructor that takes three parameters to assign input values for limit, low rate and high rate. public Rates(int limit, double lowRate, double highRate) { } // A CalculateTax method that takes an income parameter and computes the tax as follows: public int CalculateTax(int income) { int limit = 0; double lowRate = 0; double highRate = 0; int taxOwed = 0; // If income is less than the limit then return the tax as income times low rate. if (income < limit) taxOwed = Convert.ToInt32(income * lowRate); // If income is greater than or equal to the limit then return the tax as income times high rate. if (income >= limit) taxOwed = Convert.ToInt32(income * highRate); return taxOwed; } } //end class Rates // Create a class named Taxpayer that has the following data members: public class Taxpayer { //Use get and set accessors. string SSN { get; set; } int grossIncome { get; set; } // Use read-only accessor. public int taxOwed { get { return taxOwed; } } // The Taxpayer class should be set up so that its objects are comparable to each other based on tax owed. class taxpayer : IComparable { public int taxOwed { get; set; } public int income { get; set; } int IComparable.CompareTo(Object o) { int returnVal; taxpayer temp = (taxpayer)o; if (this.taxOwed > temp.taxOwed) returnVal = 1; else if (this.taxOwed < temp.taxOwed) returnVal = -1; else returnVal = 0; return returnVal; } // End IComparable.CompareTo } //end taxpayer IComparable class // **The tax should be calculated whenever the income is set. // The Taxpayer class should have a getRates class method that has the following. public static void GetRates() { // Local method data members for income limit, low rate and high rate. int incLimit = 0; double lowRate; double highRate; string userInput; // Prompt the user to enter a selection for either default settings or user input of settings. Console.Write("Would you like the default values (D) or would you like to enter the values (E)?: "); /* If the user selects default the default values you will instantiate a rates object using the default constructor * and set the Taxpayer class data member for tax equal to the value returned from calling the rates object CalculateTax method.*/ userInput = Convert.ToString(Console.ReadLine()); if (userInput == "D" || userInput == "d") { Rates rates = new Rates(); rates.CalculateTax(incLimit); } // end if /* If the user selects to enter the rates data then prompt the user to enter values for income limit, low rate and high rate, * instantiate a rates object using the three-argument constructor passing those three entries as the constructor arguments and * set the Taxpayer class data member for tax equal to the valuereturned from calling the rates object CalculateTax method. */ if (userInput == "E" || userInput == "e") { Console.Write("Please enter the income limit: "); incLimit = Convert.ToInt32(Console.ReadLine()); Console.Write("Please enter the low rate: "); lowRate = Convert.ToDouble(Console.ReadLine()); Console.Write("Please enter the high rate: "); highRate = Convert.ToDouble(Console.ReadLine()); Rates rates = new Rates(incLimit, lowRate, highRate); rates.CalculateTax(incLimit); } } static void Main(string[] args) { Taxpayer[] taxArray = new Taxpayer[5]; Rates taxRates = new Rates(); // Implement a for-loop that will prompt the user to enter the Social Security Number and gross income. for (int x = 0; x < taxArray.Length; ++x) { taxArray[x] = new Taxpayer(); Console.Write("Please enter the Social Security Number for taxpayer {0}: ", x + 1); taxArray[x].SSN = Console.ReadLine(); Console.Write("Please enter the gross income for taxpayer {0}: ", x + 1); taxArray[x].grossIncome = Convert.ToInt32(Console.ReadLine()); } Taxpayer.GetRates(); // Implement a for-loop that will display each object as formatted taxpayer SSN, income and calculated tax. for (int i = 0; i < taxArray.Length; ++i) { Console.WriteLine("Taxpayer # {0} SSN: {1}, Income is {2:c}, Tax is {3:c}", i + 1, taxArray[i].SSN, taxArray[i].grossIncome, taxRates.CalculateTax(taxArray[i].grossIncome)); } // end for // Implement a for-loop that will sort the five objects in order by the amount of tax owed Array.Sort(taxArray); Console.WriteLine("Sorted by tax owed"); for (int i = 0; i < taxArray.Length; ++i) { Console.WriteLine("Taxpayer # {0} SSN: {1}, Income is {2:c}, Tax is {3:c}", i + 1, taxArray[i].SSN, taxArray[i].grossIncome, taxRates.CalculateTax(taxArray[i].grossIncome)); } } //end main } // end Taxpayer class } //end Any clues as to why the dollar amount is coming up as 0 and why the sort is not working?

  Read the article

• Submiting a Form without Refreshing the page with jQuery and Ajax Not updating MySQL database.

  - by HEEEEEEELP

  I'm a newbie to JQuery and have a problem, when I click submit button on the form everything says registration was successful but my MYSQL database was not updated everything worked fine until I tried to add the JQuery to the picture. Can someone help me fix this problem so my database is updated? Thanks Here is the JQuery code. $(function() { $(".save-button").click(function() { var address = $("#address").val(); var address_two = $("#address_two").val(); var city_town = $("#city_town").val(); var state_province = $("#state_province").val(); var zipcode = $("#zipcode").val(); var country = $("#country").val(); var email = $("#email").val(); var dataString = 'address='+ address + '&address_two=' + address_two + '&city_town=' + city_town + '&state_province=' + state_province + '&zipcode=' + zipcode + '&country=' + country + '$email=' + email; if(address=='' || address_two=='' || city_town=='' || state_province=='' || zipcode=='' || country=='' || email=='') { $('.success').fadeOut(200).hide(); $('.error').fadeOut(200).show(); } else { $.ajax({ type: "POST", url: "http://localhost/New%20Project/home/index.php", data: dataString, success: function(){ $('.success').fadeIn(200).show(); $('.error').fadeOut(200).hide(); } }); } return false; }); }); Here is the PHP code. if (isset($_POST['contact_info_submitted'])) { // Handle the form. // Query member data from the database and ready it for display $mysqli = mysqli_connect("localhost", "root", "", "sitename"); $dbc = mysqli_query($mysqli,"SELECT users.*, contact_info.* FROM users INNER JOIN contact_info ON contact_info.user_id = users.user_id WHERE users.user_id=3"); $user_id = mysqli_real_escape_string($mysqli, htmlentities('3')); $address = mysqli_real_escape_string($mysqli, htmlentities($_POST['address'])); $address_two = mysqli_real_escape_string($mysqli, htmlentities($_POST['address_two'])); $city_town = mysqli_real_escape_string($mysqli, htmlentities($_POST['city_town'])); $state_province = mysqli_real_escape_string($mysqli, htmlentities($_POST['state_province'])); $zipcode = mysqli_real_escape_string($mysqli, htmlentities($_POST['zipcode'])); $country = mysqli_real_escape_string($mysqli, htmlentities($_POST['country'])); $email = mysqli_real_escape_string($mysqli, strip_tags($_POST['email'])); //If the table is not found add it to the database if (mysqli_num_rows($dbc) == 0) { $mysqli = mysqli_connect("localhost", "root", "", "sitename"); $dbc = mysqli_query($mysqli,"INSERT INTO contact_info (user_id, address, address_two, city_town, state_province, zipcode, country, email) VALUES ('$user_id', '$address', '$address_two', '$city_town', '$state_province', '$zipcode', '$country', '$email')"); } //If the table is in the database update each field when needed if ($dbc == TRUE) { $dbc = mysqli_query($mysqli,"UPDATE contact_info SET address = '$address', address_two = '$address_two', city_town = '$city_town', state_province = '$state_province', zipcode = '$zipcode', country = '$country', email = '$email' WHERE user_id = '$user_id'"); } if (!$dbc) { // There was an error...do something about it here... print mysqli_error($mysqli); return; } } Here is the XHTML code. <form method="post" action="index.php"> <fieldset> <ul> <li><label for="address">Address 1: </label><input type="text" name="address" id="address" size="25" class="input-size" value="<?php if (isset($_POST['address'])) { echo $_POST['address']; } else if(!empty($address)) { echo $address; } ?>" /></li> <li><label for="address_two">Address 2: </label><input type="text" name="address_two" id="address_two" size="25" class="input-size" value="<?php if (isset($_POST['address_two'])) { echo $_POST['address_two']; } else if(!empty($address_two)) { echo $address_two; } ?>" /></li> <li><label for="city_town">City/Town: </label><input type="text" name="city_town" id="city_town" size="25" class="input-size" value="<?php if (isset($_POST['city_town'])) { echo $_POST['city_town']; } else if(!empty($city_town)) { echo $city_town; } ?>" /></li> <li><label for="state_province">State/Province: </label> <?php echo '<select name="state_province" id="state_province">' . "\n"; foreach($state_options as $option) { if ($option == $state_province) { echo '<option value="' . $option . '" selected="selected">' . $option . '</option>' . "\n"; } else { echo '<option value="'. $option . '">' . $option . '</option>'."\n"; } } echo '</select>'; ?> </li> <li><label for="zipcode">Zip/Post Code: </label><input type="text" name="zipcode" id="zipcode" size="5" class="input-size" value="<?php if (isset($_POST['zipcode'])) { echo $_POST['zipcode']; } else if(!empty($zipcode)) { echo $zipcode; } ?>" /></li> <li><label for="country">Country: </label> <?php echo '<select name="country" id="country">' . "\n"; foreach($countries as $option) { if ($option == $country) { echo '<option value="' . $option . '" selected="selected">' . $option . '</option>' . "\n"; } else if($option == "-------------") { echo '<option value="' . $option . '" disabled="disabled">' . $option . '</option>'; } else { echo '<option value="'. $option . '">' . $option . '</option>'."\n"; } } echo '</select>'; ?> </li> <li><label for="email">Email Address: </label><input type="text" name="email" id="email" size="25" class="input-size" value="<?php if (isset($_POST['email'])) { echo $_POST['email']; } else if(!empty($email)) { echo $email; } ?>" /><br /><span>We don't spam or share your email with third parties. We respect your privacy.</span></li> <li><input type="submit" name="submit" value="Save Changes" class="save-button" /> <input type="hidden" name="contact_info_submitted" value="true" /> <input type="submit" name="submit" value="Preview Changes" class="preview-changes-button" /></li> </ul> </fieldset> </form>

  Read the article

• Using C# to detect whether a filename character is considered international

  - by Morten Mertner

  I've written a small console application (source below) to locate and optionally rename files containing international characters, as they are a source of constant pain with most source control systems (some background on this below). The code I'm using has a simple dictionary with characters to look for and replace (and nukes every other character that uses more than one byte of storage), but it feels very hackish. What's the right way to (a) find out whether a character is international? and (b) what the best ASCII substitution character would be? Let me provide some background information on why this is needed. It so happens that the danish Å character has two different encodings in UTF-8, both representing the same symbol. These are known as NFC and NFD encodings. Windows and Linux will create NFC encoding by default but respect whatever encoding it is given. Mac will convert all names (when saving to a HFS+ partition) to NFD and therefore returns a different byte stream for the name of a file created on Windows. This effectively breaks Subversion, Git and lots of other utilities that don't care to properly handle this scenario. I'm currently evaluating Mercurial, which turns out to be even worse at handling international characters.. being fairly tired of these problems, either source control or the international character would have to go, and so here we are. My current implementation: public class Checker { private Dictionary<char, string> internationals = new Dictionary<char, string>(); private List<char> keep = new List<char>(); private List<char> seen = new List<char>(); public Checker() { internationals.Add( 'æ', "ae" ); internationals.Add( 'ø', "oe" ); internationals.Add( 'å', "aa" ); internationals.Add( 'Æ', "Ae" ); internationals.Add( 'Ø', "Oe" ); internationals.Add( 'Å', "Aa" ); internationals.Add( 'ö', "o" ); internationals.Add( 'ü', "u" ); internationals.Add( 'ä', "a" ); internationals.Add( 'é', "e" ); internationals.Add( 'è', "e" ); internationals.Add( 'ê', "e" ); internationals.Add( '¦', "" ); internationals.Add( 'Ã', "" ); internationals.Add( '©', "" ); internationals.Add( ' ', "" ); internationals.Add( '§', "" ); internationals.Add( '¡', "" ); internationals.Add( '³', "" ); internationals.Add( '­', "" ); internationals.Add( 'º', "" ); internationals.Add( '«', "-" ); internationals.Add( '»', "-" ); internationals.Add( '´', "'" ); internationals.Add( '`', "'" ); internationals.Add( '"', "'" ); internationals.Add( Encoding.UTF8.GetString( new byte[] { 226, 128, 147 } )[ 0 ], "-" ); internationals.Add( Encoding.UTF8.GetString( new byte[] { 226, 128, 148 } )[ 0 ], "-" ); internationals.Add( Encoding.UTF8.GetString( new byte[] { 226, 128, 153 } )[ 0 ], "'" ); internationals.Add( Encoding.UTF8.GetString( new byte[] { 226, 128, 166 } )[ 0 ], "." ); keep.Add( '-' ); keep.Add( '=' ); keep.Add( '\'' ); keep.Add( '.' ); } public bool IsInternationalCharacter( char c ) { var s = c.ToString(); byte[] bytes = Encoding.UTF8.GetBytes( s ); if( bytes.Length > 1 && ! internationals.ContainsKey( c ) && ! seen.Contains( c ) ) { Console.WriteLine( "X '{0}' ({1})", c, string.Join( ",", bytes ) ); seen.Add( c ); if( ! keep.Contains( c ) ) { internationals[ c ] = ""; } } return internationals.ContainsKey( c ); } public bool HasInternationalCharactersInName( string name, out string safeName ) { StringBuilder sb = new StringBuilder(); Array.ForEach( name.ToCharArray(), c => sb.Append( IsInternationalCharacter( c ) ? internationals[ c ] : c.ToString() ) ); int length = sb.Length; sb.Replace( " ", " " ); while( sb.Length != length ) { sb.Replace( " ", " " ); } safeName = sb.ToString().Trim(); string namePart = Path.GetFileNameWithoutExtension( safeName ); if( namePart.EndsWith( "." ) ) safeName = namePart.Substring( 0, namePart.Length - 1 ) + Path.GetExtension( safeName ); return name != safeName; } } And this would be invoked like this: FileInfo file = new File( "Århus.txt" ); string safeName; if( checker.HasInternationalCharactersInName( file.Name, out safeName ) ) { // rename file }

  Read the article

• How do you overide a class that is called by another class with parent::method

  - by dan.codes

  I am trying to extend Mage_Catalog_Block_Product_View I have it setup in my local directory as its own module and everything works fine, I wasn't getting the results that I wanted. I then saw that another class extended that class as well. The method I am trying to override is the protected function _prepareLayout() This is the function class Mage_Review_Block_Product_View extends Mage_Catalog_Block_Product_View protected function _prepareLayout() { $this-&gt;getLayout()-&gt;createBlock('catalog/breadcrumbs'); $headBlock = $this-&gt;getLayout()-&gt;getBlock('head'); if ($headBlock) { $title = $this-&gt;getProduct()-&gt;getMetaTitle(); if ($title) { $headBlock-&gt;setTitle($title); } $keyword = $this-&gt;getProduct()-&gt;getMetaKeyword(); $currentCategory = Mage::registry('current_category'); if ($keyword) { $headBlock-&gt;setKeywords($keyword); } elseif($currentCategory) { $headBlock-&gt;setKeywords($this-&gt;getProduct()-&gt;getName()); } $description = $this-&gt;getProduct()-&gt;getMetaDescription(); if ($description) { $headBlock-&gt;setDescription( ($description) ); } else { $headBlock-&gt;setDescription( $this-&gt;getProduct()-&gt;getDescription() ); } } return parent::_prepareLayout(); } I am trying to modify it just a bit with the following, keep in mind I know there is a title prefix and suffix but I needed it only for the product page and also I needed to add text to the description. class MyCompany_Catalog_Block_Product_View extends Mage_Catalog_Block_Product_View protected function _prepareLayout() { $storeId = Mage::app()-&gt;getStore()-&gt;getId(); $this-&gt;getLayout()-&gt;createBlock('catalog/breadcrumbs'); $headBlock = $this-&gt;getLayout()-&gt;getBlock('head'); if ($headBlock) { $title = $this-&gt;getProduct()-&gt;getMetaTitle(); if ($title) { if($storeId == 2){ $title = "Pool Supplies Fast - " .$title; $headBlock-&gt;setTitle($title); } $headBlock-&gt;setTitle($title); }else{ $path = Mage::helper('catalog')-&gt;getBreadcrumbPath(); foreach ($path as $name =&gt; $breadcrumb) { $title[] = $breadcrumb['label']; } $newTitle = "Pool Supplies Fast - " . join($this-&gt;getTitleSeparator(), array_reverse($title)); $headBlock-&gt;setTitle($newTitle); } $keyword = $this-&gt;getProduct()-&gt;getMetaKeyword(); $currentCategory = Mage::registry('current_category'); if ($keyword) { $headBlock-&gt;setKeywords($keyword); } elseif($currentCategory) { $headBlock-&gt;setKeywords($this-&gt;getProduct()-&gt;getName()); } $description = $this-&gt;getProduct()-&gt;getMetaDescription(); if ($description) { if($storeId == 2){ $description = "Pool Supplies Fast - ". $this-&gt;getProduct()-&gt;getName() . " - " . $description; $headBlock-&gt;setDescription( ($description) ); }else{ $headBlock-&gt;setDescription( ($description) ); } } else { if($storeId == 2){ $description = "Pool Supplies Fast: ". $this-&gt;getProduct()-&gt;getName() . " - " . $this-&gt;getProduct()-&gt;getDescription(); $headBlock-&gt;setDescription( ($description) ); }else{ $headBlock-&gt;setDescription( $this-&gt;getProduct()-&gt;getDescription() ); } } } return Mage_Catalog_Block_Product_Abstract::_prepareLayout(); } This executs fine but then I notice that the following class Mage_Review_Block_Product_View_List extends which extends Mage_Review_Block_Product_View and that extends Mage_Catalog_Block_Product_View as well. Inside this class they call the _prepareLayout as well and call the parent with parent::_prepareLayout() class Mage_Review_Block_Product_View_List extends Mage_Review_Block_Product_View protected function _prepareLayout() { parent::_prepareLayout(); if ($toolbar = $this-&gt;getLayout()-&gt;getBlock('product_review_list.toolbar')) { $toolbar-&gt;setCollection($this-&gt;getReviewsCollection()); $this-&gt;setChild('toolbar', $toolbar); } return $this; } So obviously this just calls the same class I am extending and runs the function I am overiding but it doesn't get to my class because it is not in my class hierarchy and since it gets called after my class all the stuff in the parent class override what I have set. I'm not sure about the best way to extend this type of class and method, there has to be a good way to do this, I keep finding I am running into issues when trying to overide these prepare methods that are derived from the abstract classes, there seems to be so many classes overriding them and calling parent::method. What is the best way to override these functions?

  Read the article

• incrementing in php

  - by Michael Stevens

  I have a function that works on other pages but on this particular page its not working 100% the piece of code that is failing to work is: $query = "SELECT * FROM rank_punting JOIN rank_player ON rank_player.full_name=rank_punting.name WHERE active='1' AND class='$class' ORDER BY ABS(`rank_punting`.`rank_final`) ASC"; $rank = 0; $lastpct = 0; $db->setQuery($query); $result = $db->query(); if(mysql_num_rows($result) > 0) { while($row = mysql_fetch_array($result, MYSQL_ASSOC)) { if ($row['rank_final'] > $lastpct) { $rank++; $lastpct = $row['rank_final']; } $name = $row['name']; $s1= $row['s1']; $s2= $row['s2']; $s3= $row['s3']; $s4= $row['s4']; $s5= $row['s5']; $s6= $row['s6']; $s7= $row['s7']; $s8= $row['s8']; $s9= $row['s9']; $c1= $row['c1']; $c2= $row['c2']; $c3= $row['c3']; $c4= $row['c4']; $c5= $row['c5']; $c6= $row['c6']; $v1= $row['v1']; $v2= $row['v2']; $comp= $row['comp_rank_final']; $season= $row['season_rank_final']; $final=$row['rank_final']; $link = "website_url"; $link2 = "<a href=\"http://{$link}\" target='_blank'>{$name}<br>Profile Page</a>"; if ($link = ''){$link2 = "<a href='index.php?option=com_ranking&view=playerprofile&player={$name}' >{$name}<br>Profile Page</a>";} echo '<tr>'; echo " <th scope'row'>{$link2} {$lastpct} </th>"; echo "<td>"; echo 'DEBUG: '; echo $row['rank_final']; echo $lastpct;echo "{$rank}</td>"; echo "<td> Competition</td>"; echo "<td> {$comp}</td>"; echo "<td> {$c1}</td>"; echo "<td> {$c2}</td>"; echo "<td> {$c3}</td>"; echo "<td> {$c4}</td>"; echo "<td> {$c5}</td>"; echo "<td> {$c6}</td>"; echo "<td> {$c7}</td>"; echo "<td> {$c8}</td>"; echo "<td> {$v2}</td>"; echo "</tr>"; echo '<tr>'; echo "<th scope'row'> </th>"; echo "<td> </td>"; echo "<td> Game Film</td>"; echo "<td> {$season}</td>"; echo "<td> {$s1}</td>"; echo "<td> {$s2}</td>"; echo "<td> {$s3}</td>"; echo "<td> {$s4}</td>"; echo "<td> {$s5}</td>"; echo "<td> {$s7}</td>"; echo "<td> {$s8}</td>"; echo "<td> {$s6}</td>"; echo "<td> {$v1}</td>"; echo "</tr>"; } } //---------------- echo '</tbody> </table>'; }

  Read the article

• files get uploaded just before they get cancelled

  - by user1763986

  Got a little situation here where I am trying to cancel a file's upload. What I have done is stated that if the user clicks on the "Cancel" button, then it will simply remove the iframe so that it does not go to the page where it uploads the files into the server and inserts data into the database. Now this works fine if the user clicks on the "Cancel" button in quickish time the problem I have realised though is that if the user clicks on the "Cancel" button very late, it sometimes doesn't remove the iframe in time meaning that the file has just been uploaded just before the user has clicked on the "Cancel" button. So my question is that is there a way that if the file does somehow get uploaded before the user clicks on the "Cancel" button, that it deletes the data in the database and removes the file from the server? Below is the image upload form: <form action="imageupload.php" method="post" enctype="multipart/form-data" target="upload_target_image" onsubmit="return imageClickHandler(this);" class="imageuploadform" > <p class="imagef1_upload_process" align="center"> Loading...<br/> <img src="Images/loader.gif" /> </p> <p class="imagef1_upload_form" align="center"> <br/> <span class="imagemsg"></span> <label>Image File: <input name="fileImage" type="file" class="fileImage" /></label><br/> <br/> <label class="imagelbl"><input type="submit" name="submitImageBtn" class="sbtnimage" value="Upload" /></label> </p> <p class="imagef1_cancel" align="center"> <input type="reset" name="imageCancel" class="imageCancel" value="Cancel" /> </p> <iframe class="upload_target_image" name="upload_target_image" src="#" style="width:0px;height:0px;border:0px;solid;#fff;"></iframe> </form> Below is the jquery function which controls the "Cancel" button: $(imageuploadform).find(".imageCancel").on("click", function(event) { $('.upload_target_image').get(0).contentwindow $("iframe[name='upload_target_image']").attr("src", "javascript:'<html></html>'"); return stopImageUpload(2); }); Below is the php code where it uploads the files and inserts the data into the database. The form above posts to this php page "imageupload.php": <body> <?php include('connect.php'); session_start(); $result = 0; //uploads file move_uploaded_file($_FILES["fileImage"]["tmp_name"], "ImageFiles/" . $_FILES["fileImage"]["name"]); $result = 1; //set up the INSERT SQL query command to insert the name of the image file into the "Image" Table $imagesql = "INSERT INTO Image (ImageFile) VALUES (?)"; //prepare the above SQL statement if (!$insert = $mysqli->prepare($imagesql)) { // Handle errors with prepare operation here } //bind the parameters (these are the values that will be inserted) $insert->bind_param("s",$img); //Assign the variable of the name of the file uploaded $img = 'ImageFiles/'.$_FILES['fileImage']['name']; //execute INSERT query $insert->execute(); if ($insert->errno) { // Handle query error here } //close INSERT query $insert->close(); //Retrieve the ImageId of the last uploded file $lastID = $mysqli->insert_id; //Insert into Image_Question Table (be using last retrieved Image id in order to do this) $imagequestionsql = "INSERT INTO Image_Question (ImageId, SessionId, QuestionId) VALUES (?, ?, ?)"; //prepare the above SQL statement if (!$insertimagequestion = $mysqli->prepare($imagequestionsql)) { // Handle errors with prepare operation here echo "Prepare statement err imagequestion"; } //Retrieve the question number $qnum = (int)$_POST['numimage']; //bind the parameters (these are the values that will be inserted) $insertimagequestion->bind_param("isi",$lastID, 'Exam', $qnum); //execute INSERT query $insertimagequestion->execute(); if ($insertimagequestion->errno) { // Handle query error here } //close INSERT query $insertimagequestion->close(); ?> <!--Javascript which will output the message depending on the status of the upload (successful, failed or cancelled)--> <script> window.top.stopImageUpload(<?php echo $result; ?>, '<?php echo $_FILES['fileImage']['name'] ?>'); </script> </body> UPDATE: Below is the php code "cancelimage.php" where I want to delete the cancelled file from the server and delete the record from the database. It is set up but not finished, can somebody finish it off so I can retrieve the name of the file and it's id using $_SESSION? <?php // connect to the database include('connect.php'); /* check connection */ if (mysqli_connect_errno()) { printf("Connect failed: %s\n", mysqli_connect_error()); die(); } //remove file from server unlink("ImageFiles/...."); //need to retrieve file name here where the ... line is //DELETE query statement where it will delete cancelled file from both Image and Image Question Table $imagedeletesql = " DELETE img, img_q FROM Image AS img LEFT JOIN Image_Question AS img_q ON img_q.ImageId = img.ImageId WHERE img.ImageFile = ?"; //prepare delete query if (!$delete = $mysqli->prepare($imagedeletesql)) { // Handle errors with prepare operation here } //Dont pass data directly to bind_param store it in a variable $delete->bind_param("s",$img); //execute DELETE query $delete->execute(); if ($delete->errno) { // Handle query error here } //close query $delete->close(); ?> Can you please provide an sample code in your answer to make it easier for me. Thank you

  Read the article

• Installed SQL Server 2008 and now TFS is broken.

  - by johnnycakes

  Hi, My W2K3 server was running TFS 2008 SP1, SQL Server 2005 Development edition. I installed SQL Server 2008 Standard. I installed it while leaving SQL Server 2005 alone. Upgrading was not possible due to the differences in editions of the SQL Servers. Now TFS is broken. On a client computer, if I go Team - Connect to Team Foundation Server, I get this error: Team Foundation services are not available from server myserver. Technical information (for administrator): TF30059: Fatal error while initializing web service. So I head on over to my event viewer on the server. Under Application, I see one warning and two errors. First, the warning: Source: SQLSERVERAGENT Event ID: 208 Description: SQL Server Scheduled Job 'TfsWorkItemTracking Process Identities Job' (0x21F395C1F444CA499A63EBF05D717749) - Status: Failed - Invoked on: 2010-04-26 13:30:00 - Message: The job failed. The Job was invoked by Schedule 9 (ProcessIdentitiesSchedule). The last step to run was step 1 (Process Identities). Then the first error: Source: TFS Services Event ID: 3017 Description: TF53010: The following error has occurred in a Team Foundation component or extension: Date (UTC): 4/26/2010 5:36:29 PM Machine: myserver Application Domain: /LM/W3SVC/799623628/Root/Services-2-129167769888923968 Assembly: Microsoft.TeamFoundation.Server, Version=9.0.0.0, Culture=neutral, PublicKeyToken=b03f5f7f11d50a3a; v2.0.50727 Process Details: Process Name: w3wp Process Id: 4008 Thread Id: 224 Account name: DOMAIN\TFSService Detailed Message: TF53013: A crash report is being prepared for Microsoft. The following information is included in that report: System Values OS Version Information=Microsoft Windows NT 5.2.3790 Service Pack 2 CLR Version Information=2.0.50727.3053 Machine Name=myserver Processor Count=1 Working Set=34897920 System Directory=C:\WINDOWS\system32 Process Values ExitCode=0 Interactive=False Has Shutdown Started=False Process Environment Variables Path = C:\WINDOWS\system32;C:\WINDOWS;C:\WINDOWS\System32\Wbem;C:\Program Files\Microsoft SQL Server\80\Tools\Binn\;C:\Program Files\Microsoft SQL Server\90\Tools\binn\;C:\Program Files\Microsoft SQL Server\90\DTS\Binn\;C:\Program Files\Microsoft SQL Server\90\Tools\Binn\VSShell\Common7\IDE\;C:\Program Files\Microsoft Visual Studio 8\Common7\IDE\PrivateAssemblies\;C:\Program Files\Microsoft SQL Server\100\Tools\Binn\;C:\Program Files\Microsoft SQL Server\100\DTS\Binn\;C:\Program Files\Microsoft SQL Server\100\Tools\Binn\VSShell\Common7\IDE\;C:\Program Files\Microsoft Visual Studio 9.0\Common7\IDE\PrivateAssemblies\;C:\WINDOWS\system32\WindowsPowerShell\v1.0 PATHEXT = .COM;.EXE;.BAT;.CMD;.VBS;.VBE;.JS;.JSE;.WSF;.WSH;.PSC1 PROCESSOR_ARCHITECTURE = x86 SystemDrive = C: windir = C:\WINDOWS TMP = C:\WINDOWS\TEMP USERPROFILE = C:\Documents and Settings\Default User ProgramFiles = C:\Program Files FP_NO_HOST_CHECK = NO COMPUTERNAME = myserver APP_POOL_ID = Microsoft Team Foundation Server Application Pool NUMBER_OF_PROCESSORS = 1 PROCESSOR_IDENTIFIER = x86 Family 16 Model 5 Stepping 2, AuthenticAMD ClusterLog = C:\WINDOWS\Cluster\cluster.log SystemRoot = C:\WINDOWS ComSpec = C:\WINDOWS\system32\cmd.exe CommonProgramFiles = C:\Program Files\Common Files PROCESSOR_LEVEL = 16 PROCESSOR_REVISION = 0502 lib = C:\Program Files\SQLXML 4.0\bin\ ALLUSERSPROFILE = C:\Documents and Settings\All Users TEMP = C:\WINDOWS\TEMP OS = Windows_NT Request Details Url=http://myserver.domain.local:8080/Services/v1.0/Registration.asmx [method = POST] User Agent=Team Foundation (devenv.exe, 10.0.30128.1) Headers=Content-Length=390&Content-Type=text%2fxml%3b+charset%3dutf-8&Accept-Encoding=gzip%2cgzip%2cgzip&Accept-Language=en-US&Authorization=NTLM+TlRMTVNTUAADAAAAGAAYAIQAAABAAUABnAAAABAAEABYAAAADAAMAGgAAAAQABAAdAAAAAAAAADcAQAABYKIogYBsB0AAAAPN9gzQTXfZIiIFnXDlQrxjUgAWQBQAEUAUgBJAE8ATgBKAG8AaABuAG4AeQBQAEwAQQBUAFkAUABVAFMAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAUrL79KzznBHCSJi2wVjn5QEBAAAAAAAAuhQoBGflygEImxiHPrhZoAAAAAACABAASABZAFAARQBSAEkATwBOAAEACgBUAEkAVABBAE4ABAAcAEgAeQBwAGUAcgBpAG8AbgAuAGwAbwBjAGEAbAADACgAdABpAHQAYQBuAC4ASAB5AHAAZQByAGkAbwBuAC4AbABvAGMAYQBsAAUAHABIAHkAcABlAHIAaQBvAG4ALgBsAG8AYwBhAGwACAAwADAAAAAAAAAAAAAAAAAwAACg0XxPlP8uXycSFhksBJWiwp8oW7iVDqf%2f6h5U30CEXgoAEAAAAAAAAAAAAAAAAAAAAAAACQAyAEgAVABUAFAALwB0AGkAdABhAG4ALgBoAHkAcABlAHIAaQBvAG4ALgBsAG8AYwBhAGwAAAAAAAAAAAA%3d&Expect=100-continue&Host=myserver.domain.local%3a8080&User-Agent=Team+Foundation+(devenv.exe%2c+10.0.30128.1)&X-TFS-Version=1.0.0.0&X-TFS-Session=b7e7fdec-e7ee-48fc-92e8-537d1cd87ea4&SOAPAction=%22http%3a%2f%2fschemas.microsoft.com%2fTeamFoundation%2f2005%2f06%2fServices%2fRegistration%2f03%2fGetRegistrationEntries%22 Path=/Services/v1.0/Registration.asmx Local Request=False User Host Address=10.0.5.78 User=DOMAIN\Johnny [auth = NTLM] Application Provided Information Team Foundation Application Information Event Log Source = TFS Services Configured Team Foundation Server = http://myserver:8080 License Type = WorkgroupLicense Server Culture = en-US Activity Logging Name = Integration Component Name = CS Initialized = No Requests Processed = 0 Exception: TypeInitializationException Message: The type initializer for 'Microsoft.TeamFoundation.Server.IntegrationResourceComponent' threw an exception. Stack Trace: at Microsoft.TeamFoundation.Server.IntegrationResourceComponent.RegisterExceptions() at Microsoft.TeamFoundation.Server.Global.Initialize() at Microsoft.TeamFoundation.Server.TeamFoundationApplication.Init() Inner Exception Details Exception: ReflectionTypeLoadException Message: Unable to load one or more of the requested types. Retrieve the LoaderExceptions property for more information. Stack Trace: at System.Reflection.Module._GetTypesInternal(StackCrawlMark& stackMark) at System.Reflection.Assembly.GetTypes() at Microsoft.TeamFoundation.Server.SqlResourceComponent.RegisterExceptions(Assembly assembly) at Microsoft.TeamFoundation.Server.IntegrationResourceComponent.RegisterExceptions() at Microsoft.TeamFoundation.Server.IntegrationResourceComponent..cctor() Application Domain Information Assembly Name=mscorlib, Version=2.0.0.0, Culture=neutral, PublicKeyToken=b77a5c561934e089 Assembly CLR Version=v2.0.50727 Assembly Version=2.0.0.0 Assembly Location=C:\WINDOWS\Microsoft.NET\Framework\v2.0.50727\mscorlib.dll Assembly File Version: File: C:\WINDOWS\Microsoft.NET\Framework\v2.0.50727\mscorlib.dll InternalName: mscorlib.dll OriginalFilename: mscorlib.dll FileVersion: 2.0.50727.3053 (netfxsp.050727-3000) FileDescription: Microsoft Common Language Runtime Class Library Product: Microsoft® .NET Framework ProductVersion: 2.0.50727.3053 Debug: False Patched: False PreRelease: False PrivateBuild: False SpecialBuild: False Language: English (United States) Assembly Name=System.Web, Version=2.0.0.0, Culture=neutral, PublicKeyToken=b03f5f7f11d50a3a Assembly CLR Version=v2.0.50727 Assembly Version=2.0.0.0 Assembly Location=C:\WINDOWS\assembly\GAC_32\System.Web\2.0.0.0__b03f5f7f11d50a3a\System.Web.dll Assembly File Version: File: C:\WINDOWS\assembly\GAC_32\System.Web\2.0.0.0__b03f5f7f11d50a3a\System.Web.dll InternalName: System.Web.dll OriginalFilename: System.Web.dll FileVersion: 2.0.50727.3053 (netfxsp.050727-3000) FileDescription: System.Web.dll Product: Microsoft® .NET Framework ProductVersion: 2.0.50727.3053 Debug: False Patched: False PreRelease: False PrivateBuild: False SpecialBuild: False Language: English (United States) Assembly Name=System, Version=2.0.0.0, Culture=neutral, PublicKeyToken=b77a5c561934e089 Assembly CLR Version=v2.0.50727 Assembly Version=2.0.0.0 Assembly Location=C:\WINDOWS\assembly\GAC_MSIL\System\2.0.0.0__b77a5c561934e089\System.dll Assembly File Version: File: C:\WINDOWS\assembly\GAC_MSIL\System\2.0.0.0__b77a5c561934e089\System.dll InternalName: System.dll OriginalFilename: System.dll FileVersion: 2.0.50727.3053 (netfxsp.050727-3000) FileDescription: .NET Framework Product: Microsoft® .NET Framework ProductVersion: 2.0.50727.3053 Debug: False Patched: False PreRelease: False PrivateBuild: False SpecialBuild: False Language: English (United States) Assembly Name=System.Xml, Version=2.0.0.0, Culture=neutral, PublicKeyToken=b77a5c561934e089 Assembly CLR Version=v2.0.50727 Assembly Version=2.0.0.0 Assembly Location=C:\WINDOWS\assembly\GAC_MSIL\System.Xml\2.0.0.0__b77a5c561934e089\System.Xml.dll Assembly File Version: File: C:\WINDOWS\assembly\GAC_MSIL\System.Xml\2.0.0.0__b77a5c561934e089\System.Xml.dll InternalName: System.Xml.dll OriginalFilename: System.Xml.dll FileVersion: 2.0.50727.3053 (netfxsp.050727-3000) FileDescription: .NET Framework Product: Microsoft® .NET Framework ProductVersion: 2.0.50727.3053 Debug: False Patched: False PreRelease: False PrivateBuild: False SpecialBuild: False Language: English (United States) Assembly Name=System.Configuration, Version=2.0.0.0, Culture=neutral, PublicKeyToken=b03f5f7f11d50a3a Assembly CLR Version=v2.0.50727 Assembly Version=2.0.0.0 Assembly Location=C:\WINDOWS\assembly\GAC_MSIL\System.Configuration\2.0.0.0__b03f5f7f11d50a3a\System.Configuration.dll Assembly File Version: File: C:\WINDOWS\assembly\GAC_MSIL\System.Configuration\2.0.0.0__b03f5f7f11d50a3a\System.Configuration.dll InternalName: System.Configuration.dll OriginalFilename: System.Configuration.dll FileVersion: 2.0.50727.3053 (netfxsp.050727-3000) FileDescription: System.Configuration.dll Product: Microsoft® .NET Framework ProductVersion: 2.0.50727.3053 Debug: False Patched: False PreRelease: False PrivateBuild: False SpecialBuild: False Language: English (United States) Assembly Name=Microsoft.JScript, Version=8.0.0.0, Culture=neutral, PublicKeyToken=b03f5f7f11d50a3a Assembly CLR Version=v2.0.50727 Assembly Version=8.0.0.0 Assembly Location=C:\WINDOWS\assembly\GAC_MSIL\Microsoft.JScript\8.0.0.0__b03f5f7f11d50a3a\Microsoft.JScript.dll Assembly File Version: File: C:\WINDOWS\assembly\GAC_MSIL\Microsoft.JScript\8.0.0.0__b03f5f7f11d50a3a\Microsoft.JScript.dll InternalName: Microsoft.JScript.dll OriginalFilename: Microsoft.JScript.dll FileVersion: 8.0.50727.3053 FileDescription: Microsoft.JScript.dll Product: Microsoft (R) Visual Studio (R) 2005 ProductVersion: 8.0.50727.3053 Debug: False Patched: False PreRelease: False PrivateBuild: False SpecialBuild: False Language: Language Neutral Assembly Name=App_global.asax.4nq_g1xi, Version=0.0.0.0, Culture=neutral, PublicKeyToken=null Assembly CLR Version=v2.0.50727 Assembly Version=0.0.0.0 Assembly Location=C:\WINDOWS\Microsoft.NET\Framework\v2.0.50727\Temporary ASP.NET Files\services\87e24ff8\921625fe\App_global.asax.4nq_g1xi.dll Assembly File Version: File: C:\WINDOWS\Microsoft.NET\Framework\v2.0.50727\Temporary ASP.NET Files\services\87e24ff8\921625fe\App_global.asax.4nq_g1xi.dll InternalName: App_global.asax.4nq_g1xi.dll OriginalFilename: App_global.asax.4nq_g1xi.dll FileVersion: 0.0.0.0 FileDescription: Product: ProductVersion: 0.0.0.0 Debug: False Patched: False PreRelease: False PrivateBuild: False SpecialBuild: False Language: Language Neutral Assembly Name=Microsoft.TeamFoundation.Server, Version=9.0.0.0, Culture=neutral, PublicKeyToken=b03f5f7f11d50a3a Assembly CLR Version=v2.0.50727 Assembly Version=9.0.0.0 Assembly Location=C:\WINDOWS\Microsoft.NET\Framework\v2.0.50727\Temporary ASP.NET Files\services\87e24ff8\921625fe\assembly\dl3\9051eeb6\603ea9a2_d822c801\Microsoft.TeamFoundation.Server.DLL Assembly File Version: File: C:\WINDOWS\Microsoft.NET\Framework\v2.0.50727\Temporary ASP.NET Files\services\87e24ff8\921625fe\assembly\dl3\9051eeb6\603ea9a2_d822c801\Microsoft.TeamFoundation.Server.DLL InternalName: Microsoft.TeamFoundation.Server.dll OriginalFilename: Microsoft.TeamFoundation.Server.dll FileVersion: 9.0.21022.8 FileDescription: Microsoft.TeamFoundation.Server.dll Product: Microsoft (R) Visual Studio (R) 2008 ProductVersion: 9.0.21022.8 Debug: False Patched: False PreRelease: False PrivateBuild: False SpecialBuild: False Language: Language Neutral Assembly Name=Microsoft.TeamFoundation.Common, Version=9.0.0.0, Culture=neutral, PublicKeyToken=b03f5f7f11d50a3a Assembly CLR Version=v2.0.50727 Assembly Version=9.0.0.0 Assembly Location=C:\WINDOWS\assembly\GAC_32\Microsoft.TeamFoundation.Common\9.0.0.0__b03f5f7f11d50a3a\Microsoft.TeamFoundation.Common.dll Assembly File Version: File: C:\WINDOWS\assembly\GAC_32\Microsoft.TeamFoundation.Common\9.0.0.0__b03f5f7f11d50a3a\Microsoft.TeamFoundation.Common.dll InternalName: Microsoft.TeamFoundation.Common.dll OriginalFilename: Microsoft.TeamFoundation.Common.dll FileVersion: 9.0.30729.1 FileDescription: Microsoft.TeamFoundation.Common.dll Product: Microsoft (R) Visual Studio (R) 2008 ProductVersion: 9.0.30729.1 Debug: False Patched: False PreRelease: False PrivateBuild: False SpecialBuild: False Language: Language Neutral Assembly Name=Microsoft.TeamFoundation, Version=9.0.0.0, Culture=neutral, PublicKeyToken=b03f5f7f11d50a3a Assembly CLR Version=v2.0.50727 Assembly Version=9.0.0.0 Assembly Location=C:\WINDOWS\assembly\GAC_32\Microsoft.TeamFoundation\9.0.0.0__b03f5f7f11d50a3a\Microsoft.TeamFoundation.dll Assembly File Version: File: C:\WINDOWS\assembly\GAC_32\Microsoft.TeamFoundation\9.0.0.0__b03f5f7f11d50a3a\Microsoft.TeamFoundation.dll InternalName: Microsoft.TeamFoundation.dll OriginalFilename: Microsoft.TeamFoundation.dll FileVersion: 9.0.30729.1 FileDescription: Microsoft.TeamFoundation.dll Product: Microsoft (R) Visual Studio (R) 2008 ProductVersion: 9.0.30729.1 Debug: False Patched: False PreRelease: False PrivateBuild: False SpecialBuild: False Language: Language Neutral Assembly Name=System.Security, Version=2.0.0.0, Culture=neutral, PublicKeyToken=b03f5f7f11d50a3a Assembly CLR Version=v2.0.50727 Assembly Version=2.0.0.0 Assembly Location=C:\WINDOWS\assembly\GAC_MSIL\System.Security\2.0.0.0__b03f5f7f11d50a3a\System.Security.dll Assembly File Version: File: C:\WINDOWS\assembly\GAC_MSIL\System.Security\2.0.0.0__b03f5f7f11d50a3a\System.Security.dll InternalName: System.Security.dll OriginalFilename: System.Security.dll FileVersion: 2.0.50727.3053 (netfxsp.050727-3000) FileDescription: System.Security.dll Product: Microsoft® .NET Framework ProductVersion: 2.0.50727.3053 Debug: False Patched: False PreRelease: False PrivateBuild: False SpecialBuild: False Language: English (United States) Assembly Name=System.Data, Version=2.0.0.0, Culture=neutral, PublicKeyToken=b77a5c561934e089 Assembly CLR Version=v2.0.50727 Assembly Version=2.0.0.0 Assembly Location=C:\WINDOWS\assembly\GAC_32\System.Data\2.0.0.0__b77a5c561934e089\System.Data.dll Assembly File Version: File: C:\WINDOWS\assembly\GAC_32\System.Data\2.0.0.0__b77a5c561934e089\System.Data.dll InternalName: system.data.dll OriginalFilename: system.data.dll FileVersion: 2.0.50727.3053 (netfxsp.050727-3000) FileDescription: .NET Framework Product: Microsoft® .NET Framework ProductVersion: 2.0.50727.3053 Debug: False Patched: False PreRelease: False PrivateBuild: False SpecialBuild: False Language: English (United States) Assembly Name=Microsoft.TeamFoundation.Common.Library, Version=9.0.0.0, Culture=neutral, PublicKeyToken=b03f5f7f11d50a3a Assembly CLR Version=v2.0.50727 Assembly Version=9.0.0.0 Assembly Location=C:\WINDOWS\assembly\GAC_32\Microsoft.TeamFoundation.Common.Library\9.0.0.0__b03f5f7f11d50a3a\Microsoft.TeamFoundation.Common.Library.dll Assembly File Version: File: C:\WINDOWS\assembly\GAC_32\Microsoft.TeamFoundation.Common.Library\9.0.0.0__b03f5f7f11d50a3a\Microsoft.TeamFoundation.Common.Library.dll InternalName: Microsoft.TeamFoundation.Common.Library.dll OriginalFilename: Microsoft.TeamFoundation.Common.Library.dll FileVersion: 9.0.30729.1 FileDescription: Microsoft.TeamFoundation.Common.Library.dll Product: Microsoft (R) Visual Studio (R) 2008 ProductVersion: 9.0.30729.1 Debug: False Patched: False PreRelease: False PrivateBuild: False SpecialBuild: False Language: Language Neutral Assembly Name=System.Web.Mobile, Version=2.0.0.0, Culture=neutral, PublicKeyToken=b03f5f7f11d50a3a Assembly CLR Version=v2.0.50727 Assembly Version=2.0.0.0 Assembly Location=C:\WINDOWS\assembly\GAC_MSIL\System.Web.Mobile\2.0.0.0__b03f5f7f11d50a3a\System.Web.Mobile.dll As And finally, the second error: Source: Team Foundation Error Reporting Event ID: 5000 Description: EventType teamfoundationue, P1 1.0.0.0, P2 tfs, P3 9.0.30729.1, P4 9.0.0.0, P5 general, P6 typeinitializationexcept, P7 4758b22a940fe6d9, P8 d15c14bb, P9 NIL, P10 NIL. Any ideas? Thanks.

  Read the article

• An Introduction to jQuery Templates

  - by Stephen Walther

  The goal of this blog entry is to provide you with enough information to start working with jQuery Templates. jQuery Templates enable you to display and manipulate data in the browser. For example, you can use jQuery Templates to format and display a set of database records that you have retrieved with an Ajax call. jQuery Templates supports a number of powerful features such as template tags, template composition, and wrapped templates. I’ll concentrate on the features that I think that you will find most useful. In order to focus on the jQuery Templates feature itself, this blog entry is server technology agnostic. All the samples use HTML pages instead of ASP.NET pages. In a future blog entry, I’ll focus on using jQuery Templates with ASP.NET Web Forms and ASP.NET MVC (You can do some pretty powerful things when jQuery Templates are used on the client and ASP.NET is used on the server). Introduction to jQuery Templates The jQuery Templates plugin was developed by the Microsoft ASP.NET team in collaboration with the open-source jQuery team. While working at Microsoft, I wrote the original proposal for jQuery Templates, Dave Reed wrote the original code, and Boris Moore wrote the final code. The jQuery team – especially John Resig – was very involved in each step of the process. Both the jQuery community and ASP.NET communities were very active in providing feedback. jQuery Templates will be included in the jQuery core library (the jQuery.js library) when jQuery 1.5 is released. Until jQuery 1.5 is released, you can download the jQuery Templates plugin from the jQuery Source Code Repository or you can use jQuery Templates directly from the ASP.NET CDN. The documentation for jQuery Templates is already included with the official jQuery documentation at http://api.jQuery.com. The main entry for jQuery templates is located under the topic plugins/templates. A Basic Sample of jQuery Templates Let’s start with a really simple sample of using jQuery Templates. We’ll use the plugin to display a list of books stored in a JavaScript array. Here’s the complete code: <!DOCTYPE html PUBLIC "-//W3C//DTD XHTML 1.0 Transitional//EN" "http://www.w3.org/TR/xhtml1/DTD/xhtml1-transitional.dtd"> <html > <head> <title>Intro</title> <link href="0_Site.css" rel="stylesheet" type="text/css" /> </head> <body> <div id="pageContent"> <h1>ASP.NET Bookstore</h1> <div id="bookContainer"></div> </div> <script id="bookTemplate" type="text/x-jQuery-tmpl"> <div> <img src="BookPictures/${picture}" alt="" /> <h2>${title}</h2> price: ${formatPrice(price)} </div> </script> <script type="text/javascript" src="http://ajax.aspnetcdn.com/ajax/jQuery/jquery-1.4.4.js"></script> <script type="text/javascript" src="http://ajax.aspnetcdn.com/ajax/jquery.templates/beta1/jquery.tmpl.js"></script> <script type="text/javascript"> // Create an array of books var books = [ { title: "ASP.NET 4 Unleashed", price: 37.79, picture: "AspNet4Unleashed.jpg" }, { title: "ASP.NET MVC Unleashed", price: 44.99, picture: "AspNetMvcUnleashed.jpg" }, { title: "ASP.NET Kick Start", price: 4.00, picture: "AspNetKickStart.jpg" }, { title: "ASP.NET MVC Unleashed iPhone", price: 44.99, picture: "AspNetMvcUnleashedIPhone.jpg" }, ]; // Render the books using the template $("#bookTemplate").tmpl(books).appendTo("#bookContainer"); function formatPrice(price) { return "$" + price.toFixed(2); } </script> </body> </html> When you open this page in a browser, a list of books is displayed: There are several things going on in this page which require explanation. First, notice that the page uses both the jQuery 1.4.4 and jQuery Templates libraries. Both libraries are retrieved from the ASP.NET CDN: <script type="text/javascript" src="http://ajax.aspnetcdn.com/ajax/jQuery/jquery-1.4.4.js"></script> <script type="text/javascript" src="http://ajax.aspnetcdn.com/ajax/jquery.templates/beta1/jquery.tmpl.js"></script> You can use the ASP.NET CDN for free (even for production websites). You can learn more about the files included on the ASP.NET CDN by visiting the ASP.NET CDN documentation page. Second, you should notice that the actual template is included in a script tag with a special MIME type: <script id="bookTemplate" type="text/x-jQuery-tmpl"> <div> <img src="BookPictures/${picture}" alt="" /> <h2>${title}</h2> price: ${formatPrice(price)} </div> </script> This template is displayed for each of the books rendered by the template. The template displays a book picture, title, and price. Notice that the SCRIPT tag which wraps the template has a MIME type of text/x-jQuery-tmpl. Why is the template wrapped in a SCRIPT tag and why the strange MIME type? When a browser encounters a SCRIPT tag with an unknown MIME type, it ignores the content of the tag. This is the behavior that you want with a template. You don’t want a browser to attempt to parse the contents of a template because this might cause side effects. For example, the template above includes an <img> tag with a src attribute that points at “BookPictures/${picture}”. You don’t want the browser to attempt to load an image at the URL “BookPictures/${picture}”. Instead, you want to prevent the browser from processing the IMG tag until the ${picture} expression is replaced by with the actual name of an image by the jQuery Templates plugin. If you are not worried about browser side-effects then you can wrap a template inside any HTML tag that you please. For example, the following DIV tag would also work with the jQuery Templates plugin: <div id="bookTemplate" style="display:none"> <div> <h2>${title}</h2> price: ${formatPrice(price)} </div> </div> Notice that the DIV tag includes a style=”display:none” attribute to prevent the template from being displayed until the template is parsed by the jQuery Templates plugin. Third, notice that the expression ${…} is used to display the value of a JavaScript expression within a template. For example, the expression ${title} is used to display the value of the book title property. You can use any JavaScript function that you please within the ${…} expression. For example, in the template above, the book price is formatted with the help of the custom JavaScript formatPrice() function which is defined lower in the page. Fourth, and finally, the template is rendered with the help of the tmpl() method. The following statement selects the bookTemplate and renders an array of books using the bookTemplate. The results are appended to a DIV element named bookContainer by using the standard jQuery appendTo() method. $("#bookTemplate").tmpl(books).appendTo("#bookContainer"); Using Template Tags Within a template, you can use any of the following template tags. {{tmpl}} – Used for template composition. See the section below. {{wrap}} – Used for wrapped templates. See the section below. {{each}} – Used to iterate through a collection. {{if}} – Used to conditionally display template content. {{else}} – Used with {{if}} to conditionally display template content. {{html}} – Used to display the value of an HTML expression without encoding the value. Using ${…} or {{= }} performs HTML encoding automatically. {{= }}-- Used in exactly the same way as ${…}. {{! }} – Used for displaying comments. The contents of a {{!...}} tag are ignored. For example, imagine that you want to display a list of blog entries. Each blog entry could, possibly, have an associated list of categories. The following page illustrates how you can use the { if}} and {{each}} template tags to conditionally display categories for each blog entry:   <!DOCTYPE html PUBLIC "-//W3C//DTD XHTML 1.0 Transitional//EN" "http://www.w3.org/TR/xhtml1/DTD/xhtml1-transitional.dtd"> <html xmlns="http://www.w3.org/1999/xhtml"> <head> <title>each</title> <link href="1_Site.css" rel="stylesheet" type="text/css" /> </head> <body> <div id="blogPostContainer"></div> <script id="blogPostTemplate" type="text/x-jQuery-tmpl"> <h1>${postTitle}</h1> <p> ${postEntry} </p> {{if categories}} Categories: {{each categories}} <i>${$value}</i> {{/each}} {{else}} Uncategorized {{/if}} </script> <script type="text/javascript" src="http://ajax.aspnetcdn.com/ajax/jQuery/jquery-1.4.4.js"></script> <script type="text/javascript" src="http://ajax.aspnetcdn.com/ajax/jquery.templates/beta1/jquery.tmpl.js"></script> <script type="text/javascript"> var blogPosts = [ { postTitle: "How to fix a sink plunger in 5 minutes", postEntry: "Lorem ipsum dolor sit amet, consectetuer adipiscing elit. Maecenas porttitor congue massa. Fusce posuere, magna sed pulvinar ultricies, purus lectus malesuada libero, sit amet commodo magna eros quis urna.", categories: ["HowTo", "Sinks", "Plumbing"] }, { postTitle: "How to remove a broken lightbulb", postEntry: "Lorem ipsum dolor sit amet, consectetuer adipiscing elit. Maecenas porttitor congue massa. Fusce posuere, magna sed pulvinar ultricies, purus lectus malesuada libero, sit amet commodo magna eros quis urna.", categories: ["HowTo", "Lightbulbs", "Electricity"] }, { postTitle: "New associate website", postEntry: "Lorem ipsum dolor sit amet, consectetuer adipiscing elit. Maecenas porttitor congue massa. Fusce posuere, magna sed pulvinar ultricies, purus lectus malesuada libero, sit amet commodo magna eros quis urna." } ]; // Render the blog posts $("#blogPostTemplate").tmpl(blogPosts).appendTo("#blogPostContainer"); </script> </body> </html> When this page is opened in a web browser, the following list of blog posts and categories is displayed: Notice that the first and second blog entries have associated categories but the third blog entry does not. The third blog entry is “Uncategorized”. The template used to render the blog entries and categories looks like this: <script id="blogPostTemplate" type="text/x-jQuery-tmpl"> <h1>${postTitle}</h1> <p> ${postEntry} </p> {{if categories}} Categories: {{each categories}} <i>${$value}</i> {{/each}} {{else}} Uncategorized {{/if}} </script> Notice the special expression $value used within the {{each}} template tag. You can use $value to display the value of the current template item. In this case, $value is used to display the value of each category in the collection of categories. Template Composition When building a fancy page, you might want to build a template out of multiple templates. In other words, you might want to take advantage of template composition. For example, imagine that you want to display a list of products. Some of the products are being sold at their normal price and some of the products are on sale. In that case, you might want to use two different templates for displaying a product: a productTemplate and a productOnSaleTemplate. The following page illustrates how you can use the {{tmpl}} tag to build a template from multiple templates:   <!DOCTYPE html PUBLIC "-//W3C//DTD XHTML 1.0 Transitional//EN" "http://www.w3.org/TR/xhtml1/DTD/xhtml1-transitional.dtd"> <html xmlns="http://www.w3.org/1999/xhtml"> <head> <title>Composition</title> <link href="2_Site.css" rel="stylesheet" type="text/css" /> </head> <body> <div id="pageContainer"> <h1>Products</h1> <div id="productListContainer"></div> <!-- Show list of products using composition --> <script id="productListTemplate" type="text/x-jQuery-tmpl"> <div> {{if onSale}} {{tmpl "#productOnSaleTemplate"}} {{else}} {{tmpl "#productTemplate"}} {{/if}} </div> </script> <!-- Show product --> <script id="productTemplate" type="text/x-jQuery-tmpl"> ${name} </script> <!-- Show product on sale --> <script id="productOnSaleTemplate" type="text/x-jQuery-tmpl"> <b>${name}</b> <img src="images/on_sale.png" alt="On Sale" /> </script> <script type="text/javascript" src="http://ajax.aspnetcdn.com/ajax/jQuery/jquery-1.4.4.js"></script> <script type="text/javascript" src="http://ajax.aspnetcdn.com/ajax/jquery.templates/beta1/jquery.tmpl.js"></script> <script type="text/javascript"> var products = [ { name: "Laptop", onSale: false }, { name: "Apples", onSale: true }, { name: "Comb", onSale: false } ]; $("#productListTemplate").tmpl(products).appendTo("#productListContainer"); </script> </div> </body> </html>   In the page above, the main template used to display the list of products looks like this: <script id="productListTemplate" type="text/x-jQuery-tmpl"> <div> {{if onSale}} {{tmpl "#productOnSaleTemplate"}} {{else}} {{tmpl "#productTemplate"}} {{/if}} </div> </script>   If a product is on sale then the product is displayed with the productOnSaleTemplate (which includes an on sale image): <script id="productOnSaleTemplate" type="text/x-jQuery-tmpl"> <b>${name}</b> <img src="images/on_sale.png" alt="On Sale" /> </script>   Otherwise, the product is displayed with the normal productTemplate (which does not include the on sale image): <script id="productTemplate" type="text/x-jQuery-tmpl"> ${name} </script>   You can pass a parameter to the {{tmpl}} tag. The parameter becomes the data passed to the template rendered by the {{tmpl}} tag. For example, in the previous section, we used the {{each}} template tag to display a list of categories for each blog entry like this: <script id="blogPostTemplate" type="text/x-jQuery-tmpl"> <h1>${postTitle}</h1> <p> ${postEntry} </p> {{if categories}} Categories: {{each categories}} <i>${$value}</i> {{/each}} {{else}} Uncategorized {{/if}} </script>   Another way to create this template is to use template composition like this: <script id="blogPostTemplate" type="text/x-jQuery-tmpl"> <h1>${postTitle}</h1> <p> ${postEntry} </p> {{if categories}} Categories: {{tmpl(categories) "#categoryTemplate"}} {{else}} Uncategorized {{/if}} </script> <script id="categoryTemplate" type="text/x-jQuery-tmpl"> <i>${$data}</i> &nbsp; </script>   Using the {{each}} tag or {{tmpl}} tag is largely a matter of personal preference. Wrapped Templates The {{wrap}} template tag enables you to take a chunk of HTML and transform the HTML into another chunk of HTML (think easy XSLT). When you use the {{wrap}} tag, you work with two templates. The first template contains the HTML being transformed and the second template includes the filter expressions for transforming the HTML. For example, you can use the {{wrap}} template tag to transform a chunk of HTML into an interactive tab strip: When you click any of the tabs, you see the corresponding content. This tab strip was created with the following page: <!DOCTYPE html PUBLIC "-//W3C//DTD XHTML 1.0 Transitional//EN" "http://www.w3.org/TR/xhtml1/DTD/xhtml1-transitional.dtd"> <html xmlns="http://www.w3.org/1999/xhtml"> <head> <title>Wrapped Templates</title> <style type="text/css"> body { font-family: Arial; background-color:black; } .tabs div { display:inline-block; border-bottom: 1px solid black; padding:4px; background-color:gray; cursor:pointer; } .tabs div.tabState_true { background-color:white; border-bottom:1px solid white; } .tabBody { border-top:1px solid white; padding:10px; background-color:white; min-height:400px; width:400px; } </style> </head> <body> <div id="tabsView"></div> <script id="tabsContent" type="text/x-jquery-tmpl"> {{wrap "#tabsWrap"}} <h3>Tab 1</h3> <div> Content of tab 1. Lorem ipsum dolor <b>sit</b> amet, consectetuer adipiscing elit. Maecenas porttitor congue massa. Fusce posuere, magna sed pulvinar ultricies, purus lectus malesuada libero, sit amet commodo magna eros quis urna. </div> <h3>Tab 2</h3> <div> Content of tab 2. Lorem ipsum dolor <b>sit</b> amet, consectetuer adipiscing elit. Maecenas porttitor congue massa. Fusce posuere, magna sed pulvinar ultricies, purus lectus malesuada libero, sit amet commodo magna eros quis urna. </div> <h3>Tab 3</h3> <div> Content of tab 3. Lorem ipsum dolor <b>sit</b> amet, consectetuer adipiscing elit. Maecenas porttitor congue massa. Fusce posuere, magna sed pulvinar ultricies, purus lectus malesuada libero, sit amet commodo magna eros quis urna. </div> {{/wrap}} </script> <script id="tabsWrap" type="text/x-jquery-tmpl"> <div class="tabs"> {{each $item.html("h3", true)}} <div class="tabState_${$index === selectedTabIndex}"> ${$value} </div> {{/each}} </div> <div class="tabBody"> {{html $item.html("div")[selectedTabIndex]}} </div> </script> <script type="text/javascript" src="http://ajax.aspnetcdn.com/ajax/jQuery/jquery-1.4.4.js"></script> <script type="text/javascript" src="http://ajax.aspnetcdn.com/ajax/jquery.templates/beta1/jquery.tmpl.js"></script> <script type="text/javascript"> // Global for tracking selected tab var selectedTabIndex = 0; // Render the tab strip $("#tabsContent").tmpl().appendTo("#tabsView"); // When a tab is clicked, update the tab strip $("#tabsView") .delegate(".tabState_false", "click", function () { var templateItem = $.tmplItem(this); selectedTabIndex = $(this).index(); templateItem.update(); }); </script> </body> </html>   The “source” for the tab strip is contained in the following template: <script id="tabsContent" type="text/x-jquery-tmpl"> {{wrap "#tabsWrap"}} <h3>Tab 1</h3> <div> Content of tab 1. Lorem ipsum dolor <b>sit</b> amet, consectetuer adipiscing elit. Maecenas porttitor congue massa. Fusce posuere, magna sed pulvinar ultricies, purus lectus malesuada libero, sit amet commodo magna eros quis urna. </div> <h3>Tab 2</h3> <div> Content of tab 2. Lorem ipsum dolor <b>sit</b> amet, consectetuer adipiscing elit. Maecenas porttitor congue massa. Fusce posuere, magna sed pulvinar ultricies, purus lectus malesuada libero, sit amet commodo magna eros quis urna. </div> <h3>Tab 3</h3> <div> Content of tab 3. Lorem ipsum dolor <b>sit</b> amet, consectetuer adipiscing elit. Maecenas porttitor congue massa. Fusce posuere, magna sed pulvinar ultricies, purus lectus malesuada libero, sit amet commodo magna eros quis urna. </div> {{/wrap}} </script>   The tab strip is created with a list of H3 elements (which represent each tab) and DIV elements (which represent the body of each tab). Notice that the HTML content is wrapped in the {{wrap}} template tag. This template tag points at the following tabsWrap template: <script id="tabsWrap" type="text/x-jquery-tmpl"> <div class="tabs"> {{each $item.html("h3", true)}} <div class="tabState_${$index === selectedTabIndex}"> ${$value} </div> {{/each}} </div> <div class="tabBody"> {{html $item.html("div")[selectedTabIndex]}} </div> </script> The tabs DIV contains all of the tabs. The {{each}} template tag is used to loop through each of the H3 elements from the source template and render a DIV tag that represents a particular tab. The template item html() method is used to filter content from the “source” HTML template. The html() method accepts a jQuery selector for its first parameter. The tabs are retrieved from the source template by using an h3 filter. The second parameter passed to the html() method – the textOnly parameter -- causes the filter to return the inner text of each h3 element. You can learn more about the html() method at the jQuery website (see the section on $item.html()). The tabBody DIV renders the body of the selected tab. Notice that the {{html}} template tag is used to display the tab body so that HTML content in the body won’t be HTML encoded. The html() method is used, once again, to grab all of the DIV elements from the source HTML template. The selectedTabIndex global variable is used to display the contents of the selected tab. Remote Templates A common feature request for jQuery templates is support for remote templates. Developers want to be able to separate templates into different files. Adding support for remote templates requires only a few lines of extra code (Dave Ward has a nice blog entry on this). For example, the following page uses a remote template from a file named BookTemplate.htm: <!DOCTYPE html PUBLIC "-//W3C//DTD XHTML 1.0 Transitional//EN" "http://www.w3.org/TR/xhtml1/DTD/xhtml1-transitional.dtd"> <html xmlns="http://www.w3.org/1999/xhtml"> <head> <title>Remote Templates</title> <link href="0_Site.css" rel="stylesheet" type="text/css" /> </head> <body> <div id="pageContent"> <h1>ASP.NET Bookstore</h1> <div id="bookContainer"></div> </div> <script type="text/javascript" src="http://ajax.aspnetcdn.com/ajax/jQuery/jquery-1.4.4.js"></script> <script type="text/javascript" src="http://ajax.aspnetcdn.com/ajax/jquery.templates/beta1/jquery.tmpl.js"></script> <script type="text/javascript"> // Create an array of books var books = [ { title: "ASP.NET 4 Unleashed", price: 37.79, picture: "AspNet4Unleashed.jpg" }, { title: "ASP.NET MVC Unleashed", price: 44.99, picture: "AspNetMvcUnleashed.jpg" }, { title: "ASP.NET Kick Start", price: 4.00, picture: "AspNetKickStart.jpg" }, { title: "ASP.NET MVC Unleashed iPhone", price: 44.99, picture: "AspNetMvcUnleashedIPhone.jpg" }, ]; // Get the remote template $.get("BookTemplate.htm", null, function (bookTemplate) { // Render the books using the remote template $.tmpl(bookTemplate, books).appendTo("#bookContainer"); }); function formatPrice(price) { return "$" + price.toFixed(2); } </script> </body> </html>   The remote template is retrieved (and rendered) with the following code: // Get the remote template $.get("BookTemplate.htm", null, function (bookTemplate) { // Render the books using the remote template $.tmpl(bookTemplate, books).appendTo("#bookContainer"); });   This code uses the standard jQuery $.get() method to get the BookTemplate.htm file from the server with an Ajax request. After the BookTemplate.htm file is successfully retrieved, the $.tmpl() method is used to render an array of books with the template. Here’s what the BookTemplate.htm file looks like: <div> <img src="BookPictures/${picture}" alt="" /> <h2>${title}</h2> price: ${formatPrice(price)} </div> Notice that the template in the BooksTemplate.htm file is not wrapped by a SCRIPT element. There is no need to wrap the template in this case because there is no possibility that the template will get interpreted before you want it to be interpreted. If you plan to use the bookTemplate multiple times – for example, you are paging or sorting the books -- then you should compile the template into a function and cache the compiled template function. For example, the following page can be used to page through a list of 100 products (using iPhone style More paging). <!DOCTYPE html PUBLIC "-//W3C//DTD XHTML 1.0 Transitional//EN" "http://www.w3.org/TR/xhtml1/DTD/xhtml1-transitional.dtd"> <html xmlns="http://www.w3.org/1999/xhtml"> <head> <title>Template Caching</title> <link href="6_Site.css" rel="stylesheet" type="text/css" /> </head> <body> <h1>Products</h1> <div id="productContainer"></div> <button id="more">More</button> <script type="text/javascript" src="http://ajax.aspnetcdn.com/ajax/jQuery/jquery-1.4.4.js"></script> <script type="text/javascript" src="http://ajax.aspnetcdn.com/ajax/jquery.templates/beta1/jquery.tmpl.js"></script> <script type="text/javascript"> // Globals var pageIndex = 0; // Create an array of products var products = []; for (var i = 0; i < 100; i++) { products.push({ name: "Product " + (i + 1) }); } // Get the remote template $.get("ProductTemplate.htm", null, function (productTemplate) { // Compile and cache the template $.template("productTemplate", productTemplate); // Render the products renderProducts(0); }); $("#more").click(function () { pageIndex++; renderProducts(); }); function renderProducts() { // Get page of products var pageOfProducts = products.slice(pageIndex * 5, pageIndex * 5 + 5); // Used cached productTemplate to render products $.tmpl("productTemplate", pageOfProducts).appendTo("#productContainer"); } function formatPrice(price) { return "$" + price.toFixed(2); } </script> </body> </html>   The ProductTemplate is retrieved from an external file named ProductTemplate.htm. This template is retrieved only once. Furthermore, it is compiled and cached with the help of the $.template() method: // Get the remote template $.get("ProductTemplate.htm", null, function (productTemplate) { // Compile and cache the template $.template("productTemplate", productTemplate); // Render the products renderProducts(0); });   The $.template() method compiles the HTML representation of the template into a JavaScript function and caches the template function with the name productTemplate. The cached template can be used by calling the $.tmp() method. The productTemplate is used in the renderProducts() method: function renderProducts() { // Get page of products var pageOfProducts = products.slice(pageIndex * 5, pageIndex * 5 + 5); // Used cached productTemplate to render products $.tmpl("productTemplate", pageOfProducts).appendTo("#productContainer"); } In the code above, the first parameter passed to the $.tmpl() method is the name of a cached template. Working with Template Items In this final section, I want to devote some space to discussing Template Items. A new Template Item is created for each rendered instance of a template. For example, if you are displaying a list of 100 products with a template, then 100 Template Items are created. A Template Item has the following properties and methods: data – The data associated with the Template Instance. For example, a product. tmpl – The template associated with the Template Instance. parent – The parent template item if the template is nested. nodes – The HTML content of the template. calls – Used by {{wrap}} template tag. nest – Used by {{tmpl}} template tag. wrap – Used to imperatively enable wrapped templates. html – Used to filter content from a wrapped template. See the above section on wrapped templates. update – Used to re-render a template item. The last method – the update() method -- is especially interesting because it enables you to re-render a template item with new data or even a new template. For example, the following page displays a list of books. When you hover your mouse over any of the books, additional book details are displayed. In the following screenshot, details for ASP.NET Kick Start are displayed. <!DOCTYPE html PUBLIC "-//W3C//DTD XHTML 1.0 Transitional//EN" "http://www.w3.org/TR/xhtml1/DTD/xhtml1-transitional.dtd"> <html xmlns="http://www.w3.org/1999/xhtml"> <head> <title>Template Item</title> <link href="0_Site.css" rel="stylesheet" type="text/css" /> </head> <body> <div id="pageContent"> <h1>ASP.NET Bookstore</h1> <div id="bookContainer"></div> </div> <script id="bookTemplate" type="text/x-jQuery-tmpl"> <div class="bookItem"> <img src="BookPictures/${picture}" alt="" /> <h2>${title}</h2> price: ${formatPrice(price)} </div> </script> <script id="bookDetailsTemplate" type="text/x-jQuery-tmpl"> <div class="bookItem"> <img src="BookPictures/${picture}" alt="" /> <h2>${title}</h2> price: ${formatPrice(price)} <p> ${description} </p> </div> </script> <script type="text/javascript" src="http://ajax.aspnetcdn.com/ajax/jQuery/jquery-1.4.4.js"></script> <script type="text/javascript" src="http://ajax.aspnetcdn.com/ajax/jquery.templates/beta1/jquery.tmpl.js"></script> <script type="text/javascript"> // Create an array of books var books = [ { title: "ASP.NET 4 Unleashed", price: 37.79, picture: "AspNet4Unleashed.jpg", description: "The most comprehensive book on Microsoft’s new ASP.NET 4.. " }, { title: "ASP.NET MVC Unleashed", price: 44.99, picture: "AspNetMvcUnleashed.jpg", description: "Writing for professional programmers, Walther explains the crucial concepts that make the Model-View-Controller (MVC) development paradigm work…" }, { title: "ASP.NET Kick Start", price: 4.00, picture: "AspNetKickStart.jpg", description: "Visual Studio .NET is the premier development environment for creating .NET applications…." }, { title: "ASP.NET MVC Unleashed iPhone", price: 44.99, picture: "AspNetMvcUnleashedIPhone.jpg", description: "ASP.NET MVC Unleashed for the iPhone…" }, ]; // Render the books using the template $("#bookTemplate").tmpl(books).appendTo("#bookContainer"); // Get compiled details template var bookDetailsTemplate = $("#bookDetailsTemplate").template(); // Add hover handler $(".bookItem").mouseenter(function () { // Get template item associated with DIV var templateItem = $(this).tmplItem(); // Change template to compiled template templateItem.tmpl = bookDetailsTemplate; // Re-render template templateItem.update(); }); function formatPrice(price) { return "$" + price.toFixed(2); } </script> </body> </html>   There are two templates used to display a book: bookTemplate and bookDetailsTemplate. When you hover your mouse over a template item, the standard bookTemplate is swapped out for the bookDetailsTemplate. The bookDetailsTemplate displays a book description. The books are rendered with the bookTemplate with the following line of code: // Render the books using the template $("#bookTemplate").tmpl(books).appendTo("#bookContainer");   The following code is used to swap the bookTemplate and the bookDetailsTemplate to show details for a book: // Get compiled details template var bookDetailsTemplate = $("#bookDetailsTemplate").template(); // Add hover handler $(".bookItem").mouseenter(function () { // Get template item associated with DIV var templateItem = $(this).tmplItem(); // Change template to compiled template templateItem.tmpl = bookDetailsTemplate; // Re-render template templateItem.update(); });   When you hover your mouse over a DIV element rendered by the bookTemplate, the mouseenter handler executes. First, this handler retrieves the Template Item associated with the DIV element by calling the tmplItem() method. The tmplItem() method returns a Template Item. Next, a new template is assigned to the Template Item. Notice that a compiled version of the bookDetailsTemplate is assigned to the Template Item’s tmpl property. The template is compiled earlier in the code by calling the template() method. Finally, the Template Item update() method is called to re-render the Template Item with the bookDetailsTemplate instead of the original bookTemplate. Summary This is a long blog entry and I still have not managed to cover all of the features of jQuery Templates J However, I’ve tried to cover the most important features of jQuery Templates such as template composition, template wrapping, and template items. To learn more about jQuery Templates, I recommend that you look at the documentation for jQuery Templates at the official jQuery website. Another great way to learn more about jQuery Templates is to look at the (unminified) source code.

  Read the article

• Why is Java EE 6 better than Spring ?

  - by arungupta

  Java EE 6 was released over 2 years ago and now there are 14 compliant application servers. In all my talks around the world, a question that is frequently asked is Why should I use Java EE 6 instead of Spring ? There are already several blogs covering that topic: Java EE wins over Spring by Bill Burke Why will I use Java EE instead of Spring in new Enterprise Java projects in 2012 ? by Kai Waehner (more discussion on TSS) Spring to Java EE migration (Part 1 and 2, 3 and 4 coming as well) by David Heffelfinger Spring to Java EE - A Migration Experience by Lincoln Baxter Migrating Spring to Java EE 6 by Bert Ertman and Paul Bakker at NLJUG Moving from Spring to Java EE 6 - The Age of Frameworks is Over at TSS Java EE vs Spring Shootout by Rohit Kelapure and Reza Rehman at JavaOne 2011 Java EE 6 and the Ewoks by Murat Yener Definite excuse to avoid Spring forever - Bert Ertman and Arun Gupta I will try to share my perspective in this blog. First of all, I'd like to start with a note: Thank you Spring framework for filling the interim gap and providing functionality that is now included in the mainstream Java EE 6 application servers. The Java EE platform has evolved over the years learning from frameworks like Spring and provides all the functionality to build an enterprise application. Thank you very much Spring framework! While Spring was revolutionary in its time and is still very popular and quite main stream in the same way Struts was circa 2003, it really is last generation's framework - some people are even calling it legacy. However my theory is "code is king". So my approach is to build/take a simple Hello World CRUD application in Java EE 6 and Spring and compare the deployable artifacts. I started looking at the official tutorial Developing a Spring Framework MVC Application Step-by-Step but it is using the older version 2.5. I wasn't able to find any updated version in the current 3.1 release. Next, I downloaded Spring Tool Suite and thought that would provide some template samples to get started. A least a quick search did not show any handy tutorials - either video or text-based. So I searched and found a link to their SVN repository at src.springframework.org/svn/spring-samples/. I tried the "mvc-basic" sample and the generated WAR file was 4.43 MB. While it was named a "basic" sample it seemed to come with 19 different libraries bundled but it was what I could find: ./WEB-INF/lib/aopalliance-1.0.jar./WEB-INF/lib/hibernate-validator-4.1.0.Final.jar./WEB-INF/lib/jcl-over-slf4j-1.6.1.jar./WEB-INF/lib/joda-time-1.6.2.jar./WEB-INF/lib/joda-time-jsptags-1.0.2.jar./WEB-INF/lib/jstl-1.2.jar./WEB-INF/lib/log4j-1.2.16.jar./WEB-INF/lib/slf4j-api-1.6.1.jar./WEB-INF/lib/slf4j-log4j12-1.6.1.jar./WEB-INF/lib/spring-aop-3.0.5.RELEASE.jar./WEB-INF/lib/spring-asm-3.0.5.RELEASE.jar./WEB-INF/lib/spring-beans-3.0.5.RELEASE.jar./WEB-INF/lib/spring-context-3.0.5.RELEASE.jar./WEB-INF/lib/spring-context-support-3.0.5.RELEASE.jar./WEB-INF/lib/spring-core-3.0.5.RELEASE.jar./WEB-INF/lib/spring-expression-3.0.5.RELEASE.jar./WEB-INF/lib/spring-web-3.0.5.RELEASE.jar./WEB-INF/lib/spring-webmvc-3.0.5.RELEASE.jar./WEB-INF/lib/validation-api-1.0.0.GA.jar And it is not even using any database! The app deployed fine on GlassFish 3.1.2 but the "@Controller Example" link did not work as it was missing the context root. With a bit of tweaking I could deploy the application and assume that the account got created because no error was displayed in the browser or server log. Next I generated the WAR for "mvc-ajax" and the 5.1 MB WAR had 20 JARs (1 removed, 2 added): ./WEB-INF/lib/aopalliance-1.0.jar./WEB-INF/lib/hibernate-validator-4.1.0.Final.jar./WEB-INF/lib/jackson-core-asl-1.6.4.jar./WEB-INF/lib/jackson-mapper-asl-1.6.4.jar./WEB-INF/lib/jcl-over-slf4j-1.6.1.jar./WEB-INF/lib/joda-time-1.6.2.jar./WEB-INF/lib/jstl-1.2.jar./WEB-INF/lib/log4j-1.2.16.jar./WEB-INF/lib/slf4j-api-1.6.1.jar./WEB-INF/lib/slf4j-log4j12-1.6.1.jar./WEB-INF/lib/spring-aop-3.0.5.RELEASE.jar./WEB-INF/lib/spring-asm-3.0.5.RELEASE.jar./WEB-INF/lib/spring-beans-3.0.5.RELEASE.jar./WEB-INF/lib/spring-context-3.0.5.RELEASE.jar./WEB-INF/lib/spring-context-support-3.0.5.RELEASE.jar./WEB-INF/lib/spring-core-3.0.5.RELEASE.jar./WEB-INF/lib/spring-expression-3.0.5.RELEASE.jar./WEB-INF/lib/spring-web-3.0.5.RELEASE.jar./WEB-INF/lib/spring-webmvc-3.0.5.RELEASE.jar./WEB-INF/lib/validation-api-1.0.0.GA.jar 2 more JARs for just doing Ajax. Anyway, deploying this application gave the following error: Caused by: java.lang.NoSuchMethodError: org.codehaus.jackson.map.SerializationConfig.<init>(Lorg/codehaus/jackson/map/ClassIntrospector;Lorg/codehaus/jackson/map/AnnotationIntrospector;Lorg/codehaus/jackson/map/introspect/VisibilityChecker;Lorg/codehaus/jackson/map/jsontype/SubtypeResolver;)V    at org.springframework.samples.mvc.ajax.json.ConversionServiceAwareObjectMapper.<init>(ConversionServiceAwareObjectMapper.java:20)    at org.springframework.samples.mvc.ajax.json.JacksonConversionServiceConfigurer.postProcessAfterInitialization(JacksonConversionServiceConfigurer.java:40)    at org.springframework.beans.factory.support.AbstractAutowireCapableBeanFactory.applyBeanPostProcessorsAfterInitialization(AbstractAutowireCapableBeanFactory.java:407) Seems like some incorrect repos in the "pom.xml". Next one is "mvc-showcase" and the 6.49 MB WAR now has 28 JARs as shown below: ./WEB-INF/lib/aopalliance-1.0.jar./WEB-INF/lib/aspectjrt-1.6.10.jar./WEB-INF/lib/commons-fileupload-1.2.2.jar./WEB-INF/lib/commons-io-2.0.1.jar./WEB-INF/lib/el-api-2.2.jar./WEB-INF/lib/hibernate-validator-4.1.0.Final.jar./WEB-INF/lib/jackson-core-asl-1.8.1.jar./WEB-INF/lib/jackson-mapper-asl-1.8.1.jar./WEB-INF/lib/javax.inject-1.jar./WEB-INF/lib/jcl-over-slf4j-1.6.1.jar./WEB-INF/lib/jdom-1.0.jar./WEB-INF/lib/joda-time-1.6.2.jar./WEB-INF/lib/jstl-api-1.2.jar./WEB-INF/lib/jstl-impl-1.2.jar./WEB-INF/lib/log4j-1.2.16.jar./WEB-INF/lib/rome-1.0.0.jar./WEB-INF/lib/slf4j-api-1.6.1.jar./WEB-INF/lib/slf4j-log4j12-1.6.1.jar./WEB-INF/lib/spring-aop-3.1.0.RELEASE.jar./WEB-INF/lib/spring-asm-3.1.0.RELEASE.jar./WEB-INF/lib/spring-beans-3.1.0.RELEASE.jar./WEB-INF/lib/spring-context-3.1.0.RELEASE.jar./WEB-INF/lib/spring-context-support-3.1.0.RELEASE.jar./WEB-INF/lib/spring-core-3.1.0.RELEASE.jar./WEB-INF/lib/spring-expression-3.1.0.RELEASE.jar./WEB-INF/lib/spring-web-3.1.0.RELEASE.jar./WEB-INF/lib/spring-webmvc-3.1.0.RELEASE.jar./WEB-INF/lib/validation-api-1.0.0.GA.jar The app at least deployed and showed results this time. But still no database! Next I tried building "jpetstore" and got the error: [ERROR] Failed to execute goal on project org.springframework.samples.jpetstore:Could not resolve dependencies for project org.springframework.samples:org.springframework.samples.jpetstore:war:1.0.0-SNAPSHOT: Failed to collect dependencies for [commons-fileupload:commons-fileupload:jar:1.2.1 (compile), org.apache.struts:com.springsource.org.apache.struts:jar:1.2.9 (compile), javax.xml.rpc:com.springsource.javax.xml.rpc:jar:1.1.0 (compile), org.apache.commons:com.springsource.org.apache.commons.dbcp:jar:1.2.2.osgi (compile), commons-io:commons-io:jar:1.3.2 (compile), hsqldb:hsqldb:jar:1.8.0.7 (compile), org.apache.tiles:tiles-core:jar:2.2.0 (compile), org.apache.tiles:tiles-jsp:jar:2.2.0 (compile), org.tuckey:urlrewritefilter:jar:3.1.0 (compile), org.springframework:spring-webmvc:jar:3.0.0.BUILD-SNAPSHOT (compile), org.springframework:spring-orm:jar:3.0.0.BUILD-SNAPSHOT (compile), org.springframework:spring-context-support:jar:3.0.0.BUILD-SNAPSHOT (compile), org.springframework.webflow:spring-js:jar:2.0.7.RELEASE (compile), org.apache.ibatis:com.springsource.com.ibatis:jar:2.3.4.726 (runtime), com.caucho:com.springsource.com.caucho:jar:3.2.1 (compile), org.apache.axis:com.springsource.org.apache.axis:jar:1.4.0 (compile), javax.wsdl:com.springsource.javax.wsdl:jar:1.6.1 (compile), javax.servlet:jstl:jar:1.2 (runtime), org.aspectj:aspectjweaver:jar:1.6.5 (compile), javax.servlet:servlet-api:jar:2.5 (provided), javax.servlet.jsp:jsp-api:jar:2.1 (provided), junit:junit:jar:4.6 (test)]: Failed to read artifact descriptor for org.springframework:spring-webmvc:jar:3.0.0.BUILD-SNAPSHOT: Could not transfer artifact org.springframework:spring-webmvc:pom:3.0.0.BUILD-SNAPSHOT from/to JBoss repository (http://repository.jboss.com/maven2): Access denied to: http://repository.jboss.com/maven2/org/springframework/spring-webmvc/3.0.0.BUILD-SNAPSHOT/spring-webmvc-3.0.0.BUILD-SNAPSHOT.pom It appears the sample is broken - maybe I was pulling from the wrong repository - would be great if someone were to point me at a good target to use here. With a 50% hit on samples in this repository, I started searching through numerous blogs, most of which have either outdated information (using XML-heavy Spring 2.5), some piece of configuration (which is a typical "feature" of Spring) is missing, or too much complexity in the sample. I finally found this blog that worked like a charm. This blog creates a trivial Spring MVC 3 application using Hibernate and MySQL. This application performs CRUD operations on a single table in a database using typical Spring technologies.  I downloaded the sample code from the blog, deployed it on GlassFish 3.1.2 and could CRUD the "person" entity. The source code for this application can be downloaded here. More details on the application statistics below. And then I built a similar CRUD application in Java EE 6 using NetBeans wizards in a couple of minutes. The source code for the application can be downloaded here and the WAR here. The Spring Source Tool Suite may also offer similar wizard-driven capabilities but this blog focus primarily on comparing the runtimes. The lack of STS tutorials was slightly disappointing as well. NetBeans however has tons of text-based and video tutorials and tons of material even by the community. One more bit on the download size of tools bundle ... NetBeans 7.1.1 "All" is 211 MB (which includes GlassFish and Tomcat) Spring Tool Suite  2.9.0 is 347 MB (~ 65% bigger) This blog is not about the tooling comparison so back to the Java EE 6 version of the application .... In order to run the Java EE version on GlassFish, copy the MySQL Connector/J to glassfish3/glassfish/domains/domain1/lib/ext directory and create a JDBC connection pool and JDBC resource as: ./bin/asadmin create-jdbc-connection-pool --datasourceclassname \\ com.mysql.jdbc.jdbc2.optional.MysqlDataSource --restype \\ javax.sql.DataSource --property \\ portNumber=3306:user=mysql:password=mysql:databaseName=mydatabase \\ myConnectionPool ./bin/asadmin create-jdbc-resource --connectionpoolid myConnectionPool jdbc/myDataSource I generated WARs for the two projects and the table below highlights some differences between them: Java EE 6 Spring WAR File Size 0.021030 MB 10.87 MB (~516x) Number of files 20 53 (> 2.5x) Bundled libraries 0 36 Total size of libraries 0 12.1 MB XML files 3 5 LoC in XML files 50 (11 + 15 + 24) 129 (27 + 46 + 16 + 11 + 19) (~ 2.5x) Total .properties files 1 Bundle.properties 2 spring.properties, log4j.properties Cold Deploy 5,339 ms 11,724 ms Second Deploy 481 ms 6,261 ms Third Deploy 528 ms 5,484 ms Fourth Deploy 484 ms 5,576 ms Runtime memory ~73 MB ~101 MB Some points worth highlighting from the table ... 516x WAR file, 10x deployment time - With 12.1 MB of libraries (for a very basic application) bundled in your application, the WAR file size and the deployment time will naturally go higher. The WAR file for Spring-based application is 516x bigger and the deployment time is double during the first deployment and ~ 10x during subsequent deployments. The Java EE 6 application is fully portable and will run on any Java EE 6 compliant application server. 36 libraries in the WAR - There are 14 Java EE 6 compliant application servers today. Each of those servers provide all the functionality like transactions, dependency injection, security, persistence, etc typically required of an enterprise or web application. There is no need to bundle 36 libraries worth 12.1 MB for a trivial CRUD application. These 14 compliant application servers provide all the functionality baked in. Now you can also deploy these libraries in the container but then you don't get the "portability" offered by Spring in that case. Does your typical Spring deployment actually do that ? 3x LoC in XML - The number of XML files is about 1.6x and the LoC is ~ 2.5x. So much XML seems circa 2003 when the Java language had no annotations. The XML files can be further reduced, e.g. faces-config.xml can be replaced without providing i18n, but I just want to compare stock applications. Memory usage - Both the applications were deployed on default GlassFish 3.1.2 installation and any additional memory consumed as part of deployment/access was attributed to the application. This is by no means scientific but at least provides an initial ballpark. This area definitely needs more investigation. Another table that compares typical Java EE 6 compliant application servers and the custom-stack created for a Spring application ... Java EE 6 Spring Web Container ? 53 MB (tcServer 2.6.3 Developer Edition) Security ? 12 MB (Spring Security 3.1.0) Persistence ? 6.3 MB (Hibernate 4.1.0, required) Dependency Injection ? 5.3 MB (Framework) Web Services ? 796 KB (Spring WS 2.0.4) Messaging ? 3.4 MB (RabbitMQ Server 2.7.1) 936 KB (Java client 936) OSGi ? 1.3 MB (Spring OSGi 1.2.1) GlassFish and WebLogic (starting at 33 MB) 83.3 MB There are differentiating factors on both the stacks. But most of the functionality like security, persistence, and dependency injection is baked in a Java EE 6 compliant application server but needs to be individually managed and patched for a Spring application. This very quickly leads to a "stack explosion". The Java EE 6 servers are tested extensively on a variety of platforms in different combinations whereas a Spring application developer is responsible for testing with different JDKs, Operating Systems, Versions, Patches, etc. Oracle has both the leading OSS lightweight server with GlassFish and the leading enterprise Java server with WebLogic Server, both Java EE 6 and both with lightweight deployment options. The Web Container offered as part of a Java EE 6 application server not only deploys your enterprise Java applications but also provide operational management, diagnostics, and mission-critical capabilities required by your applications. The Java EE 6 platform also introduced the Web Profile which is a subset of the specifications from the entire platform. It is targeted at developers of modern web applications offering a reasonably complete stack, composed of standard APIs, and is capable out-of-the-box of addressing the needs of a large class of Web applications. As your applications grow, the stack can grow to the full Java EE 6 platform. The GlassFish Server Web Profile starting at 33MB (smaller than just the non-standard tcServer) provides most of the functionality typically required by a web application. WebLogic provides battle-tested functionality for a high throughput, low latency, and enterprise grade web application. No individual managing or patching, all tested and commercially supported for you! Note that VMWare does have a server, tcServer, but it is non-standard and not even certified to the level of the standard Web Profile most customers expect these days. Customers who choose this risk proprietary lock-in since VMWare does not seem to want to formally certify with either Java EE 6 Enterprise Platform or with Java EE 6 Web Profile but of course it would be great if they were to join the community and help their customers reduce the risk of deploying on VMWare software. Some more points to help you decide choose between Java EE 6 and Spring ... Freedom to choose container - There are 14 Java EE 6 compliant application servers today, with a variety of open source and commercial offerings. A Java EE 6 application can be deployed on any of those containers. So if you deployed your application on GlassFish today and would like to scale up with your demands then you can deploy the same application to WebLogic. And because of the portability of a Java EE 6 application, you can even take it a different vendor altogether. Spring requires a runtime which could be any of these app servers as well. But why use Spring when all the required functionality is already baked into the application server itself ? Spring also has a different definition of portability where they claim to bundle all the libraries in the WAR file and move to any application server. But we saw earlier how bloated that archive could be. The equivalent features in Spring runtime offerings (mainly tcServer) are not all open source, not as mature, and often require manual assembly.  Vendor choice - The Java EE 6 platform is created using the Java Community Process where all the big players like Oracle, IBM, RedHat, and Apache are conritbuting to make the platform successful. Each application server provides the basic Java EE 6 platform compliance and has its own competitive offerings. This allows you to choose an application server for deploying your Java EE 6 applications. If you are not happy with the support or feature of one vendor then you can move your application to a different vendor because of the portability promise offered by the platform. Spring is a set of products from a single company, one price book, one support organization, one sustaining organization, one sales organization, etc. If any of those cause a customer headache, where do you go ? Java EE, backed by multiple vendors, is a safer bet for those that are risk averse. Production support - With Spring, typically you need to get support from two vendors - VMWare and the container provider. With Java EE 6, all of this is typically provided by one vendor. For example, Oracle offers commercial support from systems, operating systems, JDK, application server, and applications on top of them. VMWare certainly offers complete production support but do you really want to put all your eggs in one basket ? Do you really use tcServer ? ;-) Maintainability - With Spring, you are likely building your own distribution with multiple JAR files, integrating, patching, versioning, etc of all those components. Spring's claim is that multiple JAR files allow you to go à la carte and pick the latest versions of different components. But who is responsible for testing whether all these versions work together ? Yep, you got it, its YOU! If something does not work, who patches and maintains the JARs ? Of course, you! Commercial support for such a configuration ? On your own! The Java EE application servers manage all of this for you and provide a well-tested and commercially supported bundle. While it is always good to realize that there is something new and improved that updates and replaces older frameworks like Spring, the good news is not only does a Java EE 6 container offer what is described here, most also will let you deploy and run your Spring applications on them while you go through an upgrade to a more modern architecture. End result, you get the best of both worlds - keeping your legacy investment but moving to a more agile, lightweight world of Java EE 6. A message to the Spring lovers ... The complexity in J2EE 1.2, 1.3, and 1.4 led to the genesis of Spring but that was in 2004. This is 2012 and the name has changed to "Java EE 6" :-) There are tons of improvements in the Java EE platform to make it easy-to-use and powerful. Some examples: Adding @Stateless on a POJO makes it an EJB EJBs can be packaged in a WAR with no special packaging or deployment descriptors "web.xml" and "faces-config.xml" are optional in most of the common cases Typesafe dependency injection is now part of the Java EE platform Add @Path on a POJO allows you to publish it as a RESTful resource EJBs can be used as backing beans for Facelets-driven JSF pages providing full MVC Java EE 6 WARs are known to be kilobytes in size and deployed in milliseconds Tons of other simplifications in the platform and application servers So if you moved away from J2EE to Spring many years ago and have not looked at Java EE 6 (which has been out since Dec 2009) then you should definitely try it out. Just be at least aware of what other alternatives are available instead of restricting yourself to one stack. Here are some workshops and screencasts worth trying: screencast #37 shows how to build an end-to-end application using NetBeans screencast #36 builds the same application using Eclipse javaee-lab-feb2012.pdf is a 3-4 hours self-paced hands-on workshop that guides you to build a comprehensive Java EE 6 application using NetBeans Each city generally has a "spring cleanup" program every year. It allows you to clean up the mess from your house. For your software projects, you don't need to wait for an annual event, just get started and reduce the technical debt now! Move away from your legacy Spring-based applications to a lighter and more modern approach of building enterprise Java applications using Java EE 6. Watch this beautiful presentation that explains how to migrate from Spring -> Java EE 6: List of files in the Java EE 6 project: ./index.xhtml./META-INF./person./person/Create.xhtml./person/Edit.xhtml./person/List.xhtml./person/View.xhtml./resources./resources/css./resources/css/jsfcrud.css./template.xhtml./WEB-INF./WEB-INF/classes./WEB-INF/classes/Bundle.properties./WEB-INF/classes/META-INF./WEB-INF/classes/META-INF/persistence.xml./WEB-INF/classes/org./WEB-INF/classes/org/javaee./WEB-INF/classes/org/javaee/javaeemysql./WEB-INF/classes/org/javaee/javaeemysql/AbstractFacade.class./WEB-INF/classes/org/javaee/javaeemysql/Person.class./WEB-INF/classes/org/javaee/javaeemysql/Person_.class./WEB-INF/classes/org/javaee/javaeemysql/PersonController$1.class./WEB-INF/classes/org/javaee/javaeemysql/PersonController$PersonControllerConverter.class./WEB-INF/classes/org/javaee/javaeemysql/PersonController.class./WEB-INF/classes/org/javaee/javaeemysql/PersonFacade.class./WEB-INF/classes/org/javaee/javaeemysql/util./WEB-INF/classes/org/javaee/javaeemysql/util/JsfUtil.class./WEB-INF/classes/org/javaee/javaeemysql/util/PaginationHelper.class./WEB-INF/faces-config.xml./WEB-INF/web.xml List of files in the Spring 3.x project: ./META-INF ./META-INF/MANIFEST.MF./WEB-INF./WEB-INF/applicationContext.xml./WEB-INF/classes./WEB-INF/classes/log4j.properties./WEB-INF/classes/org./WEB-INF/classes/org/krams ./WEB-INF/classes/org/krams/tutorial ./WEB-INF/classes/org/krams/tutorial/controller ./WEB-INF/classes/org/krams/tutorial/controller/MainController.class ./WEB-INF/classes/org/krams/tutorial/domain ./WEB-INF/classes/org/krams/tutorial/domain/Person.class ./WEB-INF/classes/org/krams/tutorial/service ./WEB-INF/classes/org/krams/tutorial/service/PersonService.class ./WEB-INF/hibernate-context.xml ./WEB-INF/hibernate.cfg.xml ./WEB-INF/jsp ./WEB-INF/jsp/addedpage.jsp ./WEB-INF/jsp/addpage.jsp ./WEB-INF/jsp/deletedpage.jsp ./WEB-INF/jsp/editedpage.jsp ./WEB-INF/jsp/editpage.jsp ./WEB-INF/jsp/personspage.jsp ./WEB-INF/lib ./WEB-INF/lib/antlr-2.7.6.jar ./WEB-INF/lib/aopalliance-1.0.jar ./WEB-INF/lib/c3p0-0.9.1.2.jar ./WEB-INF/lib/cglib-nodep-2.2.jar ./WEB-INF/lib/commons-beanutils-1.8.3.jar ./WEB-INF/lib/commons-collections-3.2.1.jar ./WEB-INF/lib/commons-digester-2.1.jar ./WEB-INF/lib/commons-logging-1.1.1.jar ./WEB-INF/lib/dom4j-1.6.1.jar ./WEB-INF/lib/ejb3-persistence-1.0.2.GA.jar ./WEB-INF/lib/hibernate-annotations-3.4.0.GA.jar ./WEB-INF/lib/hibernate-commons-annotations-3.1.0.GA.jar ./WEB-INF/lib/hibernate-core-3.3.2.GA.jar ./WEB-INF/lib/javassist-3.7.ga.jar ./WEB-INF/lib/jstl-1.1.2.jar ./WEB-INF/lib/jta-1.1.jar ./WEB-INF/lib/junit-4.8.1.jar ./WEB-INF/lib/log4j-1.2.14.jar ./WEB-INF/lib/mysql-connector-java-5.1.14.jar ./WEB-INF/lib/persistence-api-1.0.jar ./WEB-INF/lib/slf4j-api-1.6.1.jar ./WEB-INF/lib/slf4j-log4j12-1.6.1.jar ./WEB-INF/lib/spring-aop-3.0.5.RELEASE.jar ./WEB-INF/lib/spring-asm-3.0.5.RELEASE.jar ./WEB-INF/lib/spring-beans-3.0.5.RELEASE.jar ./WEB-INF/lib/spring-context-3.0.5.RELEASE.jar ./WEB-INF/lib/spring-context-support-3.0.5.RELEASE.jar ./WEB-INF/lib/spring-core-3.0.5.RELEASE.jar ./WEB-INF/lib/spring-expression-3.0.5.RELEASE.jar ./WEB-INF/lib/spring-jdbc-3.0.5.RELEASE.jar ./WEB-INF/lib/spring-orm-3.0.5.RELEASE.jar ./WEB-INF/lib/spring-tx-3.0.5.RELEASE.jar ./WEB-INF/lib/spring-web-3.0.5.RELEASE.jar ./WEB-INF/lib/spring-webmvc-3.0.5.RELEASE.jar ./WEB-INF/lib/standard-1.1.2.jar ./WEB-INF/lib/xml-apis-1.0.b2.jar ./WEB-INF/spring-servlet.xml ./WEB-INF/spring.properties ./WEB-INF/web.xml So, are you excited about Java EE 6 ? Want to get started now ? Here are some resources: Java EE 6 SDK (including runtime, samples, tutorials etc) GlassFish Server Open Source Edition 3.1.2 (Community) Oracle GlassFish Server 3.1.2 (Commercial) Java EE 6 using WebLogic 12c and NetBeans (Video) Java EE 6 with NetBeans and GlassFish (Video) Java EE with Eclipse and GlassFish (Video)

  Read the article

• E-Business Suite Technology Sessions at OpenWorld 2012

  - by Max Arderius

  Oracle OpenWorld 2012 is almost here! We're looking forward to updating you on our products, strategy, and roadmaps. This year, the E-Business Suite Applications Technology Group (ATG) will participate in 25 speaker sessions, two Meet the Experts round-table discussions, five demoground booths and seven Special Interest Group meetings as guest speakers. We hope to see you at our sessions.  Please join us to hear the latest news and connect with senior ATG development staff. Here's a downloadable listing of all Applications Technology Group-related sessions with times and locations: FOCUS ON Oracle E-Business Suite - Applications Tools and Technology (PDF) General Sessions GEN8474 - Oracle E-Business Suite - Strategy, Update, and RoadmapCliff Godwin, SVP, Oracle Monday, Oct 1, 12:15 PM - 1:15 PM - Moscone West 2002/2004 In this session, hear Oracle E-Business Suite General Manager Cliff Godwin deliver an update on the Oracle E-Business Suite product line. This session covers the value delivered by the current release of Oracle E-Business Suite, the momentum, and how Oracle E-Business Suite applications integrate into Oracle’s overall applications strategy. You’ll come away with an understanding of the value Oracle E-Business Suite applications deliver now and will deliver in the future. GEN9173 - Optimize and Extend Oracle Applications - The Path to Oracle Fusion ApplicationsNadia Bendjedou, Oracle; Corre Curtice, Bhavish Madurai (CSC) Tuesday, Oct 2, 10:15 AM - 11:15 AM - Moscone West 3002/3004 One of the main objectives of this session is to help organizations build their IT roadmap for the next five years and be aligned with the Oracle Applications strategy in general and the Oracle Fusion Applications strategy in particular. Come hear about some of the common sense, practical steps you can take to optimize the performance of your Oracle Applications today and prepare your path to Oracle Fusion Applications for when your organization is ready to embrace them. Each step you take in adopting Oracle Fusion technology gets you partway to Oracle Fusion Applications. Conference Sessions CON9024 - Oracle E-Business Suite Technology: Latest Features and Roadmap Lisa Parekh, Oracle Monday, Oct 1, 10:45 AM - 11:45 AM - Moscone West 2016 This Oracle development session provides a comprehensive overview of Oracle’s product strategy for Oracle E-Business Suite technology, the capabilities and associated business benefits of recent releases, and a review of capabilities on the product roadmap. This is the cornerstone session for the Oracle E-Business Suite technology stack. Come hear about the latest new usability enhancements of the user interface; systems administration and configuration management tools; security-related updates; and tools and options for extending, customizing, and integrating Oracle E-Business Suite with other applications. CON9021 - Oracle E-Business Suite Future Directions: Deployment and System AdministrationMax Arderius, Oracle Monday, Oct 1, 3:15 PM - 4:15 PM - Moscone West 2016  What’s coming in the next major version of Oracle E-Business Suite 12? This Oracle Development session covers the latest technology stack, including the use of Oracle WebLogic Server (Oracle Fusion Middleware 11g) and Oracle Database 11g Release 2 (11.2). Topics include an architectural overview of the latest updates, installation and upgrade options, new configuration options, and new tools for hot cloning and automated “lights-out” cloning. Come learn how online patching (based on the Oracle Database 11g Release 2 Edition-Based Redefinition feature) will reduce your database patching downtimes to however long it takes to bounce your database server. CON9017 - Desktop Integration in Oracle E-Business Suite 12.1 Padmaprabodh Ambale, Gustavo Jimenez, Oracle Monday, Oct 1, 4:45 PM - 5:45 PM - Moscone West 2016 This presentation covers the latest functional enhancements in Oracle Web Applications Desktop Integrator and Oracle Report Manager, enhanced Microsoft Office support, and greater support for building custom desktop integration solutions. The session also presents tips and tricks for upgrading from Oracle Applications Desktop Integrator to Oracle Web Applications Desktop Integrator and Oracle Report Manager. CON9023 - Oracle E-Business Suite Technology Certification Primer and Roadmap Steven Chan, Oracle Tuesday, Oct 2, 10:15 AM - 11:15 AM - Moscone West 2016  Is your Oracle E-Business Suite technology stack up to date? Are you taking advantage of all the latest options and capabilities? This Oracle development session summarizes the latest certifications and roadmap for the Oracle E-Business Suite technology stack, including elements such as database releases and options, Java, Oracle Forms, Oracle Containers for J2EE, desktop operating systems, browsers, JRE releases, development and Web authoring tools, user authentication and management, business intelligence, Oracle Application Management Packs, security options, clouds, Oracle VM, and virtualization. The session also covers the most commonly asked questions about tech stack component support dates and upgrade implications. CON9028 - Minimizing Oracle E-Business Suite Maintenance DowntimesSantiago Bastidas, Elke Phelps, Oracle Tuesday, Oct 2, 11:45 AM - 12:45 PM - Moscone West 2016 This Oracle development session features a survey of the best techniques sysadmins can use to minimize patching downtimes. It starts with an architectural-level review of Oracle E-Business Suite fundamentals and then moves to a practical view of the various tools and approaches for downtimes. Topics include patching shortcuts, merging patches, distributing worker processes across multiple servers, running ADPatch in noninteractive mode, staged APPL_TOPs, shared file systems, deferring systemwide database tasks, avoiding resource bottlenecks, and more. An added bonus: hear about the upcoming Oracle E-Business Suite 12 online patching capabilities based on the groundbreaking Oracle Database 11g Release 2 Edition-Based Redefinition feature. CON9116 - Extending the Use of Oracle E-Business Suite with the Oracle Endeca PlatformOsama Elkady, Muhannad Obeidat, Oracle Tuesday, Oct 2, 11:45 AM - 12:45 PM - Moscone West 2018 The Oracle Endeca platform includes a leading unstructured data correlation and analytics engine, together with a best-in class catalog search and guided navigation solution, to improve the productivity of all types of users in your enterprise. This development session focuses on the details behind the Oracle Endeca platform’s integration into Oracle E-Business Suite. It demonstrates how easily you can extend the use of the Oracle Endeca platform into other areas of Oracle E-Business Suite and how you can bring in your own data and build new Oracle Endeca applications for Oracle E-Business Suite. CON9005 - Oracle E-Business Suite Integration Best PracticesVeshaal Singh, Oracle, Jeffrey Hand, Zebra Technologies Tuesday, Oct 2, 1:15 PM - 2:15 PM - Moscone West 2018 Oracle is investing across applications and technologies to make the application integration experience easier for customers. Today Oracle has certified Oracle E-Business Suite on Oracle Fusion Middleware 11g and provides a comprehensive set of integration technologies. Learn about Oracle’s integration offering across data- and process-centric integrations. These technologies can be used to address various application integration challenges and styles. In this session, you will get an understanding of how, when, and where you can leverage Oracle’s integration technologies to connect end-to-end business processes across your enterprise, including your Oracle Applications portfolio.  CON9026 - Latest Oracle E-Business Suite 12.1 User Interface and Usability EnhancementsPadmaprabodh Ambale, Oracle Tuesday, Oct 2, 1:15 PM - 2:15 PM - Moscone West 2016 This Oracle development session details the latest UI enhancements to Oracle Application Framework in Oracle E-Business Suite 12.1. Developers will get a detailed look at new features to enhance usability, offer more capabilities for personalization and extensions, and support the development and use of dashboards and Web services. Topics include new rich UI capabilities such as new home page features, Navigator and Favorites pull-down menus, REST interface, embedded widgets for analytics content, Oracle Application Development Framework (Oracle ADF) task flows, third-party widgets, a look-ahead list of values, inline attachments, pop-ups, personalization and extensibility enhancements, business layer extensions, Oracle ADF integration, and mobile devices. CON8805 - Planning Your Oracle E-Business Suite Upgrade from 11i to Release 12.1 and BeyondAnne Carlson, Oracle Tuesday, Oct 2, 5:00 PM - 6:00 PM - Moscone West 3002/3004 Attend this session to hear the latest Oracle E-Business Suite 12.1 upgrade planning tips from Oracle’s support, consulting, development, and IT organizations. You’ll get specific cross-product advice on how to understand the factors that affect your project’s duration, decide on your project’s scope, develop a robust testing strategy, leverage Oracle Support resources, and more. In a nutshell, this session tells you things you need to know before embarking upon your Release 12.1 upgrade project. CON9053 - Advanced Management of Oracle E-Business Suite with Oracle Enterprise ManagerAngelo Rosado, Oracle Tuesday, Oct 2, 5:00 PM - 6:00 PM - Moscone West 2016 The task of managing and monitoring Oracle E-Business Suite environments can be very challenging. Oracle Enterprise Manager is the only product on the market that is designed to monitor and manage all the different technologies that constitute Oracle E-Business Suite applications, including end user, midtier, configuration, host, and database management—to name just a few. Customers that have implemented Oracle Enterprise Manager have experienced dramatic improvements in system visibility and diagnostic capability as well as administrator productivity. The purpose of this session is to highlight the key features and benefits of Oracle Enterprise Manager and Oracle Application Management Suite for Oracle E-Business Suite. CON8809 - Oracle E-Business Suite 12.1 Upgrade Best Practices: Technical InsightIsam Alyousfi, Udayan Parvate, Oracle Wednesday, Oct 3, 10:15 AM - 11:15 AM - Moscone West 3011 This session is ideal for organizations thinking about upgrading to Oracle E-Business Suite 12.1. It covers the fundamentals of upgrading to Release 12.1, including the technology stack components and supported upgrade paths. Hear from Oracle Development about the set of best practices for patching in general and executing the Release 12.1 technical upgrade, with special considerations for minimizing your downtime. Also get to know about relatively recent upgrade resources. CON9032 - Upgrading Your Customizations of Oracle E-Business Suite 12.1Sara Woodhull, Oracle Wednesday, Oct 3, 10:15 AM - 11:15 AM - Moscone West 2016 Have you personalized Oracle Forms or Oracle Application Framework screens in Oracle E-Business Suite? Have you used mod_plsql in Release 11i? Have you extended or customized your Release 11i environment with other tools? The technical options for upgrading these customizations as part of your Oracle E-Business Suite Release 12.1 upgrade can be bewildering. Come to this Oracle development session to learn about selecting the best upgrade approach for your existing customizations. The session will help you understand customization scenarios and use cases, tools, and technologies to ensure that your Oracle E-Business Suite Release 12.1 environment fits your users’ needs closely and that any future customizations will be easy to upgrade. CON9259 - Oracle E-Business Suite Internationalization and Multilingual FeaturesMaher Al-Nubani, Oracle Wednesday, Oct 3, 10:15 AM - 11:15 AM - Moscone West 2018 Oracle E-Business Suite supports more countries, languages, and regions than ever. Come to this Oracle development session to get an overview of internationalization features and capabilities and see new Release 12 features such as calendar support for Hijra and Thai, new group separators, lightweight multilingual support (MLS) setup, new character sets such as AL32UTF, newly supported languages, Mac certifications, Oracle iSetup support for moving MLS setups, new file export options for Unicode, new MLS number spelling options, and more. CON7188 - Mobile Apps for Oracle E-Business Suite with Oracle ADF Mobile and Oracle SOA SuiteSrikant Subramaniam, Joe Huang, Veshaal Singh, Oracle Wednesday, Oct 3, 10:15 AM - 11:15 AM - Moscone West 3001 Follow your mobile customers, employees, and partners with Oracle Fusion Middleware. See how native iPhone and iPad applications can easily be built for Oracle E-Business Suite with the new Oracle ADF Mobile and Oracle SOA Suite. Using Oracle ADF Mobile, developers can quickly develop native applications for Apple iOS and other mobile platforms. The Oracle SOA Suite/Oracle ADF Mobile combination can execute business transactions on Oracle E-Business Suite. This session includes a demo in which a mobile user approves a business transaction in Oracle E-Business Suite and a demo of the tools used to build a native on-device solution. These concepts for mobile applications also apply to other Oracle applications.CON9029 - Oracle E-Business Suite Directions: Slashing Downtimes with Online PatchingKevin Hudson, Oracle Wednesday, Oct 3, 11:45 AM - 12:45 PM - Moscone West 2016 Oracle E-Business Suite will soon include online patching (based on the Oracle Database 11g Release 2 Edition-Based Redefinition feature), which will reduce your database patching downtimes to however long it takes to bounce your database server. This Oracle development session details how online patching works, with special attention to what’s happening at a database object level when database patches are applied to an Oracle E-Business Suite environment that’s still running. Come learn about the operational and system management implications for minimizing maintenance downtimes when applying database patches with this new technology and the related impact on customizations you might have built on top of Oracle E-Business Suite. CON8806 - Upgrading to Oracle E-Business Suite 12.1: Technical and Functional PanelAndrew Katz, Komori America Corporation; Sandra Vucinic, VLAD Group, Inc. ;Srini Chavali, Cummins Inc.; Amrita Mehrok, Nadia Bendjedou, Anne Carlson Oracle Wednesday, Oct 3, 1:15 PM - 2:15 PM - Moscone West 2018 In this panel discussion, Oracle experts, customers, and partners share their experiences in upgrading to the latest release of Oracle E-Business Suite, Release 12.1. The panelists cover aspects of a typical Release 12 upgrade, technical (upgrading the technical infrastructure) as well as functional (upgrading to the new financial infrastructure). Hear directly from the experts who either develop the product or support, implement, or upgrade it, and find out how to apply their lessons learned to your organization. CON9027 - Personalize and Extend Oracle E-Business Suite Applications with Rich MashupsGustavo Jimenez, Padmaprabodh Ambale, Oracle Wednesday, Oct 3, 1:15 PM - 2:15 PM - Moscone West 2016 This session covers the use of several Oracle Fusion Middleware technologies to personalize and extend your existing Oracle E-Business Suite applications. The Oracle Fusion Middleware technologies covered include Oracle Application Development Framework (Oracle ADF), Oracle WebCenter, Oracle Endeca applications, and Oracle Business Intelligence Enterprise Edition with Oracle E-Business Suite Oracle Application Framework applications. CON9036 - Advanced Oracle E-Business Suite Architectures: Maximum Availability, Security, and MoreElke Phelps, Oracle Wednesday, Oct 3, 3:30 PM - 4:30 PM - Moscone West 2016 This session includes architecture diagrams and configuration instructions for building a maximum availability architecture (MAA) that will help you design a disaster recovery solution that fits the needs of your business. Database and application high-availability features it describes include Oracle Data Guard, Oracle Real Application Clusters (Oracle RAC), Oracle Active Data Guard, load-balancing Web and forms services, parallel concurrent processing, and the use of Oracle Exalogic and Oracle Exadata to provide a highly available environment. The session also covers the latest updates to systems management tools, AutoConfig, cloud computing, virtualization, and Oracle WebLogic Server and provides sneak previews of upcoming functionality. CON9047 - Efficiently Scaling Oracle E-Business Suite on Oracle Exadata and Oracle ExalogicIsam Alyousfi, Nishit Rao, Oracle Wednesday, Oct 3, 5:00 PM - 6:00 PM - Moscone West 2016 Oracle Exadata and Oracle Exalogic are designed from the ground up with optimizations in software and hardware to deliver superfast performance for mission-critical applications such as Oracle E-Business Suite. Oracle E-Business Suite applications run three to eight times as fast on the Oracle Exadata/Oracle Exalogic platform in standard benchmark tests. Besides performance, customers benefit from simplified support, enhanced manageability, and the ability to consolidate multiple Oracle E-Business Suite instances. Attend this session to understand best practices for Oracle E-Business Suite deployment on Oracle Exalogic and Oracle Exadata through customer case studies. Learn how adopting the Exa* platform increases efficiency, simplifies scaling, and boosts performance for peak loads. CON8716 - Web Services and SOA Integration Options for Oracle E-Business SuiteRekha Ayothi, Veshaal Singh, Oracle Thursday, Oct 4, 11:15 AM - 12:15 PM - Moscone West 2016 This Oracle development session provides a deep dive into a subset of the Web services and SOA-related integration options available to Oracle E-Business Suite systems integrators. It offers a technical look at Oracle E-Business Suite Integrated SOA Gateway, Oracle SOA Suite, Oracle Application Adapters for Data Integration for Oracle E-Business Suite, and other Web services options for integrating Oracle E-Business Suite with other applications. Systems integrators and developers will get an overview of the latest integration capabilities and technologies available out of the box with Oracle E-Business Suite and possibly a sneak preview of upcoming functionality and features. CON9030 - Recommendations for Oracle E-Business Suite Performance TuningIsam Alyousfi, Samer Barakat, Oracle Thursday, Oct 4, 11:15 AM - 12:15 PM - Moscone West 2018 Need to squeeze more performance out of your existing servers? This packed Oracle development session summarizes practical tips and lessons learned from performance-tuning and benchmarking the world’s largest Oracle E-Business Suite environments. Apps sysadmins will learn concrete tips and techniques for identifying and resolving performance bottlenecks on all layers, with special attention to application- and database-tier servers. Learn about tuning Oracle Forms, Oracle Concurrent Manager, Apache, and Oracle Discoverer. Track down memory leaks and other issues at the Java and JVM layers. The session also covers Oracle E-Business Suite product-level tuning, including Oracle Workflow, Oracle Order Management, Oracle Payroll, and other modules. CON3429 - Using Oracle ADF with Oracle E-Business Suite: The Full Integration ViewSiva Puthurkattil, Lake County; Juan Camilo Ruiz, Sara Woodhull, Oracle Thursday, Oct 4, 11:15 AM - 12:15 PM - Moscone West 3003 Oracle E-Business Suite delivers functionality for handling the core business of your organization. However, user requirements and new technologies are driving an emerging need to implement new types of user interfaces for these applications. This session provides an overview of how to use Oracle Application Development Framework (Oracle ADF) to deliver cutting-edge Web 2.0 and mobile rich user interfaces that front existing Oracle E-Business Suite processes, and it also explores all the existing types of integration between the two worlds. CON9020 - Integrating Oracle E-Business Suite with Oracle Identity Management SolutionsSunil Ghosh, Elke Phelps, Oracle Thursday, Oct 4, 12:45 PM - 1:45 PM - Moscone West 2016 Need to integrate Oracle E-Business Suite with Microsoft Windows Kerberos, Active Directory, CA Netegrity SiteMinder, or other third-party authentication systems? Want to understand your options when Oracle Premier Support for Oracle Single Sign-On ends in December 2011? This Oracle Development session covers the latest certified integrations with Oracle Access Manager 11g and Oracle Internet Directory 11g, which can be used individually or as bridges for integrating with third-party authentication solutions. The session presents an architectural overview of how Oracle Access Manager, its WebGate and AccessGate components, and Oracle Internet Directory work together, with implications for Oracle Discoverer, Oracle Portal, and other Oracle Fusion identity management products. CON9019 - Troubleshooting, Diagnosing, and Optimizing Oracle E-Business Suite TechnologyGustavo Jimenez, Oracle Thursday, Oct 4, 2:15 PM - 3:15 PM - Moscone West 2016 This session covers how you can proactively diagnose Oracle E-Business Suite applications, including extensions built with Oracle Fusion Middleware technologies such as Oracle Application Development Framework (Oracle ADF) and Oracle WebCenter to catch potential issues in the middle tier before they become more serious. Topics include debugging, logging infrastructure, warning signs, performance tuning, information required when logging service requests, general JVM optimization, and an overall picture of all the moving parts that make it possible for Oracle E-Business Suite to isolate and fix problems. Also learn how Oracle Diagnostics Framework will help prevent downtime caused by failures. CON9031 - The Top 10 Things You Can Do to Secure Your Oracle E-Business Suite InstanceEric Bing, Erik Graversen, Oracle Thursday, Oct 4, 2:15 PM - 3:15 PM - Moscone West 2018 Learn the top 10 things you can do to secure your applications and your sensitive data. This Oracle development session for system administrators and security professionals explores some of the most important and overlooked things you can do to secure your Oracle E-Business Suite instance. It also covers data masking and other mechanisms for protecting sensitive data. Special Interest Groups (SIG) Some of our most senior staff have been invited to participate on the following SIG meetings as guest speakers: SIG10525 - OAUG - Archive & Purge SIGBrian Bent - Pre-Sales Engineer, TierData, Inc. Sunday, Sep 30, 10:30 AM - 12:00 PM - Moscone West 3011 The Archive and Purge SIG is an organization in which users can share their experiences and solicit functional and technical advice on archiving and purging data in Oracle E-Business Suite. This session provides an opportunity for users to network and share best practices, tips, and tricks. Guest: Oracle E-Business Suite Database Performance, Archive & Purging - Q&A SessionIsam Alyousfi, Senior Director, Applications Performance, Oracle SIG10547 - OAUG - Oracle E-Business (EBS) Applications Technology SIGSrini Chavali - IT Director, Cummins Inc Sunday, Sep 30, 10:30 AM - 12:00 PM - Moscone West 3018 The general purpose of the EBS Applications Technology SIG is to inform and educate its members about current and future components of the tech stack as they relate to Oracle E-Business Suite. Attend this meeting for networking and education and to share best practices. Guest: Oracle E-Business Suite Technology Certification Roadmap - Presentation and Q&ASteven Chan, Sr. Director, Applications Technology Group, Oracle SIG10559 - OAUG - User Management SIGSusan Behn - VP of Oracle Delivery, Infosemantics, Inc. Sunday, Sep 30, 10:30 AM - 12:00 PM - Moscone West 3024 The E-Business Suite User Management SIG focuses on the components of user management that enable Oracle E-Business Suite users to define administrative functions and manage users’ access to functions and data based on roles within an organization—rather than the user’s individual identity—which is referred to as role-based access control (RBAC). This meeting includes an introduction to Oracle User Management that covers the Oracle User Management building blocks and presents an example of creating a security policy.Guest: Security and User Management - Q&A SessionEric Bing, Sr. Director, EBS Security, OracleSara Woodhull, Principal Product Manager, Applications Technology Group, Oracle SIG10515 - OAUG – Upgrade SIGBarbara Matthews - Consultant, On Call DBASandra Vucinic, VLAD Group, Inc. Sunday, Sep 30, 12:00 PM - 2:00 PM - Moscone West 3009 This Upgrade SIG session starts with a business meeting and then features a Q&A panel discussion on Oracle E-Business Suite upgrade topics. The session• Reviews Upgrade SIG goals and objectives• Provides answers, during the Q&A session, to questions related to Oracle E-Business Suite upgrades• Shares “real world” experiences, tips, and techniques for Oracle E-Business Suite upgrades to Release 12.1. Guest: Oracle E-Business Suite Upgrade - Q&A SessionAnne Carlson - Sr. Director, Oracle E-Business Suite Product Strategy, OracleUdayan Parvate - Director, EBS Release Engineering, OracleSuzana Ferrari, Sr. Principal Consultant, OracleIsam Alyousfi, Sr. Director, Applications Performance, Oracle SIG10552 - OAUG - Oracle E-Business Suite SIGDonna Rosentrater - Manager, Global Sourcing & Procurement Systems, TJX Sunday, Sep 30, 12:15 PM - 1:45 PM - Moscone West 3020 The E-Business Suite SIG, affiliated with OAUG, supports Oracle E-Business Suite users through networking, education, and sharing of best practices. This SIG meeting will feature a general discussion of Oracle E-Business Suite product strategies in Release 12 and migration to Oracle Fusion Applications. Guest: Oracle E-Business Suite - Q&A SessionJeanne Lowell, Vice President, EBS Product Strategy, OracleNadia Bendjedou, Sr. Director, Product Strategy, Oracle SIG10556 - OAUG - SysAdmin SIGRandy Giefer - Sr Systems and Security Architect, Solution Beacon, LLC Sunday, Sep 30, 12:15 PM - 1:45 PM - Moscone West 3022 The SysAdmin SIG provides a forum in which OAUG members and participants can share updates, tips, and successful practices relating to system administration in an Oracle applications environment. The SysAdmin SIG strives to enable system administrators to become more effective and efficient in their jobs by providing them with access to people and information that can increase their system administration knowledge and experience. Attend this meeting to network, share best practices, and benefit from educational content. Guest: Oracle E-Business Suite 12.2 Online Patching- Presentation and Q&AKevin Hudson, Sr. Director, Applications Technology Group, Oracle SIG10553 - OAUG - Database SIGMichael Brown - Senior DBA, COLIBRI LTD LC Sunday, Sep 30, 2:00 PM - 3:15 PM - Moscone West 3020 The OAUG Database SIG provides an opportunity for applications database administrators to learn from and share their experiences with supporting the various Oracle applications environments. This session will include a brief business meeting followed by a short presentation. It will end with an open discussion among the attendees about items of interest to those present. Guest: Oracle E-Business Suite Database Performance - Presentation and Q&AIsam Alyousfi, Sr. Director, Applications Performance, Oracle Meet the Experts We're planning two round-table discussions where you can review your questions with senior E-Business Suite ATG staff: MTE9648 - Meet the Experts for Oracle E-Business Suite: Planning Your Upgrade Jeanne Lowell - VP, EBS Product Strategy, Oracle John Abraham - Sr. Principal Product Manager, Oracle Nadia Bendjedou - Sr. Director - Product Strategy, Oracle Anne Carlson - Sr. Director, Applications Technology Group, Oracle Udayan Parvate - Director, EBS Release Engineering, Oracle Isam Alyousfi, Sr. Director, Applications Performance, Oracle Monday, Oct 1, 3:15 PM - 4:15 PM - Moscone West 2001A Don’t miss this Oracle Applications Meet the Experts session with experts who specialize in Oracle E-Business Suite upgrade best practices. This is the place where attendees can have informal and semistructured but open one-on-one discussions with Strategy and Development regarding Oracle Applications strategy and your specific business and IT strategy. The experts will be available to discuss the value of the latest releases and share insights into the best path for your enterprise, so come ready with your questions. Space is limited, so make sure you register. MTE9649 - Meet the Oracle E-Business Suite Tools and Technology Experts Lisa Parekh - Vice President, Technology Integration, Oracle Steven Chan - Sr. Director, Oracle Elke Phelps - Sr. Principal Product Manager, Applications Technology Group, Oracle Max Arderius - Manager, Applications Technology Group, Oracle Tuesday, Oct 2, 1:15 PM - 2:15 PM - Moscone West 2001A Don’t miss this Oracle Applications Meet the Experts session with experts who specialize in Oracle E-Business Suite technology. This is the place where attendees can have informal and semistructured but open one-on-one discussions with Strategy and Development regarding Oracle Applications strategy and your specific business and IT strategy. The experts will be available to discuss the value of the latest releases and share insights into the best path for your enterprise, so come ready with your questions. Space is limited, so make sure you register. Demos We have five booths in the exhibition demogrounds this year, where you can try ATG technologies firsthand and get your questions answered. Please stop by and meet our staff at the following locations: Advanced Architecture and Technology Stack for Oracle E-Business Suite (W-067) New User Productivity Capabilities in Oracle E-Business Suite (W-065) End-to-End Management of Oracle E-Business Suite (W-063) Oracle E-Business Suite 12.1 Technical Upgrade Best Practices (W-066) SOA-Based Integration for Oracle E-Business Suite (W-064)

  Read the article

• Node.js Adventure - When Node Flying in Wind

  - by Shaun

  In the first post of this series I mentioned some popular modules in the community, such as underscore, async, etc.. I also listed a module named “Wind (zh-CN)”, which is created by one of my friend, Jeff Zhao (zh-CN). Now I would like to use a separated post to introduce this module since I feel it brings a new async programming style in not only Node.js but JavaScript world. If you know or heard about the new feature in C# 5.0 called “async and await”, or you learnt F#, you will find the “Wind” brings the similar async programming experience in JavaScript. By using “Wind”, we can write async code that looks like the sync code. The callbacks, async stats and exceptions will be handled by “Wind” automatically and transparently.   What’s the Problem: Dense “Callback” Phobia Let’s firstly back to my second post in this series. As I mentioned in that post, when we wanted to read some records from SQL Server we need to open the database connection, and then execute the query. In Node.js all IO operation are designed as async callback pattern which means when the operation was done, it will invoke a function which was taken from the last parameter. For example the database connection opening code would be like this. 1: sql.open(connectionString, function(error, conn) { 2: if(error) { 3: // some error handling code 4: } 5: else { 6: // connection opened successfully 7: } 8: }); And then if we need to query the database the code would be like this. It nested in the previous function. 1: sql.open(connectionString, function(error, conn) { 2: if(error) { 3: // some error handling code 4: } 5: else { 6: // connection opened successfully 7: conn.queryRaw(command, function(error, results) { 8: if(error) { 9: // failed to execute this command 10: } 11: else { 12: // records retrieved successfully 13: } 14: }; 15: } 16: }); Assuming if we need to copy some data from this database to another then we need to open another connection and execute the command within the function under the query function. 1: sql.open(connectionString, function(error, conn) { 2: if(error) { 3: // some error handling code 4: } 5: else { 6: // connection opened successfully 7: conn.queryRaw(command, function(error, results) { 8: if(error) { 9: // failed to execute this command 10: } 11: else { 12: // records retrieved successfully 13: target.open(targetConnectionString, function(error, t_conn) { 14: if(error) { 15: // connect failed 16: } 17: else { 18: t_conn.queryRaw(copy_command, function(error, results) { 19: if(error) { 20: // copy failed 21: } 22: else { 23: // and then, what do you want to do now... 24: } 25: }; 26: } 27: }; 28: } 29: }; 30: } 31: }); This is just an example. In the real project the logic would be more complicated. This means our application might be messed up and the business process will be fragged by many callback functions. I would like call this “Dense Callback Phobia”. This might be a challenge how to make code straightforward and easy to read, something like below. 1: try 2: { 3: // open source connection 4: var s_conn = sqlConnect(s_connectionString); 5: // retrieve data 6: var results = sqlExecuteCommand(s_conn, s_command); 7: 8: // open target connection 9: var t_conn = sqlConnect(t_connectionString); 10: // prepare the copy command 11: var t_command = getCopyCommand(results); 12: // execute the copy command 13: sqlExecuteCommand(s_conn, t_command); 14: } 15: catch (ex) 16: { 17: // error handling 18: }   What’s the Problem: Sync-styled Async Programming Similar as the previous problem, the callback-styled async programming model makes the upcoming operation as a part of the current operation, and mixed with the error handling code. So it’s very hard to understand what on earth this code will do. And since Node.js utilizes non-blocking IO mode, we cannot invoke those operations one by one, as they will be executed concurrently. For example, in this post when I tried to copy the records from Windows Azure SQL Database (a.k.a. WASD) to Windows Azure Table Storage, if I just insert the data into table storage one by one and then print the “Finished” message, I will see the message shown before the data had been copied. This is because all operations were executed at the same time. In order to make the copy operation and print operation executed synchronously I introduced a module named “async” and the code was changed as below. 1: async.forEach(results.rows, 2: function (row, callback) { 3: var resource = { 4: "PartitionKey": row[1], 5: "RowKey": row[0], 6: "Value": row[2] 7: }; 8: client.insertEntity(tableName, resource, function (error) { 9: if (error) { 10: callback(error); 11: } 12: else { 13: console.log("entity inserted."); 14: callback(null); 15: } 16: }); 17: }, 18: function (error) { 19: if (error) { 20: error["target"] = "insertEntity"; 21: res.send(500, error); 22: } 23: else { 24: console.log("all done."); 25: res.send(200, "Done!"); 26: } 27: }); It ensured that the “Finished” message will be printed when all table entities had been inserted. But it cannot promise that the records will be inserted in sequence. It might be another challenge to make the code looks like in sync-style? 1: try 2: { 3: forEach(row in rows) { 4: var entity = { /* ... */ }; 5: tableClient.insert(tableName, entity); 6: } 7:  8: console.log("Finished"); 9: } 10: catch (ex) { 11: console.log(ex); 12: }   How “Wind” Helps “Wind” is a JavaScript library which provides the control flow with plain JavaScript for asynchronous programming (and more) without additional pre-compiling steps. It’s available in NPM so that we can install it through “npm install wind”. Now let’s create a very simple Node.js application as the example. This application will take some website URLs from the command arguments and tried to retrieve the body length and print them in console. Then at the end print “Finish”. I’m going to use “request” module to make the HTTP call simple so I also need to install by the command “npm install request”. The code would be like this. 1: var request = require("request"); 2:  3: // get the urls from arguments, the first two arguments are `node.exe` and `fetch.js` 4: var args = process.argv.splice(2); 5:  6: // main function 7: var main = function() { 8: for(var i = 0; i < args.length; i++) { 9: // get the url 10: var url = args[i]; 11: // send the http request and try to get the response and body 12: request(url, function(error, response, body) { 13: if(!error && response.statusCode == 200) { 14: // log the url and the body length 15: console.log( 16: "%s: %d.", 17: response.request.uri.href, 18: body.length); 19: } 20: else { 21: // log error 22: console.log(error); 23: } 24: }); 25: } 26: 27: // finished 28: console.log("Finished"); 29: }; 30:  31: // execute the main function 32: main(); Let’s execute this application. (I made them in multi-lines for better reading.) 1: node fetch.js 2: "http://www.igt.com/us-en.aspx" 3: "http://www.igt.com/us-en/games.aspx" 4: "http://www.igt.com/us-en/cabinets.aspx" 5: "http://www.igt.com/us-en/systems.aspx" 6: "http://www.igt.com/us-en/interactive.aspx" 7: "http://www.igt.com/us-en/social-gaming.aspx" 8: "http://www.igt.com/support.aspx" Below is the output. As you can see the finish message was printed at the beginning, and the pages’ length retrieved in a different order than we specified. This is because in this code the request command, console logging command are executed asynchronously and concurrently. Now let’s introduce “Wind” to make them executed in order, which means it will request the websites one by one, and print the message at the end.   First of all we need to import the “Wind” package and make sure the there’s only one global variant named “Wind”, and ensure it’s “Wind” instead of “wind”. 1: var Wind = require("wind");   Next, we need to tell “Wind” which code will be executed asynchronously so that “Wind” can control the execution process. In this case the “request” operation executed asynchronously so we will create a “Task” by using a build-in helps function in “Wind” named Wind.Async.Task.create. 1: var requestBodyLengthAsync = function(url) { 2: return Wind.Async.Task.create(function(t) { 3: request(url, function(error, response, body) { 4: if(error || response.statusCode != 200) { 5: t.complete("failure", error); 6: } 7: else { 8: var data = 9: { 10: uri: response.request.uri.href, 11: length: body.length 12: }; 13: t.complete("success", data); 14: } 15: }); 16: }); 17: }; The code above created a “Task” from the original request calling code. In “Wind” a “Task” means an operation will be finished in some time in the future. A “Task” can be started by invoke its start() method, but no one knows when it actually will be finished. The Wind.Async.Task.create helped us to create a task. The only parameter is a function where we can put the actual operation in, and then notify the task object it’s finished successfully or failed by using the complete() method. In the code above I invoked the request method. If it retrieved the response successfully I set the status of this task as “success” with the URL and body length. If it failed I set this task as “failure” and pass the error out.   Next, we will change the main() function. In “Wind” if we want a function can be controlled by Wind we need to mark it as “async”. This should be done by using the code below. 1: var main = eval(Wind.compile("async", function() { 2: })); When the application is running, Wind will detect “eval(Wind.compile(“async”, function” and generate an anonymous code from the body of this original function. Then the application will run the anonymous code instead of the original one. In our example the main function will be like this. 1: var main = eval(Wind.compile("async", function() { 2: for(var i = 0; i < args.length; i++) { 3: try 4: { 5: var result = $await(requestBodyLengthAsync(args[i])); 6: console.log( 7: "%s: %d.", 8: result.uri, 9: result.length); 10: } 11: catch (ex) { 12: console.log(ex); 13: } 14: } 15: 16: console.log("Finished"); 17: })); As you can see, when I tried to request the URL I use a new command named “$await”. It tells Wind, the operation next to $await will be executed asynchronously, and the main thread should be paused until it finished (or failed). So in this case, my application will be pause when the first response was received, and then print its body length, then try the next one. At the end, print the finish message.   Finally, execute the main function. The full code would be like this. 1: var request = require("request"); 2: var Wind = require("wind"); 3:  4: var args = process.argv.splice(2); 5:  6: var requestBodyLengthAsync = function(url) { 7: return Wind.Async.Task.create(function(t) { 8: request(url, function(error, response, body) { 9: if(error || response.statusCode != 200) { 10: t.complete("failure", error); 11: } 12: else { 13: var data = 14: { 15: uri: response.request.uri.href, 16: length: body.length 17: }; 18: t.complete("success", data); 19: } 20: }); 21: }); 22: }; 23:  24: var main = eval(Wind.compile("async", function() { 25: for(var i = 0; i < args.length; i++) { 26: try 27: { 28: var result = $await(requestBodyLengthAsync(args[i])); 29: console.log( 30: "%s: %d.", 31: result.uri, 32: result.length); 33: } 34: catch (ex) { 35: console.log(ex); 36: } 37: } 38: 39: console.log("Finished"); 40: })); 41:  42: main().start();   Run our new application. At the beginning we will see the compiled and generated code by Wind. Then we can see the pages were requested one by one, and at the end the finish message was printed. Below is the code Wind generated for us. As you can see the original code, the output code were shown. 1: // Original: 2: function () { 3: for(var i = 0; i < args.length; i++) { 4: try 5: { 6: var result = $await(requestBodyLengthAsync(args[i])); 7: console.log( 8: "%s: %d.", 9: result.uri, 10: result.length); 11: } 12: catch (ex) { 13: console.log(ex); 14: } 15: } 16: 17: console.log("Finished"); 18: } 19:  20: // Compiled: 21: /* async << function () { */ (function () { 22: var _builder_$0 = Wind.builders["async"]; 23: return _builder_$0.Start(this, 24: _builder_$0.Combine( 25: _builder_$0.Delay(function () { 26: /* var i = 0; */ var i = 0; 27: /* for ( */ return _builder_$0.For(function () { 28: /* ; i < args.length */ return i < args.length; 29: }, function () { 30: /* ; i ++) { */ i ++; 31: }, 32: /* try { */ _builder_$0.Try( 33: _builder_$0.Delay(function () { 34: /* var result = $await(requestBodyLengthAsync(args[i])); */ return _builder_$0.Bind(requestBodyLengthAsync(args[i]), function (result) { 35: /* console.log("%s: %d.", result.uri, result.length); */ console.log("%s: %d.", result.uri, result.length); 36: return _builder_$0.Normal(); 37: }); 38: }), 39: /* } catch (ex) { */ function (ex) { 40: /* console.log(ex); */ console.log(ex); 41: return _builder_$0.Normal(); 42: /* } */ }, 43: null 44: ) 45: /* } */ ); 46: }), 47: _builder_$0.Delay(function () { 48: /* console.log("Finished"); */ console.log("Finished"); 49: return _builder_$0.Normal(); 50: }) 51: ) 52: ); 53: /* } */ })   How Wind Works Someone may raise a big concern when you find I utilized “eval” in my code. Someone may assume that Wind utilizes “eval” to execute some code dynamically while “eval” is very low performance. But I would say, Wind does NOT use “eval” to run the code. It only use “eval” as a flag to know which code should be compiled at runtime. When the code was firstly been executed, Wind will check and find “eval(Wind.compile(“async”, function”. So that it knows this function should be compiled. Then it utilized parse-js to analyze the inner JavaScript and generated the anonymous code in memory. Then it rewrite the original code so that when the application was running it will use the anonymous one instead of the original one. Since the code generation was done at the beginning of the application was started, in the future no matter how long our application runs and how many times the async function was invoked, it will use the generated code, no need to generate again. So there’s no significant performance hurt when using Wind.   Wind in My Previous Demo Let’s adopt Wind into one of my previous demonstration and to see how it helps us to make our code simple, straightforward and easy to read and understand. In this post when I implemented the functionality that copied the records from my WASD to table storage, the logic would be like this. 1, Open database connection. 2, Execute a query to select all records from the table. 3, Recreate the table in Windows Azure table storage. 4, Create entities from each of the records retrieved previously, and then insert them into table storage. 5, Finally, show message as the HTTP response. But as the image below, since there are so many callbacks and async operations, it’s very hard to understand my logic from the code. Now let’s use Wind to rewrite our code. First of all, of course, we need the Wind package. Then we need to include the package files into project and mark them as “Copy always”. Add the Wind package into the source code. Pay attention to the variant name, you must use “Wind” instead of “wind”. 1: var express = require("express"); 2: var async = require("async"); 3: var sql = require("node-sqlserver"); 4: var azure = require("azure"); 5: var Wind = require("wind"); Now we need to create some async functions by using Wind. All async functions should be wrapped so that it can be controlled by Wind which are open database, retrieve records, recreate table (delete and create) and insert entity in table. Below are these new functions. All of them are created by using Wind.Async.Task.create. 1: sql.openAsync = function (connectionString) { 2: return Wind.Async.Task.create(function (t) { 3: sql.open(connectionString, function (error, conn) { 4: if (error) { 5: t.complete("failure", error); 6: } 7: else { 8: t.complete("success", conn); 9: } 10: }); 11: }); 12: }; 13:  14: sql.queryAsync = function (conn, query) { 15: return Wind.Async.Task.create(function (t) { 16: conn.queryRaw(query, function (error, results) { 17: if (error) { 18: t.complete("failure", error); 19: } 20: else { 21: t.complete("success", results); 22: } 23: }); 24: }); 25: }; 26:  27: azure.recreateTableAsync = function (tableName) { 28: return Wind.Async.Task.create(function (t) { 29: client.deleteTable(tableName, function (error, successful, response) { 30: console.log("delete table finished"); 31: client.createTableIfNotExists(tableName, function (error, successful, response) { 32: console.log("create table finished"); 33: if (error) { 34: t.complete("failure", error); 35: } 36: else { 37: t.complete("success", null); 38: } 39: }); 40: }); 41: }); 42: }; 43:  44: azure.insertEntityAsync = function (tableName, entity) { 45: return Wind.Async.Task.create(function (t) { 46: client.insertEntity(tableName, entity, function (error, entity, response) { 47: if (error) { 48: t.complete("failure", error); 49: } 50: else { 51: t.complete("success", null); 52: } 53: }); 54: }); 55: }; Then in order to use these functions we will create a new function which contains all steps for data copying. 1: var copyRecords = eval(Wind.compile("async", function (req, res) { 2: try { 3: } 4: catch (ex) { 5: console.log(ex); 6: res.send(500, "Internal error."); 7: } 8: })); Let’s execute steps one by one with the “$await” keyword introduced by Wind so that it will be invoked in sequence. First is to open the database connection. 1: var copyRecords = eval(Wind.compile("async", function (req, res) { 2: try { 3: // connect to the windows azure sql database 4: var conn = $await(sql.openAsync(connectionString)); 5: console.log("connection opened"); 6: } 7: catch (ex) { 8: console.log(ex); 9: res.send(500, "Internal error."); 10: } 11: })); Then retrieve all records from the database connection. 1: var copyRecords = eval(Wind.compile("async", function (req, res) { 2: try { 3: // connect to the windows azure sql database 4: var conn = $await(sql.openAsync(connectionString)); 5: console.log("connection opened"); 6: // retrieve all records from database 7: var results = $await(sql.queryAsync(conn, "SELECT * FROM [Resource]")); 8: console.log("records selected. count = %d", results.rows.length); 9: } 10: catch (ex) { 11: console.log(ex); 12: res.send(500, "Internal error."); 13: } 14: })); After recreated the table, we need to create the entities and insert them into table storage. 1: var copyRecords = eval(Wind.compile("async", function (req, res) { 2: try { 3: // connect to the windows azure sql database 4: var conn = $await(sql.openAsync(connectionString)); 5: console.log("connection opened"); 6: // retrieve all records from database 7: var results = $await(sql.queryAsync(conn, "SELECT * FROM [Resource]")); 8: console.log("records selected. count = %d", results.rows.length); 9: if (results.rows.length > 0) { 10: // recreate the table 11: $await(azure.recreateTableAsync(tableName)); 12: console.log("table created"); 13: // insert records in table storage one by one 14: for (var i = 0; i < results.rows.length; i++) { 15: var entity = { 16: "PartitionKey": results.rows[i][1], 17: "RowKey": results.rows[i][0], 18: "Value": results.rows[i][2] 19: }; 20: $await(azure.insertEntityAsync(tableName, entity)); 21: console.log("entity inserted"); 22: } 23: } 24: } 25: catch (ex) { 26: console.log(ex); 27: res.send(500, "Internal error."); 28: } 29: })); Finally, send response back to the browser. 1: var copyRecords = eval(Wind.compile("async", function (req, res) { 2: try { 3: // connect to the windows azure sql database 4: var conn = $await(sql.openAsync(connectionString)); 5: console.log("connection opened"); 6: // retrieve all records from database 7: var results = $await(sql.queryAsync(conn, "SELECT * FROM [Resource]")); 8: console.log("records selected. count = %d", results.rows.length); 9: if (results.rows.length > 0) { 10: // recreate the table 11: $await(azure.recreateTableAsync(tableName)); 12: console.log("table created"); 13: // insert records in table storage one by one 14: for (var i = 0; i < results.rows.length; i++) { 15: var entity = { 16: "PartitionKey": results.rows[i][1], 17: "RowKey": results.rows[i][0], 18: "Value": results.rows[i][2] 19: }; 20: $await(azure.insertEntityAsync(tableName, entity)); 21: console.log("entity inserted"); 22: } 23: // send response 24: console.log("all done"); 25: res.send(200, "All done!"); 26: } 27: } 28: catch (ex) { 29: console.log(ex); 30: res.send(500, "Internal error."); 31: } 32: })); If we compared with the previous code we will find now it became more readable and much easy to understand. It’s very easy to know what this function does even though without any comments. When user go to URL “/was/copyRecords” we will execute the function above. The code would be like this. 1: app.get("/was/copyRecords", function (req, res) { 2: copyRecords(req, res).start(); 3: }); And below is the logs printed in local compute emulator console. As we can see the functions executed one by one and then finally the response back to me browser.   Scaffold Functions in Wind Wind provides not only the async flow control and compile functions, but many scaffold methods as well. We can build our async code more easily by using them. I’m going to introduce some basic scaffold functions here. In the code above I created some functions which wrapped from the original async function such as open database, create table, etc.. All of them are very similar, created a task by using Wind.Async.Task.create, return error or result object through Task.complete function. In fact, Wind provides some functions for us to create task object from the original async functions. If the original async function only has a callback parameter, we can use Wind.Async.Binding.fromCallback method to get the task object directly. For example the code below returned the task object which wrapped the file exist check function. 1: var Wind = require("wind"); 2: var fs = require("fs"); 3:  4: fs.existsAsync = Wind.Async.Binding.fromCallback(fs.exists); In Node.js a very popular async function pattern is that, the first parameter in the callback function represent the error object, and the other parameters is the return values. In this case we can use another build-in function in Wind named Wind.Async.Binding.fromStandard. For example, the open database function can be created from the code below. 1: sql.openAsync = Wind.Async.Binding.fromStandard(sql.open); 2:  3: /* 4: sql.openAsync = function (connectionString) { 5: return Wind.Async.Task.create(function (t) { 6: sql.open(connectionString, function (error, conn) { 7: if (error) { 8: t.complete("failure", error); 9: } 10: else { 11: t.complete("success", conn); 12: } 13: }); 14: }); 15: }; 16: */ When I was testing the scaffold functions under Wind.Async.Binding I found for some functions, such as the Azure SDK insert entity function, cannot be processed correctly. So I personally suggest writing the wrapped method manually.   Another scaffold method in Wind is the parallel tasks coordination. In this example, the steps of open database, retrieve records and recreated table should be invoked one by one, but it can be executed in parallel when copying data from database to table storage. In Wind there’s a scaffold function named Task.whenAll which can be used here. Task.whenAll accepts a list of tasks and creates a new task. It will be returned only when all tasks had been completed, or any errors occurred. For example in the code below I used the Task.whenAll to make all copy operation executed at the same time. 1: var copyRecordsInParallel = eval(Wind.compile("async", function (req, res) { 2: try { 3: // connect to the windows azure sql database 4: var conn = $await(sql.openAsync(connectionString)); 5: console.log("connection opened"); 6: // retrieve all records from database 7: var results = $await(sql.queryAsync(conn, "SELECT * FROM [Resource]")); 8: console.log("records selected. count = %d", results.rows.length); 9: if (results.rows.length > 0) { 10: // recreate the table 11: $await(azure.recreateTableAsync(tableName)); 12: console.log("table created"); 13: // insert records in table storage in parallal 14: var tasks = new Array(results.rows.length); 15: for (var i = 0; i < results.rows.length; i++) { 16: var entity = { 17: "PartitionKey": results.rows[i][1], 18: "RowKey": results.rows[i][0], 19: "Value": results.rows[i][2] 20: }; 21: tasks[i] = azure.insertEntityAsync(tableName, entity); 22: } 23: $await(Wind.Async.Task.whenAll(tasks)); 24: // send response 25: console.log("all done"); 26: res.send(200, "All done!"); 27: } 28: } 29: catch (ex) { 30: console.log(ex); 31: res.send(500, "Internal error."); 32: } 33: })); 34:  35: app.get("/was/copyRecordsInParallel", function (req, res) { 36: copyRecordsInParallel(req, res).start(); 37: });   Besides the task creation and coordination, Wind supports the cancellation solution so that we can send the cancellation signal to the tasks. It also includes exception solution which means any exceptions will be reported to the caller function.   Summary In this post I introduced a Node.js module named Wind, which created by my friend Jeff Zhao. As you can see, different from other async library and framework, adopted the idea from F# and C#, Wind utilizes runtime code generation technology to make it more easily to write async, callback-based functions in a sync-style way. By using Wind there will be almost no callback, and the code will be very easy to understand. Currently Wind is still under developed and improved. There might be some problems but the author, Jeff, should be very happy and enthusiastic to learn your problems, feedback, suggestion and comments. You can contact Jeff by - Email: [email protected] - Group: https://groups.google.com/d/forum/windjs - GitHub: https://github.com/JeffreyZhao/wind/issues   Source code can be download here.   Hope this helps, Shaun All documents and related graphics, codes are provided "AS IS" without warranty of any kind. Copyright © Shaun Ziyan Xu. This work is licensed under the Creative Commons License.

  Read the article

• New features of C# 4.0

  This article covers New features of C# 4.0. Article has been divided into below sections. Introduction. Dynamic Lookup. Named and Optional Arguments. Features for COM interop. Variance. Relationship with Visual Basic. Resources. Other interested readings… 22 New Features of Visual Studio 2008 for .NET Professionals 50 New Features of SQL Server 2008 IIS 7.0 New features Introduction It is now close to a year since Microsoft Visual C# 3.0 shipped as part of Visual Studio 2008. In the VS Managed Languages team we are hard at work on creating the next version of the language (with the unsurprising working title of C# 4.0), and this document is a first public description of the planned language features as we currently see them. Please be advised that all this is in early stages of production and is subject to change. Part of the reason for sharing our plans in public so early is precisely to get the kind of feedback that will cause us to improve the final product before it rolls out. Simultaneously with the publication of this whitepaper, a first public CTP (community technology preview) of Visual Studio 2010 is going out as a Virtual PC image for everyone to try. Please use it to play and experiment with the features, and let us know of any thoughts you have. We ask for your understanding and patience working with very early bits, where especially new or newly implemented features do not have the quality or stability of a final product. The aim of the CTP is not to give you a productive work environment but to give you the best possible impression of what we are working on for the next release. The CTP contains a number of walkthroughs, some of which highlight the new language features of C# 4.0. Those are excellent for getting a hands-on guided tour through the details of some common scenarios for the features. You may consider this whitepaper a companion document to these walkthroughs, complementing them with a focus on the overall language features and how they work, as opposed to the specifics of the concrete scenarios. C# 4.0 The major theme for C# 4.0 is dynamic programming. Increasingly, objects are “dynamic” in the sense that their structure and behavior is not captured by a static type, or at least not one that the compiler knows about when compiling your program. Some examples include a. objects from dynamic programming languages, such as Python or Ruby b. COM objects accessed through IDispatch c. ordinary .NET types accessed through reflection d. objects with changing structure, such as HTML DOM objects While C# remains a statically typed language, we aim to vastly improve the interaction with such objects. A secondary theme is co-evolution with Visual Basic. Going forward we will aim to maintain the individual character of each language, but at the same time important new features should be introduced in both languages at the same time. They should be differentiated more by style and feel than by feature set. The new features in C# 4.0 fall into four groups: Dynamic lookup Dynamic lookup allows you to write method, operator and indexer calls, property and field accesses, and even object invocations which bypass the C# static type checking and instead gets resolved at runtime. Named and optional parameters Parameters in C# can now be specified as optional by providing a default value for them in a member declaration. When the member is invoked, optional arguments can be omitted. Furthermore, any argument can be passed by parameter name instead of position. COM specific interop features Dynamic lookup as well as named and optional parameters both help making programming against COM less painful than today. On top of that, however, we are adding a number of other small features that further improve the interop experience. Variance It used to be that an IEnumerable<string> wasn’t an IEnumerable<object>. Now it is – C# embraces type safe “co-and contravariance” and common BCL types are updated to take advantage of that. Dynamic Lookup Dynamic lookup allows you a unified approach to invoking things dynamically. With dynamic lookup, when you have an object in your hand you do not need to worry about whether it comes from COM, IronPython, the HTML DOM or reflection; you just apply operations to it and leave it to the runtime to figure out what exactly those operations mean for that particular object. This affords you enormous flexibility, and can greatly simplify your code, but it does come with a significant drawback: Static typing is not maintained for these operations. A dynamic object is assumed at compile time to support any operation, and only at runtime will you get an error if it wasn’t so. Oftentimes this will be no loss, because the object wouldn’t have a static type anyway, in other cases it is a tradeoff between brevity and safety. In order to facilitate this tradeoff, it is a design goal of C# to allow you to opt in or opt out of dynamic behavior on every single call. The dynamic type C# 4.0 introduces a new static type called dynamic. When you have an object of type dynamic you can “do things to it” that are resolved only at runtime: dynamic d = GetDynamicObject(…); d.M(7); The C# compiler allows you to call a method with any name and any arguments on d because it is of type dynamic. At runtime the actual object that d refers to will be examined to determine what it means to “call M with an int” on it. The type dynamic can be thought of as a special version of the type object, which signals that the object can be used dynamically. It is easy to opt in or out of dynamic behavior: any object can be implicitly converted to dynamic, “suspending belief” until runtime. Conversely, there is an “assignment conversion” from dynamic to any other type, which allows implicit conversion in assignment-like constructs: dynamic d = 7; // implicit conversion int i = d; // assignment conversion Dynamic operations Not only method calls, but also field and property accesses, indexer and operator calls and even delegate invocations can be dispatched dynamically: dynamic d = GetDynamicObject(…); d.M(7); // calling methods d.f = d.P; // getting and settings fields and properties d[“one”] = d[“two”]; // getting and setting thorugh indexers int i = d + 3; // calling operators string s = d(5,7); // invoking as a delegate The role of the C# compiler here is simply to package up the necessary information about “what is being done to d”, so that the runtime can pick it up and determine what the exact meaning of it is given an actual object d. Think of it as deferring part of the compiler’s job to runtime. The result of any dynamic operation is itself of type dynamic. Runtime lookup At runtime a dynamic operation is dispatched according to the nature of its target object d: COM objects If d is a COM object, the operation is dispatched dynamically through COM IDispatch. This allows calling to COM types that don’t have a Primary Interop Assembly (PIA), and relying on COM features that don’t have a counterpart in C#, such as indexed properties and default properties. Dynamic objects If d implements the interface IDynamicObject d itself is asked to perform the operation. Thus by implementing IDynamicObject a type can completely redefine the meaning of dynamic operations. This is used intensively by dynamic languages such as IronPython and IronRuby to implement their own dynamic object models. It will also be used by APIs, e.g. by the HTML DOM to allow direct access to the object’s properties using property syntax. Plain objects Otherwise d is a standard .NET object, and the operation will be dispatched using reflection on its type and a C# “runtime binder” which implements C#’s lookup and overload resolution semantics at runtime. This is essentially a part of the C# compiler running as a runtime component to “finish the work” on dynamic operations that was deferred by the static compiler. Example Assume the following code: dynamic d1 = new Foo(); dynamic d2 = new Bar(); string s; d1.M(s, d2, 3, null); Because the receiver of the call to M is dynamic, the C# compiler does not try to resolve the meaning of the call. Instead it stashes away information for the runtime about the call. This information (often referred to as the “payload”) is essentially equivalent to: “Perform an instance method call of M with the following arguments: 1. a string 2. a dynamic 3. a literal int 3 4. a literal object null” At runtime, assume that the actual type Foo of d1 is not a COM type and does not implement IDynamicObject. In this case the C# runtime binder picks up to finish the overload resolution job based on runtime type information, proceeding as follows: 1. Reflection is used to obtain the actual runtime types of the two objects, d1 and d2, that did not have a static type (or rather had the static type dynamic). The result is Foo for d1 and Bar for d2. 2. Method lookup and overload resolution is performed on the type Foo with the call M(string,Bar,3,null) using ordinary C# semantics. 3. If the method is found it is invoked; otherwise a runtime exception is thrown. Overload resolution with dynamic arguments Even if the receiver of a method call is of a static type, overload resolution can still happen at runtime. This can happen if one or more of the arguments have the type dynamic: Foo foo = new Foo(); dynamic d = new Bar(); var result = foo.M(d); The C# runtime binder will choose between the statically known overloads of M on Foo, based on the runtime type of d, namely Bar. The result is again of type dynamic. The Dynamic Language Runtime An important component in the underlying implementation of dynamic lookup is the Dynamic Language Runtime (DLR), which is a new API in .NET 4.0. The DLR provides most of the infrastructure behind not only C# dynamic lookup but also the implementation of several dynamic programming languages on .NET, such as IronPython and IronRuby. Through this common infrastructure a high degree of interoperability is ensured, but just as importantly the DLR provides excellent caching mechanisms which serve to greatly enhance the efficiency of runtime dispatch. To the user of dynamic lookup in C#, the DLR is invisible except for the improved efficiency. However, if you want to implement your own dynamically dispatched objects, the IDynamicObject interface allows you to interoperate with the DLR and plug in your own behavior. This is a rather advanced task, which requires you to understand a good deal more about the inner workings of the DLR. For API writers, however, it can definitely be worth the trouble in order to vastly improve the usability of e.g. a library representing an inherently dynamic domain. Open issues There are a few limitations and things that might work differently than you would expect. · The DLR allows objects to be created from objects that represent classes. However, the current implementation of C# doesn’t have syntax to support this. · Dynamic lookup will not be able to find extension methods. Whether extension methods apply or not depends on the static context of the call (i.e. which using clauses occur), and this context information is not currently kept as part of the payload. · Anonymous functions (i.e. lambda expressions) cannot appear as arguments to a dynamic method call. The compiler cannot bind (i.e. “understand”) an anonymous function without knowing what type it is converted to. One consequence of these limitations is that you cannot easily use LINQ queries over dynamic objects: dynamic collection = …; var result = collection.Select(e => e + 5); If the Select method is an extension method, dynamic lookup will not find it. Even if it is an instance method, the above does not compile, because a lambda expression cannot be passed as an argument to a dynamic operation. There are no plans to address these limitations in C# 4.0. Named and Optional Arguments Named and optional parameters are really two distinct features, but are often useful together. Optional parameters allow you to omit arguments to member invocations, whereas named arguments is a way to provide an argument using the name of the corresponding parameter instead of relying on its position in the parameter list. Some APIs, most notably COM interfaces such as the Office automation APIs, are written specifically with named and optional parameters in mind. Up until now it has been very painful to call into these APIs from C#, with sometimes as many as thirty arguments having to be explicitly passed, most of which have reasonable default values and could be omitted. Even in APIs for .NET however you sometimes find yourself compelled to write many overloads of a method with different combinations of parameters, in order to provide maximum usability to the callers. Optional parameters are a useful alternative for these situations. Optional parameters A parameter is declared optional simply by providing a default value for it: public void M(int x, int y = 5, int z = 7); Here y and z are optional parameters and can be omitted in calls: M(1, 2, 3); // ordinary call of M M(1, 2); // omitting z – equivalent to M(1, 2, 7) M(1); // omitting both y and z – equivalent to M(1, 5, 7) Named and optional arguments C# 4.0 does not permit you to omit arguments between commas as in M(1,,3). This could lead to highly unreadable comma-counting code. Instead any argument can be passed by name. Thus if you want to omit only y from a call of M you can write: M(1, z: 3); // passing z by name or M(x: 1, z: 3); // passing both x and z by name or even M(z: 3, x: 1); // reversing the order of arguments All forms are equivalent, except that arguments are always evaluated in the order they appear, so in the last example the 3 is evaluated before the 1. Optional and named arguments can be used not only with methods but also with indexers and constructors. Overload resolution Named and optional arguments affect overload resolution, but the changes are relatively simple: A signature is applicable if all its parameters are either optional or have exactly one corresponding argument (by name or position) in the call which is convertible to the parameter type. Betterness rules on conversions are only applied for arguments that are explicitly given – omitted optional arguments are ignored for betterness purposes. If two signatures are equally good, one that does not omit optional parameters is preferred. M(string s, int i = 1); M(object o); M(int i, string s = “Hello”); M(int i); M(5); Given these overloads, we can see the working of the rules above. M(string,int) is not applicable because 5 doesn’t convert to string. M(int,string) is applicable because its second parameter is optional, and so, obviously are M(object) and M(int). M(int,string) and M(int) are both better than M(object) because the conversion from 5 to int is better than the conversion from 5 to object. Finally M(int) is better than M(int,string) because no optional arguments are omitted. Thus the method that gets called is M(int). Features for COM interop Dynamic lookup as well as named and optional parameters greatly improve the experience of interoperating with COM APIs such as the Office Automation APIs. In order to remove even more of the speed bumps, a couple of small COM-specific features are also added to C# 4.0. Dynamic import Many COM methods accept and return variant types, which are represented in the PIAs as object. In the vast majority of cases, a programmer calling these methods already knows the static type of a returned object from context, but explicitly has to perform a cast on the returned value to make use of that knowledge. These casts are so common that they constitute a major nuisance. In order to facilitate a smoother experience, you can now choose to import these COM APIs in such a way that variants are instead represented using the type dynamic. In other words, from your point of view, COM signatures now have occurrences of dynamic instead of object in them. This means that you can easily access members directly off a returned object, or you can assign it to a strongly typed local variable without having to cast. To illustrate, you can now say excel.Cells[1, 1].Value = "Hello"; instead of ((Excel.Range)excel.Cells[1, 1]).Value2 = "Hello"; and Excel.Range range = excel.Cells[1, 1]; instead of Excel.Range range = (Excel.Range)excel.Cells[1, 1]; Compiling without PIAs Primary Interop Assemblies are large .NET assemblies generated from COM interfaces to facilitate strongly typed interoperability. They provide great support at design time, where your experience of the interop is as good as if the types where really defined in .NET. However, at runtime these large assemblies can easily bloat your program, and also cause versioning issues because they are distributed independently of your application. The no-PIA feature allows you to continue to use PIAs at design time without having them around at runtime. Instead, the C# compiler will bake the small part of the PIA that a program actually uses directly into its assembly. At runtime the PIA does not have to be loaded. Omitting ref Because of a different programming model, many COM APIs contain a lot of reference parameters. Contrary to refs in C#, these are typically not meant to mutate a passed-in argument for the subsequent benefit of the caller, but are simply another way of passing value parameters. It therefore seems unreasonable that a C# programmer should have to create temporary variables for all such ref parameters and pass these by reference. Instead, specifically for COM methods, the C# compiler will allow you to pass arguments by value to such a method, and will automatically generate temporary variables to hold the passed-in values, subsequently discarding these when the call returns. In this way the caller sees value semantics, and will not experience any side effects, but the called method still gets a reference. Open issues A few COM interface features still are not surfaced in C#. Most notably these include indexed properties and default properties. As mentioned above these will be respected if you access COM dynamically, but statically typed C# code will still not recognize them. There are currently no plans to address these remaining speed bumps in C# 4.0. Variance An aspect of generics that often comes across as surprising is that the following is illegal: IList<string> strings = new List<string>(); IList<object> objects = strings; The second assignment is disallowed because strings does not have the same element type as objects. There is a perfectly good reason for this. If it were allowed you could write: objects[0] = 5; string s = strings[0]; Allowing an int to be inserted into a list of strings and subsequently extracted as a string. This would be a breach of type safety. However, there are certain interfaces where the above cannot occur, notably where there is no way to insert an object into the collection. Such an interface is IEnumerable<T>. If instead you say: IEnumerable<object> objects = strings; There is no way we can put the wrong kind of thing into strings through objects, because objects doesn’t have a method that takes an element in. Variance is about allowing assignments such as this in cases where it is safe. The result is that a lot of situations that were previously surprising now just work. Covariance In .NET 4.0 the IEnumerable<T> interface will be declared in the following way: public interface IEnumerable<out T> : IEnumerable { IEnumerator<T> GetEnumerator(); } public interface IEnumerator<out T> : IEnumerator { bool MoveNext(); T Current { get; } } The “out” in these declarations signifies that the T can only occur in output position in the interface – the compiler will complain otherwise. In return for this restriction, the interface becomes “covariant” in T, which means that an IEnumerable<A> is considered an IEnumerable<B> if A has a reference conversion to B. As a result, any sequence of strings is also e.g. a sequence of objects. This is useful e.g. in many LINQ methods. Using the declarations above: var result = strings.Union(objects); // succeeds with an IEnumerable<object> This would previously have been disallowed, and you would have had to to some cumbersome wrapping to get the two sequences to have the same element type. Contravariance Type parameters can also have an “in” modifier, restricting them to occur only in input positions. An example is IComparer<T>: public interface IComparer<in T> { public int Compare(T left, T right); } The somewhat baffling result is that an IComparer<object> can in fact be considered an IComparer<string>! It makes sense when you think about it: If a comparer can compare any two objects, it can certainly also compare two strings. This property is referred to as contravariance. A generic type can have both in and out modifiers on its type parameters, as is the case with the Func<…> delegate types: public delegate TResult Func<in TArg, out TResult>(TArg arg); Obviously the argument only ever comes in, and the result only ever comes out. Therefore a Func<object,string> can in fact be used as a Func<string,object>. Limitations Variant type parameters can only be declared on interfaces and delegate types, due to a restriction in the CLR. Variance only applies when there is a reference conversion between the type arguments. For instance, an IEnumerable<int> is not an IEnumerable<object> because the conversion from int to object is a boxing conversion, not a reference conversion. Also please note that the CTP does not contain the new versions of the .NET types mentioned above. In order to experiment with variance you have to declare your own variant interfaces and delegate types. COM Example Here is a larger Office automation example that shows many of the new C# features in action. using System; using System.Diagnostics; using System.Linq; using Excel = Microsoft.Office.Interop.Excel; using Word = Microsoft.Office.Interop.Word; class Program { static void Main(string[] args) { var excel = new Excel.Application(); excel.Visible = true; excel.Workbooks.Add(); // optional arguments omitted excel.Cells[1, 1].Value = "Process Name"; // no casts; Value dynamically excel.Cells[1, 2].Value = "Memory Usage"; // accessed var processes = Process.GetProcesses() .OrderByDescending(p =&gt; p.WorkingSet) .Take(10); int i = 2; foreach (var p in processes) { excel.Cells[i, 1].Value = p.ProcessName; // no casts excel.Cells[i, 2].Value = p.WorkingSet; // no casts i++; } Excel.Range range = excel.Cells[1, 1]; // no casts Excel.Chart chart = excel.ActiveWorkbook.Charts. Add(After: excel.ActiveSheet); // named and optional arguments chart.ChartWizard( Source: range.CurrentRegion, Title: "Memory Usage in " + Environment.MachineName); //named+optional chart.ChartStyle = 45; chart.CopyPicture(Excel.XlPictureAppearance.xlScreen, Excel.XlCopyPictureFormat.xlBitmap, Excel.XlPictureAppearance.xlScreen); var word = new Word.Application(); word.Visible = true; word.Documents.Add(); // optional arguments word.Selection.Paste(); } } The code is much more terse and readable than the C# 3.0 counterpart. Note especially how the Value property is accessed dynamically. This is actually an indexed property, i.e. a property that takes an argument; something which C# does not understand. However the argument is optional. Since the access is dynamic, it goes through the runtime COM binder which knows to substitute the default value and call the indexed property. Thus, dynamic COM allows you to avoid accesses to the puzzling Value2 property of Excel ranges. Relationship with Visual Basic A number of the features introduced to C# 4.0 already exist or will be introduced in some form or other in Visual Basic: · Late binding in VB is similar in many ways to dynamic lookup in C#, and can be expected to make more use of the DLR in the future, leading to further parity with C#. · Named and optional arguments have been part of Visual Basic for a long time, and the C# version of the feature is explicitly engineered with maximal VB interoperability in mind. · NoPIA and variance are both being introduced to VB and C# at the same time. VB in turn is adding a number of features that have hitherto been a mainstay of C#. As a result future versions of C# and VB will have much better feature parity, for the benefit of everyone. Resources All available resources concerning C# 4.0 can be accessed through the C# Dev Center. Specifically, this white paper and other resources can be found at the Code Gallery site. Enjoy! span.fullpost {display:none;}

  Read the article

• Creating STA COM compatible ASP.NET Applications

  - by Rick Strahl

  When building ASP.NET applications that interface with old school COM objects like those created with VB6 or Visual FoxPro (MTDLL), it's extremely important that the threads that are serving requests use Single Threaded Apartment Threading. STA is a COM built-in technology that allows essentially single threaded components to operate reliably in a multi-threaded environment. STA's guarantee that COM objects instantiated on a specific thread stay on that specific thread and any access to a COM object from another thread automatically marshals that thread to the STA thread. The end effect is that you can have multiple threads, but a COM object instance lives on a fixed never changing thread. ASP.NET by default uses MTA (multi-threaded apartment) threads which are truly free spinning threads that pay no heed to COM object marshaling. This is vastly more efficient than STA threading which has a bit of overhead in determining whether it's OK to run code on a given thread or whether some sort of thread/COM marshaling needs to occur. MTA COM components can be very efficient, but STA COM components in a multi-threaded environment always tend to have a fair amount of overhead. It's amazing how much COM Interop I still see today so while it seems really old school to be talking about this topic, it's actually quite apropos for me as I have many customers using legacy COM systems that need to interface with other .NET applications. In this post I'm consolidating some of the hacks I've used to integrate with various ASP.NET technologies when using STA COM Components. STA in ASP.NET Support for STA threading in the ASP.NET framework is fairly limited. Specifically only the original ASP.NET WebForms technology supports STA threading directly via its STA Page Handler implementation or what you might know as ASPCOMPAT mode. For WebForms running STA components is as easy as specifying the ASPCOMPAT attribute in the @Page tag:<%@ Page Language="C#" AspCompat="true" %> which runs the page in STA mode. Removing it runs in MTA mode. Simple. Unfortunately all other ASP.NET technologies built on top of the core ASP.NET engine do not support STA natively. So if you want to use STA COM components in MVC or with class ASMX Web Services, there's no automatic way like the ASPCOMPAT keyword available. So what happens when you run an STA COM component in an MTA application? In low volume environments - nothing much will happen. The COM objects will appear to work just fine as there are no simultaneous thread interactions and the COM component will happily run on a single thread or multiple single threads one at a time. So for testing running components in MTA environments may appear to work just fine. However as load increases and threads get re-used by ASP.NET COM objects will end up getting created on multiple different threads. This can result in crashes or hangs, or data corruption in the STA components which store their state in thread local storage on the STA thread. If threads overlap this global store can easily get corrupted which in turn causes problems. STA ensures that any COM object instance loaded always stays on the same thread it was instantiated on. What about COM+? COM+ is supposed to address the problem of STA in MTA applications by providing an abstraction with it's own thread pool manager for COM objects. It steps in to the COM instantiation pipeline and hands out COM instances from its own internally maintained STA Thread pool. This guarantees that the COM instantiation threads are STA threads if using STA components. COM+ works, but in my experience the technology is very, very slow for STA components. It adds a ton of overhead and reduces COM performance noticably in load tests in IIS. COM+ can make sense in some situations but for Web apps with STA components it falls short. In addition there's also the need to ensure that COM+ is set up and configured on the target machine and the fact that components have to be registered in COM+. COM+ also keeps components up at all times, so if a component needs to be replaced the COM+ package needs to be unloaded (same is true for IIS hosted components but it's more common to manage that). COM+ is an option for well established components, but native STA support tends to provide better performance and more consistent usability, IMHO. STA for non supporting ASP.NET Technologies As mentioned above only WebForms supports STA natively. However, by utilizing the WebForms ASP.NET Page handler internally it's actually possible to trick various other ASP.NET technologies and let them work with STA components. This is ugly but I've used each of these in various applications and I've had minimal problems making them work with FoxPro STA COM components which is about as dififcult as it gets for COM Interop in .NET. In this post I summarize several STA workarounds that enable you to use STA threading with these ASP.NET Technologies: ASMX Web Services ASP.NET MVC WCF Web Services ASP.NET Web API ASMX Web Services I start with classic ASP.NET ASMX Web Services because it's the easiest mechanism that allows for STA modification. It also clearly demonstrates how the WebForms STA Page Handler is the key technology to enable the various other solutions to create STA components. Essentially the way this works is to override the WebForms Page class and hijack it's init functionality for processing requests. Here's what this looks like for Web Services:namespace FoxProAspNet { public class WebServiceStaHandler : System.Web.UI.Page, IHttpAsyncHandler { protected override void OnInit(EventArgs e) { IHttpHandler handler = new WebServiceHandlerFactory().GetHandler( this.Context, this.Context.Request.HttpMethod, this.Context.Request.FilePath, this.Context.Request.PhysicalPath); handler.ProcessRequest(this.Context); this.Context.ApplicationInstance.CompleteRequest(); } public IAsyncResult BeginProcessRequest( HttpContext context, AsyncCallback cb, object extraData) { return this.AspCompatBeginProcessRequest(context, cb, extraData); } public void EndProcessRequest(IAsyncResult result) { this.AspCompatEndProcessRequest(result); } } public class AspCompatWebServiceStaHandlerWithSessionState : WebServiceStaHandler, IRequiresSessionState { } } This class overrides the ASP.NET WebForms Page class which has a little known AspCompatBeginProcessRequest() and AspCompatEndProcessRequest() method that is responsible for providing the WebForms ASPCOMPAT functionality. These methods handle routing requests to STA threads. Note there are two classes - one that includes session state and one that does not. If you plan on using ASP.NET Session state use the latter class, otherwise stick to the former. This maps to the EnableSessionState page setting in WebForms. This class simply hooks into this functionality by overriding the BeginProcessRequest and EndProcessRequest methods and always forcing it into the AspCompat methods. The way this works is that BeginProcessRequest() fires first to set up the threads and starts intializing the handler. As part of that process the OnInit() method is fired which is now already running on an STA thread. The code then creates an instance of the actual WebService handler factory and calls its ProcessRequest method to start executing which generates the Web Service result. Immediately after ProcessRequest the request is stopped with Application.CompletRequest() which ensures that the rest of the Page handler logic doesn't fire. This means that even though the fairly heavy Page class is overridden here, it doesn't end up executing any of its internal processing which makes this code fairly efficient. In a nutshell, we're highjacking the Page HttpHandler and forcing it to process the WebService process handler in the context of the AspCompat handler behavior. Hooking up the Handler Because the above is an HttpHandler implementation you need to hook up the custom handler and replace the standard ASMX handler. To do this you need to modify the web.config file (here for IIS 7 and IIS Express): <configuration> <system.webServer> <handlers> <remove name="WebServiceHandlerFactory-Integrated-4.0" /> <add name="Asmx STA Web Service Handler" path="*.asmx" verb="*" type="FoxProAspNet.WebServiceStaHandler" precondition="integrated"/> </handlers> </system.webServer> </configuration> (Note: The name for the WebServiceHandlerFactory-Integrated-4.0 might be slightly different depending on your server version. Check the IIS Handler configuration in the IIS Management Console for the exact name or simply remove the handler from the list there which will propagate to your web.config). For IIS 5 & 6 (Windows XP/2003) or the Visual Studio Web Server use:<configuration> <system.web> <httpHandlers> <remove path="*.asmx" verb="*" /> <add path="*.asmx" verb="*" type="FoxProAspNet.WebServiceStaHandler" /> </httpHandlers> </system.web></configuration> To test, create a new ASMX Web Service and create a method like this: [WebService(Namespace = "http://foxaspnet.org/")] [WebServiceBinding(ConformsTo = WsiProfiles.BasicProfile1_1)] public class FoxWebService : System.Web.Services.WebService { [WebMethod] public string HelloWorld() { return "Hello World. Threading mode is: " + System.Threading.Thread.CurrentThread.GetApartmentState(); } } Run this before you put in the web.config configuration changes and you should get: Hello World. Threading mode is: MTA Then put the handler mapping into Web.config and you should see: Hello World. Threading mode is: STA And you're on your way to using STA COM components. It's a hack but it works well! I've used this with several high volume Web Service installations with various customers and it's been fast and reliable. ASP.NET MVC ASP.NET MVC has quickly become the most popular ASP.NET technology, replacing WebForms for creating HTML output. MVC is more complex to get started with, but once you understand the basic structure of how requests flow through the MVC pipeline it's easy to use and amazingly flexible in manipulating HTML requests. In addition, MVC has great support for non-HTML output sources like JSON and XML, making it an excellent choice for AJAX requests without any additional tools. Unlike WebForms ASP.NET MVC doesn't support STA threads natively and so some trickery is needed to make it work with STA threads as well. MVC gets its handler implementation through custom route handlers using ASP.NET's built in routing semantics. To work in an STA handler requires working in the Page Handler as part of the Route Handler implementation. As with the Web Service handler the first step is to create a custom HttpHandler that can instantiate an MVC request pipeline properly:public class MvcStaThreadHttpAsyncHandler : Page, IHttpAsyncHandler, IRequiresSessionState { private RequestContext _requestContext; public MvcStaThreadHttpAsyncHandler(RequestContext requestContext) { if (requestContext == null) throw new ArgumentNullException("requestContext"); _requestContext = requestContext; } public IAsyncResult BeginProcessRequest(HttpContext context, AsyncCallback cb, object extraData) { return this.AspCompatBeginProcessRequest(context, cb, extraData); } protected override void OnInit(EventArgs e) { var controllerName = _requestContext.RouteData.GetRequiredString("controller"); var controllerFactory = ControllerBuilder.Current.GetControllerFactory(); var controller = controllerFactory.CreateController(_requestContext, controllerName); if (controller == null) throw new InvalidOperationException("Could not find controller: " + controllerName); try { controller.Execute(_requestContext); } finally { controllerFactory.ReleaseController(controller); } this.Context.ApplicationInstance.CompleteRequest(); } public void EndProcessRequest(IAsyncResult result) { this.AspCompatEndProcessRequest(result); } public override void ProcessRequest(HttpContext httpContext) { throw new NotSupportedException("STAThreadRouteHandler does not support ProcessRequest called (only BeginProcessRequest)"); } } This handler code figures out which controller to load and then executes the controller. MVC internally provides the information needed to route to the appropriate method and pass the right parameters. Like the Web Service handler the logic occurs in the OnInit() and performs all the processing in that part of the request. Next, we need a RouteHandler that can actually pick up this handler. Unlike the Web Service handler where we simply registered the handler, MVC requires a RouteHandler to pick up the handler. RouteHandlers look at the URL's path and based on that decide on what handler to invoke. The route handler is pretty simple - all it does is load our custom handler: public class MvcStaThreadRouteHandler : IRouteHandler { public IHttpHandler GetHttpHandler(RequestContext requestContext) { if (requestContext == null) throw new ArgumentNullException("requestContext"); return new MvcStaThreadHttpAsyncHandler(requestContext); } } At this point you can instantiate this route handler and force STA requests to MVC by specifying a route. The following sets up the ASP.NET Default Route:Route mvcRoute = new Route("{controller}/{action}/{id}", new RouteValueDictionary( new { controller = "Home", action = "Index", id = UrlParameter.Optional }), new MvcStaThreadRouteHandler()); RouteTable.Routes.Add(mvcRoute);   To make this code a little easier to work with and mimic the behavior of the routes.MapRoute() functionality extension method that MVC provides, here is an extension method for MapMvcStaRoute(): public static class RouteCollectionExtensions { public static void MapMvcStaRoute(this RouteCollection routeTable, string name, string url, object defaults = null) { Route mvcRoute = new Route(url, new RouteValueDictionary(defaults), new MvcStaThreadRouteHandler()); RouteTable.Routes.Add(mvcRoute); } } With this the syntax to add  route becomes a little easier and matches the MapRoute() method:RouteTable.Routes.MapMvcStaRoute( name: "Default", url: "{controller}/{action}/{id}", defaults: new { controller = "Home", action = "Index", id = UrlParameter.Optional } ); The nice thing about this route handler, STA Handler and extension method is that it's fully self contained. You can put all three into a single class file and stick it into your Web app, and then simply call MapMvcStaRoute() and it just works. Easy! To see whether this works create an MVC controller like this: public class ThreadTestController : Controller { public string ThreadingMode() { return Thread.CurrentThread.GetApartmentState().ToString(); } } Try this test both with only the MapRoute() hookup in the RouteConfiguration in which case you should get MTA as the value. Then change the MapRoute() call to MapMvcStaRoute() leaving all the parameters the same and re-run the request. You now should see STA as the result. You're on your way using STA COM components reliably in ASP.NET MVC. WCF Web Services running through IIS WCF Web Services provide a more robust and wider range of services for Web Services. You can use WCF over HTTP, TCP, and Pipes, and WCF services support WS* secure services. There are many features in WCF that go way beyond what ASMX can do. But it's also a bit more complex than ASMX. As a basic rule if you need to serve straight SOAP Services over HTTP I 'd recommend sticking with the simpler ASMX services especially if COM is involved. If you need WS* support or want to serve data over non-HTTP protocols then WCF makes more sense. WCF is not my forte but I found a solution from Scott Seely on his blog that describes the progress and that seems to work well. I'm copying his code below so this STA information is all in one place and quickly explain. Scott's code basically works by creating a custom OperationBehavior which can be specified via an [STAOperation] attribute on every method. Using his attribute you end up with a class (or Interface if you separate the contract and class) that looks like this: [ServiceContract] public class WcfService { [OperationContract] public string HelloWorldMta() { return Thread.CurrentThread.GetApartmentState().ToString(); } // Make sure you use this custom STAOperationBehavior // attribute to force STA operation of service methods [STAOperationBehavior] [OperationContract] public string HelloWorldSta() { return Thread.CurrentThread.GetApartmentState().ToString(); } } Pretty straight forward. The latter method returns STA while the former returns MTA. To make STA work every method needs to be marked up. The implementation consists of the attribute and OperationInvoker implementation. Here are the two classes required to make this work from Scott's post:public class STAOperationBehaviorAttribute : Attribute, IOperationBehavior { public void AddBindingParameters(OperationDescription operationDescription, System.ServiceModel.Channels.BindingParameterCollection bindingParameters) { } public void ApplyClientBehavior(OperationDescription operationDescription, System.ServiceModel.Dispatcher.ClientOperation clientOperation) { // If this is applied on the client, well, it just doesn’t make sense. // Don’t throw in case this attribute was applied on the contract // instead of the implementation. } public void ApplyDispatchBehavior(OperationDescription operationDescription, System.ServiceModel.Dispatcher.DispatchOperation dispatchOperation) { // Change the IOperationInvoker for this operation. dispatchOperation.Invoker = new STAOperationInvoker(dispatchOperation.Invoker); } public void Validate(OperationDescription operationDescription) { if (operationDescription.SyncMethod == null) { throw new InvalidOperationException("The STAOperationBehaviorAttribute " + "only works for synchronous method invocations."); } } } public class STAOperationInvoker : IOperationInvoker { IOperationInvoker _innerInvoker; public STAOperationInvoker(IOperationInvoker invoker) { _innerInvoker = invoker; } public object[] AllocateInputs() { return _innerInvoker.AllocateInputs(); } public object Invoke(object instance, object[] inputs, out object[] outputs) { // Create a new, STA thread object[] staOutputs = null; object retval = null; Thread thread = new Thread( delegate() { retval = _innerInvoker.Invoke(instance, inputs, out staOutputs); }); thread.SetApartmentState(ApartmentState.STA); thread.Start(); thread.Join(); outputs = staOutputs; return retval; } public IAsyncResult InvokeBegin(object instance, object[] inputs, AsyncCallback callback, object state) { // We don’t handle async… throw new NotImplementedException(); } public object InvokeEnd(object instance, out object[] outputs, IAsyncResult result) { // We don’t handle async… throw new NotImplementedException(); } public bool IsSynchronous { get { return true; } } } The key in this setup is the Invoker and the Invoke method which creates a new thread and then fires the request on this new thread. Because this approach creates a new thread for every request it's not super efficient. There's a bunch of overhead involved in creating the thread and throwing it away after each thread, but it'll work for low volume requests and insure each thread runs in STA mode. If better performance is required it would be useful to create a custom thread manager that can pool a number of STA threads and hand off threads as needed rather than creating new threads on every request. If your Web Service needs are simple and you need only to serve standard SOAP 1.x requests, I would recommend sticking with ASMX services. It's easier to set up and work with and for STA component use it'll be significantly better performing since ASP.NET manages the STA thread pool for you rather than firing new threads for each request. One nice thing about Scotts code is though that it works in any WCF environment including self hosting. It has no dependency on ASP.NET or WebForms for that matter. STA - If you must STA components are a  pain in the ass and thankfully there isn't too much stuff out there anymore that requires it. But when you need it and you need to access STA functionality from .NET at least there are a few options available to make it happen. Each of these solutions is a bit hacky, but they work - I've used all of them in production with good results with FoxPro components. I hope compiling all of these in one place here makes it STA consumption a little bit easier. I feel your pain :-) Resources Download STA Handler Code Examples Scott Seely's original STA WCF OperationBehavior Article© Rick Strahl, West Wind Technologies, 2005-2012Posted in FoxPro   ASP.NET  .NET  COM   Tweet !function(d,s,id){var js,fjs=d.getElementsByTagName(s)[0];if(!d.getElementById(id)){js=d.createElement(s);js.id=id;js.src="//platform.twitter.com/widgets.js";fjs.parentNode.insertBefore(js,fjs);}}(document,"script","twitter-wjs"); (function() { var po = document.createElement('script'); po.type = 'text/javascript'; po.async = true; po.src = 'https://apis.google.com/js/plusone.js'; var s = document.getElementsByTagName('script')[0]; s.parentNode.insertBefore(po, s); })();

  Read the article

• AngularJS on top of ASP.NET: Moving the MVC framework out to the browser

  - by Varun Chatterji

  Heavily drawing inspiration from Ruby on Rails, MVC4’s convention over configuration model of development soon became the Holy Grail of .NET web development. The MVC model brought with it the goodness of proper separation of concerns between business logic, data, and the presentation logic. However, the MVC paradigm, was still one in which server side .NET code could be mixed with presentation code. The Razor templating engine, though cleaner than its predecessors, still encouraged and allowed you to mix .NET server side code with presentation logic. Thus, for example, if the developer required a certain <div> tag to be shown if a particular variable ShowDiv was true in the View’s model, the code could look like the following: Fig 1: To show a div or not. Server side .NET code is used in the View Mixing .NET code with HTML in views can soon get very messy. Wouldn’t it be nice if the presentation layer (HTML) could be pure HTML? Also, in the ASP.NET MVC model, some of the business logic invariably resides in the controller. It is tempting to use an anti­pattern like the one shown above to control whether a div should be shown or not. However, best practice would indicate that the Controller should not be aware of the div. The ShowDiv variable in the model should not exist. A controller should ideally, only be used to do the plumbing of getting the data populated in the model and nothing else. The view (ideally pure HTML) should render the presentation layer based on the model. In this article we will see how Angular JS, a new JavaScript framework by Google can be used effectively to build web applications where: 1. Views are pure HTML 2. Controllers (in the server sense) are pure REST based API calls 3. The presentation layer is loaded as needed from partial HTML only files. What is MVVM? MVVM short for Model View View Model is a new paradigm in web development. In this paradigm, the Model and View stuff exists on the client side through javascript instead of being processed on the server through postbacks. These frameworks are JavaScript frameworks that facilitate the clear separation of the “frontend” or the data rendering logic from the “backend” which is typically just a REST based API that loads and processes data through a resource model. The frameworks are called MVVM as a change to the Model (through javascript) gets reflected in the view immediately i.e. Model > View. Also, a change on the view (through manual input) gets reflected in the model immediately i.e. View > Model. The following figure shows this conceptually (comments are shown in red): Fig 2: Demonstration of MVVM in action In Fig 2, two text boxes are bound to the same variable model.myInt. Thus, changing the view manually (changing one text box through keyboard input) also changes the other textbox in real time demonstrating V > M property of a MVVM framework. Furthermore, clicking the button adds 1 to the value of model.myInt thus changing the model through JavaScript. This immediately updates the view (the value in the two textboxes) thus demonstrating the M > V property of a MVVM framework. Thus we see that the model in a MVVM JavaScript framework can be regarded as “the single source of truth“. This is an important concept. Angular is one such MVVM framework. We shall use it to build a simple app that sends SMS messages to a particular number. Application, Routes, Views, Controllers, Scope and Models Angular can be used in many ways to construct web applications. For this article, we shall only focus on building Single Page Applications (SPAs). Many of the approaches we will follow in this article have alternatives. It is beyond the scope of this article to explain every nuance in detail but we shall try to touch upon the basic concepts and end up with a working application that can be used to send SMS messages using Sent.ly Plus (a service that is itself built using Angular). Before you read on, we would like to urge you to forget what you know about Models, Views, Controllers and Routes in the ASP.NET MVC4 framework. All these words have different meanings in the Angular world. Whenever these words are used in this article, they will refer to Angular concepts and not ASP.NET MVC4 concepts. The following figure shows the skeleton of the root page of an SPA: Fig 3: The skeleton of a SPA The skeleton of the application is based on the Bootstrap starter template which can be found at: http://getbootstrap.com/examples/starter­template/ Apart from loading the Angular, jQuery and Bootstrap JavaScript libraries, it also loads our custom scripts /app/js/controllers.js /app/js/app.js These scripts define the routes, views and controllers which we shall come to in a moment. Application Notice that the body tag (Fig. 3) has an extra attribute: ng­app=”smsApp” Providing this tag “bootstraps” our single page application. It tells Angular to load a “module” called smsApp. This “module” is defined /app/js/app.js angular.module('smsApp', ['smsApp.controllers', function () {}]) Fig 4: The definition of our application module The line shows above, declares a module called smsApp. It also declares that this module “depends” on another module called “smsApp.controllers”. The smsApp.controllers module will contain all the controllers for our SPA. Routing and Views Notice that in the Navbar (in Fig 3) we have included two hyperlinks to: “#/app” “#/help” This is how Angular handles routing. Since the URLs start with “#”, they are actually just bookmarks (and not server side resources). However, our route definition (in /app/js/app.js) gives these URLs a special meaning within the Angular framework. angular.module('smsApp', ['smsApp.controllers', function () { }]) //Configure the routes .config(['$routeProvider', function ($routeProvider) { $routeProvider.when('/binding', { templateUrl: '/app/partials/bindingexample.html', controller: 'BindingController' }); }]); Fig 5: The definition of a route with an associated partial view and controller As we can see from the previous code sample, we are using the $routeProvider object in the configuration of our smsApp module. Notice how the code “asks for” the $routeProvider object by specifying it as a dependency in the [] braces and then defining a function that accepts it as a parameter. This is known as dependency injection. Please refer to the following link if you want to delve into this topic: http://docs.angularjs.org/guide/di What the above code snippet is doing is that it is telling Angular that when the URL is “#/binding”, then it should load the HTML snippet (“partial view”) found at /app/partials/bindingexample.html. Also, for this URL, Angular should load the controller called “BindingController”. We have also marked the div with the class “container” (in Fig 3) with the ng­view attribute. This attribute tells Angular that views (partial HTML pages) defined in the routes will be loaded within this div. You can see that the Angular JavaScript framework, unlike many other frameworks, works purely by extending HTML tags and attributes. It also allows you to extend HTML with your own tags and attributes (through directives) if you so desire, you can find out more about directives at the following URL: http://www.codeproject.com/Articles/607873/Extending­HTML­with­AngularJS­Directives Controllers and Models We have seen how we define what views and controllers should be loaded for a particular route. Let us now consider how controllers are defined. Our controllers are defined in the file /app/js/controllers.js. The following snippet shows the definition of the “BindingController” which is loaded when we hit the URL http://localhost:port/index.html#/binding (as we have defined in the route earlier as shown in Fig 5). Remember that we had defined that our application module “smsApp” depends on the “smsApp.controllers” module (see Fig 4). The code snippet below shows how the “BindingController” defined in the route shown in Fig 5 is defined in the module smsApp.controllers: angular.module('smsApp.controllers', [function () { }]) .controller('BindingController', ['$scope', function ($scope) { $scope.model = {}; $scope.model.myInt = 6; $scope.addOne = function () { $scope.model.myInt++; } }]); Fig 6: The definition of a controller in the “smsApp.controllers” module. The pieces are falling in place! Remember Fig.2? That was the code of a partial view that was loaded within the container div of the skeleton SPA shown in Fig 3. The route definition shown in Fig 5 also defined that the controller called “BindingController” (shown in Fig 6.) was loaded when we loaded the URL: http://localhost:22544/index.html#/binding The button in Fig 2 was marked with the attribute ng­click=”addOne()” which added 1 to the value of model.myInt. In Fig 6, we can see that this function is actually defined in the “BindingController”. Scope We can see from Fig 6, that in the definition of “BindingController”, we defined a dependency on $scope and then, as usual, defined a function which “asks for” $scope as per the dependency injection pattern. So what is $scope? Any guesses? As you might have guessed a scope is a particular “address space” where variables and functions may be defined. This has a similar meaning to scope in a programming language like C#. Model: The Scope is not the Model It is tempting to assign variables in the scope directly. For example, we could have defined myInt as $scope.myInt = 6 in Fig 6 instead of $scope.model.myInt = 6. The reason why this is a bad idea is that scope in hierarchical in Angular. Thus if we were to define a controller which was defined within the another controller (nested controllers), then the inner controller would inherit the scope of the parent controller. This inheritance would follow JavaScript prototypal inheritance. Let’s say the parent controller defined a variable through $scope.myInt = 6. The child controller would inherit the scope through java prototypical inheritance. This basically means that the child scope has a variable myInt that points to the parent scopes myInt variable. Now if we assigned the value of myInt in the parent, the child scope would be updated with the same value as the child scope’s myInt variable points to the parent scope’s myInt variable. However, if we were to assign the value of the myInt variable in the child scope, then the link of that variable to the parent scope would be broken as the variable myInt in the child scope now points to the value 6 and not to the parent scope’s myInt variable. But, if we defined a variable model in the parent scope, then the child scope will also have a variable model that points to the model variable in the parent scope. Updating the value of $scope.model.myInt in the parent scope would change the model variable in the child scope too as the variable is pointed to the model variable in the parent scope. Now changing the value of $scope.model.myInt in the child scope would ALSO change the value in the parent scope. This is because the model reference in the child scope is pointed to the scope variable in the parent. We did no new assignment to the model variable in the child scope. We only changed an attribute of the model variable. Since the model variable (in the child scope) points to the model variable in the parent scope, we have successfully changed the value of myInt in the parent scope. Thus the value of $scope.model.myInt in the parent scope becomes the “single source of truth“. This is a tricky concept, thus it is considered good practice to NOT use scope inheritance. More info on prototypal inheritance in Angular can be found in the “JavaScript Prototypal Inheritance” section at the following URL: https://github.com/angular/angular.js/wiki/Understanding­Scopes. Building It: An Angular JS application using a .NET Web API Backend Now that we have a perspective on the basic components of an MVVM application built using Angular, let’s build something useful. We will build an application that can be used to send out SMS messages to a given phone number. The following diagram describes the architecture of the application we are going to build: Fig 7: Broad application architecture We are going to add an HTML Partial to our project. This partial will contain the form fields that will accept the phone number and message that needs to be sent as an SMS. It will also display all the messages that have previously been sent. All the executable code that is run on the occurrence of events (button clicks etc.) in the view resides in the controller. The controller interacts with the ASP.NET WebAPI to get a history of SMS messages, add a message etc. through a REST based API. For the purposes of simplicity, we will use an in memory data structure for the purposes of creating this application. Thus, the tasks ahead of us are: Creating the REST WebApi with GET, PUT, POST, DELETE methods. Creating the SmsView.html partial Creating the SmsController controller with methods that are called from the SmsView.html partial Add a new route that loads the controller and the partial. 1. Creating the REST WebAPI This is a simple task that should be quite straightforward to any .NET developer. The following listing shows our ApiController: public class SmsMessage { public string to { get; set; } public string message { get; set; } } public class SmsResource : SmsMessage { public int smsId { get; set; } } public class SmsResourceController : ApiController { public static Dictionary<int, SmsResource> messages = new Dictionary<int, SmsResource>(); public static int currentId = 0; // GET api/<controller> public List<SmsResource> Get() { List<SmsResource> result = new List<SmsResource>(); foreach (int key in messages.Keys) { result.Add(messages[key]); } return result; } // GET api/<controller>/5 public SmsResource Get(int id) { if (messages.ContainsKey(id)) return messages[id]; return null; } // POST api/<controller> public List<SmsResource> Post([FromBody] SmsMessage value) { //Synchronize on messages so we don't have id collisions lock (messages) { SmsResource res = (SmsResource) value; res.smsId = currentId++; messages.Add(res.smsId, res); //SentlyPlusSmsSender.SendMessage(value.to, value.message); return Get(); } } // PUT api/<controller>/5 public List<SmsResource> Put(int id, [FromBody] SmsMessage value) { //Synchronize on messages so we don't have id collisions lock (messages) { if (messages.ContainsKey(id)) { //Update the message messages[id].message = value.message; messages[id].to = value.message; } return Get(); } } // DELETE api/<controller>/5 public List<SmsResource> Delete(int id) { if (messages.ContainsKey(id)) { messages.Remove(id); } return Get(); } } Once this class is defined, we should be able to access the WebAPI by a simple GET request using the browser: http://localhost:port/api/SmsResource Notice the commented line: //SentlyPlusSmsSender.SendMessage The SentlyPlusSmsSender class is defined in the attached solution. We have shown this line as commented as we want to explain the core Angular concepts. If you load the attached solution, this line is uncommented in the source and an actual SMS will be sent! By default, the API returns XML. For consumption of the API in Angular, we would like it to return JSON. To change the default to JSON, we make the following change to WebApiConfig.cs file located in the App_Start folder. public static class WebApiConfig { public static void Register(HttpConfiguration config) { config.Routes.MapHttpRoute( name: "DefaultApi", routeTemplate: "api/{controller}/{id}", defaults: new { id = RouteParameter.Optional } ); var appXmlType = config.Formatters.XmlFormatter. SupportedMediaTypes. FirstOrDefault( t => t.MediaType == "application/xml"); config.Formatters.XmlFormatter.SupportedMediaTypes.Remove(appXmlType); } } We now have our backend REST Api which we can consume from Angular! 2. Creating the SmsView.html partial This simple partial will define two fields: the destination phone number (international format starting with a +) and the message. These fields will be bound to model.phoneNumber and model.message. We will also add a button that we shall hook up to sendMessage() in the controller. A list of all previously sent messages (bound to model.allMessages) will also be displayed below the form input. The following code shows the code for the partial: <!--­­ If model.errorMessage is defined, then render the error div -­­> <div class="alert alert-­danger alert-­dismissable" style="margin­-top: 30px;" ng­-show="model.errorMessage != undefined"> <button type="button" class="close" data­dismiss="alert" aria­hidden="true">&times;</button> <strong>Error!</strong> <br /> {{ model.errorMessage }} </div> <!--­­ The input fields bound to the model --­­> <div class="well" style="margin-­top: 30px;"> <table style="width: 100%;"> <tr> <td style="width: 45%; text-­align: center;"> <input type="text" placeholder="Phone number (eg; +44 7778 609466)" ng­-model="model.phoneNumber" class="form-­control" style="width: 90%" onkeypress="return checkPhoneInput();" /> </td> <td style="width: 45%; text-­align: center;"> <input type="text" placeholder="Message" ng­-model="model.message" class="form-­control" style="width: 90%" /> </td> <td style="text-­align: center;"> <button class="btn btn-­danger" ng-­click="sendMessage();" ng-­disabled="model.isAjaxInProgress" style="margin­right: 5px;">Send</button> <img src="/Content/ajax-­loader.gif" ng­-show="model.isAjaxInProgress" /> </td> </tr> </table> </div> <!--­­ The past messages ­­--> <div style="margin-­top: 30px;"> <!­­-- The following div is shown if there are no past messages --­­> <div ng­-show="model.allMessages.length == 0"> No messages have been sent yet! </div> <!--­­ The following div is shown if there are some past messages --­­> <div ng-­show="model.allMessages.length == 0"> <table style="width: 100%;" class="table table-­striped"> <tr> <td>Phone Number</td> <td>Message</td> <td></td> </tr> <!--­­ The ng-­repeat directive is line the repeater control in .NET, but as you can see this partial is pure HTML which is much cleaner --> <tr ng-­repeat="message in model.allMessages"> <td>{{ message.to }}</td> <td>{{ message.message }}</td> <td> <button class="btn btn-­danger" ng-­click="delete(message.smsId);" ng­-disabled="model.isAjaxInProgress">Delete</button> </td> </tr> </table> </div> </div> The above code is commented and should be self explanatory. Conditional rendering is achieved through using the ng-­show=”condition” attribute on various div tags. Input fields are bound to the model and the send button is bound to the sendMessage() function in the controller as through the ng­click=”sendMessage()” attribute defined on the button tag. While AJAX calls are taking place, the controller sets model.isAjaxInProgress to true. Based on this variable, buttons are disabled through the ng-­disabled directive which is added as an attribute to the buttons. The ng-­repeat directive added as an attribute to the tr tag causes the table row to be rendered multiple times much like an ASP.NET repeater. 3. Creating the SmsController controller The penultimate piece of our application is the controller which responds to events from our view and interacts with our MVC4 REST WebAPI. The following listing shows the code we need to add to /app/js/controllers.js. Note that controller definitions can be chained. Also note that this controller “asks for” the $http service. The $http service is a simple way in Angular to do AJAX. So far we have only encountered modules, controllers, views and directives in Angular. The $http is new entity in Angular called a service. More information on Angular services can be found at the following URL: http://docs.angularjs.org/guide/dev_guide.services.understanding_services. .controller('SmsController', ['$scope', '$http', function ($scope, $http) { //We define the model $scope.model = {}; //We define the allMessages array in the model //that will contain all the messages sent so far $scope.model.allMessages = []; //The error if any $scope.model.errorMessage = undefined; //We initially load data so set the isAjaxInProgress = true; $scope.model.isAjaxInProgress = true; //Load all the messages $http({ url: '/api/smsresource', method: "GET" }). success(function (data, status, headers, config) { this callback will be called asynchronously //when the response is available $scope.model.allMessages = data; //We are done with AJAX loading $scope.model.isAjaxInProgress = false; }). error(function (data, status, headers, config) { //called asynchronously if an error occurs //or server returns response with an error status. $scope.model.errorMessage = "Error occurred status:" + status; //We are done with AJAX loading $scope.model.isAjaxInProgress = false; }); $scope.delete = function (id) { //We are making an ajax call so we set this to true $scope.model.isAjaxInProgress = true; $http({ url: '/api/smsresource/' + id, method: "DELETE" }). success(function (data, status, headers, config) { // this callback will be called asynchronously // when the response is available $scope.model.allMessages = data; //We are done with AJAX loading $scope.model.isAjaxInProgress = false; }); error(function (data, status, headers, config) { // called asynchronously if an error occurs // or server returns response with an error status. $scope.model.errorMessage = "Error occurred status:" + status; //We are done with AJAX loading $scope.model.isAjaxInProgress = false; }); } $scope.sendMessage = function () { $scope.model.errorMessage = undefined; var message = ''; if($scope.model.message != undefined) message = $scope.model.message.trim(); if ($scope.model.phoneNumber == undefined || $scope.model.phoneNumber == '' || $scope.model.phoneNumber.length < 10 || $scope.model.phoneNumber[0] != '+') { $scope.model.errorMessage = "You must enter a valid phone number in international format. Eg: +44 7778 609466"; return; } if (message.length == 0) { $scope.model.errorMessage = "You must specify a message!"; return; } //We are making an ajax call so we set this to true $scope.model.isAjaxInProgress = true; $http({ url: '/api/smsresource', method: "POST", data: { to: $scope.model.phoneNumber, message: $scope.model.message } }). success(function (data, status, headers, config) { // this callback will be called asynchronously // when the response is available $scope.model.allMessages = data; //We are done with AJAX loading $scope.model.isAjaxInProgress = false; }). error(function (data, status, headers, config) { // called asynchronously if an error occurs // or server returns response with an error status. $scope.model.errorMessage = "Error occurred status:" + status // We are done with AJAX loading $scope.model.isAjaxInProgress = false; }); } }]); We can see from the previous listing how the functions that are called from the view are defined in the controller. It should also be evident how easy it is to make AJAX calls to consume our MVC4 REST WebAPI. Now we are left with the final piece. We need to define a route that associates a particular path with the view we have defined and the controller we have defined. 4. Add a new route that loads the controller and the partial This is the easiest part of the puzzle. We simply define another route in the /app/js/app.js file: $routeProvider.when('/sms', { templateUrl: '/app/partials/smsview.html', controller: 'SmsController' }); Conclusion In this article we have seen how much of the server side functionality in the MVC4 framework can be moved to the browser thus delivering a snappy and fast user interface. We have seen how we can build client side HTML only views that avoid the messy syntax offered by server side Razor views. We have built a functioning app from the ground up. The significant advantage of this approach to building web apps is that the front end can be completely platform independent. Even though we used ASP.NET to create our REST API, we could just easily have used any other language such as Node.js, Ruby etc without changing a single line of our front end code. Angular is a rich framework and we have only touched on basic functionality required to create a SPA. For readers who wish to delve further into the Angular framework, we would recommend the following URL as a starting point: http://docs.angularjs.org/misc/started. To get started with the code for this project: Sign up for an account at http://plus.sent.ly (free) Add your phone number Go to the “My Identies Page” Note Down your Sender ID, Consumer Key and Consumer Secret Download the code for this article at: https://docs.google.com/file/d/0BzjEWqSE31yoZjZlV0d0R2Y3eW8/edit?usp=sharing Change the values of Sender Id, Consumer Key and Consumer Secret in the web.config file Run the project through Visual Studio!

  Read the article

• You Might Be a DBA

  - by BuckWoody

  With all apologies to Jeff Foxworthy, I was up late Friday night on a holiday weekend (which translated into T-SQL becomes “Maintenance Window”) and I got bored in between the two or three minutes I had between clicks. So I started a “Twitter” meme – and it just took off. I haven’t cleaned these up much, but here, in author order as of Saturday the 29th of May is the list “You might be a DBA” from around the Twitterverse: buckwoody Your two main enemies are developers and SAN admins #youmightbeaDBA  buckwoody People can use Access as a cross or garlic on you #youmightbeaDBA  buckwoody You always plan an exit strategy, even when entering a McDonald's #youmightbeaDBA  buckwoody You can't explain to your family what you really do for a living #youmightbeaDBA  buckwoody You have at least one set of scripts you won't share #youmightbeaDBA  buckwoody You have an opinion on the best code-beautifier #youmightbeaDBA  buckwoody You have children older than the rest of your team #youmightbeaDBA  buckwoody You and the Oracle DBA would kill each other, but you'll happily fight off a developer together first #youmightbeaDBA  buckwoody You've threatened to quit if they give anyone the sa password on production #youmightbeaDBA  buckwoody You've sent a vendor suggestions on improving their database design or code (and been ignored) #youmightbeaDBA  buckwoody You've sent a vendor suggestions on improving their database design or code (and been ignored) #youmightbeaDBA  buckwoody You have an opinion on the best code-beautifier #youmightbeaDBA  buckwoody You have at least one set of scripts you won't share #youmightbeaDBA  buckwoody You refer to co-workers as "carbon-units" #youmightbeaDBA  buckwoody Being paranoid is on your resume at the top #youmightbeaDBA  buckwoody Everyone comes to your cube to find the MSDN DVD's #youmightbeaDBA  buckwoody You always plan an exit strategy, even when entering a McDonald's #youmightbeaDBA  buckwoody You've worn down developers to get your way by explaining normalization levels #youmightbeaDBA  buckwoody You refer to clothes as "Data Abstractions" #youmightbeaDBA  buckwoody Users pester you to be able to put data in a database, then they pester you to take it out and put it in Excel #youmightbeaDBA  buckwoody Others try to de-duplicate data, you try to copy it to more than three locations #youmightbeaDBA  buckwoody You have at least one DLT tape in the trunk of your car #youmightbeaDBA  buckwoody You use twitter and facebook to talk with colleagues because there's no one else in your company that does what you do #youmightbeaDBA  buckwoody Your spouse knows what "ETL" means #youmightbeaDBA  buckwoody You've referred to yourself as the "Data Janitor" #youmightbeaDBA  buckwoody You don't have positive connotations of the word "upgrade" #youmightbeaDBA  buckwoody You get your coffee before you check your servers, because you know you won't get any if you don't #youmightbeaDBA  buckwoody You always come to work through the back door so no one hijacks you on the way to your cube #youmightbeaDBA  buckwoody You check your server logs before you check your e-mail in the morning so you can reply "Yeah, I already fixed that." #youmightbeaDBA  buckwoody You have more conference badges than clean socks #youmightbeaDBA  buckwoody Your coffee mug says "It depends" #youmightbeaDBA  buckwoody You can convince a boss that you need 16GB of RAM in your laptop #youmightbeaDBA  buckwoody You've used ebay to find production equipment #youmightbeaDBA  buckwoody You pad all project timelines by 2X, and you still miss them #youmightbeaDBA  buckwoody You know when your company is acquiring another even before the CFO #youmightbeaDBA  buckwoody You pad all project timelines by 2X, and you still miss them #youmightbeaDBA  buckwoody You call aspirin "work vitamins" #youmightbeaDBA  buckwoody You get the same amount of sleep even after you have a child #youmightbeaDBA  buckwoody You obsess about performance metrics from over one year ago #youmightbeaDBA  buckwoody The first thing you buy after the database software is aftermarket tools to manage the database software #youmightbeaDBA  buckwoody You've tried to convince someone else to become a DBA #youmightbeaDBA  buckwoody You use twitter and facebook to talk with colleagues because there's no one else in your company that does what you do #youmightbeaDBA  buckwoody You only know other DBA's by their Tweet Handle #youmightbeaDBA  buckwoody You've explained the difference between 32 and 64-bit to more than one manager in terms they can understand, using puppets #youmightbeaDBA  buckwoody Your two main enemies are developers and SAN admins #youmightbeaDBA  buckwoody You've driven to the Datacenter to install SQL Server because "you don't trust those NOC admins" #youmightbeaDBA  buckwoody You pay more for faster Internet connections than cable at home so you don't have to drive in #youmightbeaDBA  buckwoody You call texting a "queuing system" #youmightbeaDBA  buckwoody You know that if someone can read Perl, they manage an Oracle system #youmightbeaDBA  buckwoody You have an e-mail rule for backup notifications #youmightbeaDBA  buckwoody Your food pyramid includes coffee, salt and fat #youmightbeaDBA  buckwoody You wish everything had a graphical query plan #youmightbeaDBA  buckwoody You refactor your e-mails #youmightbeaDBA  buckwoody You've gotten more help from twitter and facebook than all your years in college #youmightbeaDBA  buckwoody You would pay money for a license plate that has the letters S-Q-L together #youmightbeaDBA  buckwoody You have actually considered making a RAID array from thumb drives #youmightbeaDBA  buckwoody Everything on your laptop is installed from your MSDN subscription #youmightbeaDBA  buckwoody You've written blog posts on technology you've never actually implemented in production #youmightbeaDBA  buckwoody Everything on your laptop is installed from your MSDN subscription #youmightbeaDBA  buckwoody @MidnightDBA Click the #youmightbeaDBA tag. I've had WAY too much coffee today.  buckwoody There is no other position that is 1-deep except you and the CEO #youmightbeaDBA  buckwoody When you watch "The Office" you call it "OJT" #youmightbeaDBA  buckwoody You would pay money for a license plate that has the letters S-Q-L together #youmightbeaDBA  buckwoody Your blog would make a "best practices" or "worst practices" book #youmightbeaDBA  buckwoody You have actually considered making a RAID array from thumb drives #youmightbeaDBA  buckwoody The first thing you install on your netbook is SSMS #youmightbeaDBA  buckwoody Everything on your laptop is installed from your MSDN subscription #youmightbeaDBA  buckwoody Your watch is set to UTC because it's just easier #youmightbeaDBA  buckwoody You make plenty of money, but you're excited to get a $2.00 squeeze-ball from Quest and Redgate #youmightbeaDBA  buckwoody You make plenty of money, but you're excited to get a $2.00 squeeze-ball from Quest and Redgate #youmightbeaDBA  buckwoody You think data can be represented as something OTHER than XML #youmightbeaDBA  buckwoody You tell people that you made a database query go faster, and expect them to be happy for you #youmightbeaDBA  buckwoody You take the word "NoSQL" as a personal attack #youmightbeaDBA  buckwoody People can use Access as a cross or garlic on you #youmightbeaDBA  buckwoody * == bad #youmightbeaDBA  buckwoody * == bad #youmightbeaDBA  buckwoody There are just as many females in your technical field as males #youmightbeaDBA  buckwoody People can use Access as a cross or garlic on you #youmightbeaDBA  buckwoody You've gotten more help from twitter and facebook than all your years in college #youmightbeaDBA  buckwoody You think that something OTHER than the database might be the performance bottleneck #youmightbeaDBA  buckwoody You refer to time as a "Clustered Index" #youmightbeaDBA  buckwoody You know why "user" refers to both business people and crack addicts #youmightbeaDBA  buckwoody You make plenty of money, but you're excited to get a $2.00 squeeze-ball from Quest and Redgate #youmightbeaDBA  buckwoody You can't explain to your family what you really do for a living #youmightbeaDBA  buckwoody You tell people that you made a database query go faster, and expect them to be happy for you #youmightbeaDBA  buckwoody You think a millisecond is a really long time #youmightbeaDBA  buckwoody You're sitting and typing #youmightbeaDBA when you could be outside #youmightbeaDBA  buckwoody You can't wait for a technical conference so you can wear a kilt - and you're not Scottish #youmightbeaDBA  buckwoody You know that "DBA" stands for "Default Blame Acceptor" #youmightbeaDBA  buckwoody People can use Access as a cross or garlic on you #youmightbeaDBA  buckwoody You know what "the truth, thole truth and nothing but the truth, so help me Codd" means #youmightbeaDBA  buckwoody You've gotten more help from twitter and facebook than all your years in college #youmightbeaDBA  buckwoody You can't talk fast enough to get a concept out of your head so you tweet it instead #youmightbeaDBA  buckwoody You cry when someone doesn't use a WHERE clause #youmightbeaDBA  buckwoody You think data can be represented as something OTHER than XML #youmightbeaDBA  buckwoody You think "Set theory" is not an verb but a noun #youmightbeaDBA  buckwoody You try to convince random strangers to vote on your Connect item #youmightbeaDBA  buckwoody You think 3 hours of contiguous sleep is a good thing #youmightbeaDBA or #youmightbeamother  buckwoody You don't like Oracle, and not just because of what she did to Neo #youmightbeaDBA  buckwoody You know when to say "sequel" and "s-q-l" #youmightbeaDBA  buckwoody You know where the data is #youmightbeaDBA  buckwoody You refer to your children as "Fully Redundant Mirrors" #youmightbeaDBA  buckwoody Holiday == "Maintenance Window" #youmightbeaDBA  buckwoody Your laptop is more powerful than the servers in most companies - including your own #youmightbeaDBA  buckwoody You capitalize SELECTed words #youmightbeaDBA  buckwoody You take the word "NoSQL" as a personal attack #youmightbeaDBA  buckwoody You know why "user" refers to both business people and crack addicts #youmightbeaDBA  buckwoody You cringe in public when the word "upgrade" is used in a sentence #youmightbeaDBA  buckwoody Holiday == "Maintenance Window" #youmightbeaDBA  buckwoody All Data Is MetaData means something to you #youmightbeaDBA  buckwoody You've never seen the driveway to your house in the daylight #youmightbeaDBA  buckwoody You think that something OTHER than the database might be the performance bottleneck #youmightbeaDBA  buckwoody Most of your bloodstream is composed of caffeine #youmightbeaDBA  buckwoody Your task list is labeled "CRUD Matrix" #youmightbeaDBA  buckwoody You call your wife/husband a "Linked Server" #youmightbeaDBA  anonythemouse When someone tells you they are going to take a dump and you wonder of which database then #youmightbeaDBA  anonythemouse When it's 11pm on a holiday weekend and you are working #youmightbeaDBA  anonythemouse When you sit down at a table and look for it's primary key #youmightbeaDBA  anonythemouse When getting milk from the fridge you check the expiry date is > getdate() #youmightbeaDBA  blakmk when you wake up dreaming about sql #youmightbeaDBA  CharlesGarver You think a @buckwoody bobblehead would be a cool thing to have on the dashboard of your car #youmightbeaDBA  CharlesGarver Your friends don't understand why you think there's a difference between single and double quotes #youmightbeaDBA  CharlesGarver Even the newest employees know your name from all the downtime notices you've sent out #youmightbeaDBA  CharlesGarver You sometimes feel anxious and think "I should test restoring those backups" and then the feeling passes #youmightbeadba  CharlesGarver You know what a co-worker means when they ask "how is your squirrel server?" #youmightbeadba  CharlesGarver You can't sleep at night and you ponder the logisitcs of collecting every copy of Access for the world's biggest bonfire #youmightbeaDBA  CharlesGarver You can't sleep at night and you ponder the logisitcs of collecting every copy of Access for the world's biggest bonfire #youmightbeaDBA  CharlesGarver You're willing to move someone's job up in priority for a box of #voodoodonuts #youmightbeaDBA  CharlesGarver Each person in your company seems to think you work for THEM #youmightbeaDBA  CharlesGarver You have a Love/Hate relationship going on with #Microsoft #youmightbeaDBA  CharlesGarver People ask you to troubleshoot their Access program #youmightbeaDBA  CharlesGarver The first words you hear in the morning are 'your voicemail box is full' #youmightbeaDBA  CharlesGarver The thought of disrupting 500 people's work so you can do something doesn't phase you #youmightbeaDBA  CharlesGarver You can't sleep at night and you ponder the logisitcs of collecting every copy of Access for the world's biggest bonfire #youmightbeaDBA  CharlesGarver Your home computer is backed up in 3 different places #youmightbeaDBA  CharlesGarver Your wardrobe for work includes pajamas #youmightbeaDBA  CharlesGarver Someone tells you to look in the INDEX and you look puzzled before finally going to the back of the book. #youmightbeaDBA  chuckboycejr If you have ever set up a SQLAgent job to email your mobile phone to serve as an alarm clock #youmightbeaDBA  chuckboycejr If you'd rather meet Itzik than Jay Z #youmightbeaDBA  chuckboycejr If you'd rather meet Itzik than Jay Z #youmightbeaDBA  chuckboycejr If you'd wrestle a SysAdmin to the ground to implement #DPA best practices as per @aspiringgeek #youmightbeaDBA  databaseguy I need to be up in 7 hours, so I'm off to bed! I'll have to read the rest of @buckwoody's #youmightbeaDBA posts in the AM. (g'night Buck!)  databaseguy When people ask you about your house, the first thing you describe is the network. #youmightbeaDBA  databaseguy The last thing you say at the office each day is, "is anybody else here? I'm shutting off the lights!" #youmightbeaDBA  databaseguy Your blood pressure rises when you read application specs drafted by marketing. #youmightbeaDBA  databaseguy A good day at work is one when nobody pays you no mind. #youmightbeaDBA  databaseguy You care about latches and wait states. #youmightbeaDBA  databaseguy You have worked over 200 hours on a performance tuning project that required no application changes at all. #youmightbeaDBA  databaseguy The late-night security guard knows the names of your spouse and kids. #youmightbeaDBA  databaseguy You have had vigorous debates about whether it should be pronounced "sequel" or "ess-queue-ell". #youmightbeaDBA  databaseguy You have VPN and RDP software installed on your phone ... just in case. #youmightbeaDBA  databaseguy You have edited a data file by hand, just to see what would happen. #youmightbeaDBA  databaseguy You decorate your office walls with database catalog posters. #youmightbeaDBA  databaseguy You've built programs that access data just to keep other developers from asking you to run queries all the time. #youmightbeaDBA  databaseguy When you watch movies like The Matrix, you find yourself calculating the fasibility of storing all that data. #youmightbeaDBA  databaseguy You have tried to convince someone to spend money on an SSD storage array. #youmightbeaDBA  databaseguy When CPU is spiked on a server, you want to gather forensic evidence. #youmightbeaDBA  databaseguy You have to remind developers not to push code to production without checking if the database is ready. #youmightbeaDBA  databaseguy Nobody cares what you wear to work, as long as the thing keeps running. #youmightbeaDBA  databaseguy Telepathy is a job requirement when working with app dev teams. #youmightbeaDBA  databaseguy You read database statistics for the educational value. #youmightbeaDBA  databaseguy And your boss freely admits this to anyone within earshot. #youmightbeaDBA  databaseguy Your boss cannot explain or understand what you do. #youmightbeaDBA  databaseguy You envision ERDs when you see a GUI. #youmightbeaDBA  databaseguy You say things like "applications come and go, but data lasts forever." #youmightbeaDBA  databaseguy You have memorized the names of several of the AdventureWorks employees. #youmightbeaDBA  databaseguy You know what MAXDOP setting you can get away with for a big query based on current server load. #youmightbeaDBA  databaseguy And you immediately recognize the recursion in my last tweet. #youmightbeaDBA  databaseguy You find 50 simultaneous tweets from @buckwoody about #youmightbeaDBA :O)  DBAishness You have "funny stories" about the times your developers accidentally deleted the T-log in their test environment. #youmightbeaDBA  DBAishness Planning to slice and dice your MDW data with PowerPivot makes you giggle like a schoolgirl. #youmightbeaDBA  donalddotfarmer You think @buckwoody lives in the "real world." #youmightbeaDBA  jamach09 @buckwoody #youmightbeaDBA Why go outside when you can sit in the nice cool server room?  jamach09 If you refer to procreation as "Replication", #youmightbeaDBA.  jamach09 If you think ORM is a four-letter word, #youmightbeaDBA  JamesMarsh If you have ever preached the value of Source Code Control, #YouMightBeADBA  jethrocarr @venzann You store your shopping list in a ACID compliant DB #youmightbeaDBA  joe_positive @buckwoody thought it stood for "Don't Bother Asking" #youmightbeaDBA  joe_positive when you check your IT Events Calendar before making weekend plans #youmightbeaDBA  LadyRuna You cringe whenever someone calls Excel a database #youmightbeaDBA  LadyRuna When the waiter says he'll be your server today, you ask how many terabytes he is #youmightbeaDBA  LadyRuna you always call the asterisk a "Star" #youmightbeaDBA  LadyRuna You walk into a server room, say "Nice RACK!" and everyone there knows you're talking about server rack... #youmightbeaDBA  LadyRuna You receive more messages from servers than from friends #youmightbeaDBA  LadyRuna hmmm... #youmightbeaDBA if your recipe for gumbo is "SELECT * FROM Refrigerator"  markjholmes @SQLSoldier Heh. #youmightbeaDBA if you correct other DBAs' spelling of @PaulRandal  markjholmes #youmightbeaDBA if you actually test RAID5 vs RAID10 on your SAN because when it comes to configuration, "it depends."  markjholmes #youmightbeaDBA if you have at least 3 definitions of the word "cluster"  MarlonRibunal 3 Words: @BrentO, snicker, & Access #youmightbeaDBA  MarlonRibunal @onpnt @mikeSQL my appeal was a couple of mins late. Enjoying #youmightbeaDBA  MarlonRibunal @mikeSQL @onpnt pls, don't mention bacon #youmightbeaDBA  merv @buckwoody You HATE 3-way joins #youmightbeaDBA  MidnightDBA If you're up at midnight Tweeting about SQL #youmightbeaDBA  MidnightDBA @buckwoody I'd noticed that. :) #youmightbeaDBA  mikeSQL when people talk about "their type" you're thinking varchar, bigint, binary, etc #youmightbeadba  mikeSQL people ask you to go to lunch , but you can't go because you're attending #SQLlunch #youmightbeadba  mikeSQL you laugh for hours at all of the #sqlmoviequotes ....things in which a normal individual would scratch their head at. #youmightbeadba  mikeSQL you laugh for hours at all of the #sqlmoviequotes ....things in which a normal individual would scratch their head at. #youmightbeadba  mrdenny If you think that @buckwoody's demo using PowerPivot to analyze index usage data from DMVs is awesome then #youmightbeaDBA  mrdenny You wish @PaulRandal still worked at Microsoft so that they would make a bobble head of him #youmightbeadba  mrdenny When it's 11pm on a holiday weekend, and your posting stupid jokes on Twitter then #youmightbeadba  mrdenny If you go out with friends and wonder why no one's wearing a kilt then #YouMightBeADBA  mrdenny You can't do basic math, but you know off the top of your head how many CALs $14,412 can buy you. #YoumightbeaDBA  mrdenny If you've ever setup a SQL Job to email you to get you out of a regularly scheduled meeting #YouMightBeADBA.  mrdenny You throw up in your mouth a little when ever you here the word "Access". Even if it doesn't relate to a MS product. #YouMightBeADBA  msdtjones You spend more time listening to @buckwoody than your wife #youmightbeaDBA  NFDotCom You perform "hail deltas" on a regular basis. #YouMightBeADBA  NoelMcKinney If you tell your wife you want to go to Columbus Ohio for your wedding anniversary so you can attend #sqlsat42 then #youmightbeaDBA  NoelMcKinney You read a union is on strike and wonder if it's a UNION ALL #youmightbeaDBA  NoelMcKinney You read a union is on strike and wonder if it's a UNION ALL #youmightbeaDBA  NoelMcKinney Someone asks you to throw another log on the fire and you tell them not to worry about it because Autogrowth is turned on #youmightbeaDBA  Nuurdygirl Even if you have a girlfriend...its possible #youmightbeadba. Yeah-i said its possible!  Nuurdygirl When your girlfriend has to lean around the laptop to kiss you goodnight #youmightbeadba  Old_Man_Fish If you worry about how big your package is and how long it takes to finish #youmightbeaDBA  Old_Man_Fish If you no longer wonder if someone is in trouble or died if you are getting calls at 2AM #youmightbeaDBA  Old_Man_Fish If, when you hear the word ACCESS with no connotation you blood pressure jumps 50 points, #youmightbeaDBA  onpnt When you hear the word inject you immediately get concerned if your databases are OK #youmightbeaDBA  onpnt Your servers haven't been rebooted in a year #youmightbeaDBA  onpnt You know why it's funny when @PaulRandal has the word, "Sheep" in a tweet #youmightbeaDBA  onpnt You have read BOL without actually having a problem to figure out #youmightbeaDBA  onpnt You can type "SELECT columns FROM tables" without typos but tipen ni Banglish ares a messis #youmightbeaDBA  onpnt DR strategies doesn't include the word, RAID in them #youmightbeaDBA  onpnt you can move a SQL Server instance to a new server without the users ever knowing #youmightbeaDBA  onpnt You have made an SSIS package that is more than one step #youmightbeaDBA  onpnt You have the balls to say no to your boss when they ask for the sa password #youmightbeaDBA  onpnt you google to trouble shoot a problem and end up at your own blog (and it fixes it) #youmightbeaDBA  onpnt You talk your wife into moving the family vacation a week earlier so you can attend the areas local SSUG meeting #youmightbeaDBA  onpnt you can explain to a nontechnical person what a deadlock is #youmightbeaDBA  onpnt You hope a girl asks you what your collation is #youmightbeaDBA  onpnt you make jokes that include the words shrink, truncate and 1205. And you are the only one that laughs at them #youmightbeaDBA  onpnt You rate your ability to stay awake to work longer on blogs, twitter, forums and your day to day job with the 5 9's goal #youmightbeaDBA  onpnt you have major surgery and beg the doctor to release you back to work 5 days later because you miss your servers #youmightbeaDBA #TrueStory  onpnt You do have backups and you know how to use them #youmightbeaDBA  onpnt It's the network #youmightbeaDBA  onpnt When the developers get to work your mood changes rapidly #youmightbeaDBA  onpnt When someone says, "PASS", you first think of karaoke #youmightbeaDBA  onpnt Recruiters try to get you to call them *just* because they think you'll give them @BrentO contact info #youmightbeaDBA  onpnt You chuckle every time you go to grab the "CLR" Calcium, Lime and Rust Remover to clean something #youmightbeaDBA  onpnt @MarlonRibunal @mikeSQL Sorry man, it was already in motion ;-) #youmightbeaDBA  onpnt When you have an "I love bacon" sticker on your laptop. #youmightbeaDBA http://twitpic.com/1ry671  onpnt You sing SELECT statements in the shower #youmightbeaDBA  onpnt When you see a chicken it doesn't remind you of food. It reminds you of a guy named Jorge #youmightbeaDBA  onpnt At time, SQL is your mistress #youmightbeaDBA  onpnt Your wife wonders if SQL is the code name of your mistress at times #youmightbeaDBA  onpnt it's Friday and you are on twitter thinking really hard about what would be funny for hash tag #youmightbeaDBA  onpnt You organize your wife's "decorative"pillows on the bed in a B-Tree structure #youmightbeaDBA  PaulWhiteNZ If you: SELECT TOP (1) milk FROM fridge WHERE use_by_date >= GET_DATE() ORDER BY use_by_date ASC #YouMightBeaDBA  RonDBA #youmightbeaDBA if you read @buckwoody's and @BrentO's blogs.  ryaneastabrook @buckwoody omg, you have to stand up a website with these on them, they are awesome #youmightbeaDBA  soulvy @StrateSQL @LadyRuna Or a "Splat" #youmightbeaDBA  speedracer You can still fall asleep after three cups of coffee #youmightbeaDBA  speedracer You retweet @buckwoody on a Friday night #youmightbeaDBA  speedracer You can still fall asleep after three cups of coffee #youmightbeaDBA  speedracer Developers make you twitch #youmightbeaDBA  sqlagentman You know what X/1024*8 is. #YouMightBeADBA  SqlAsylum Your still in the office at 5:00 on memorial day weekend. #youmightbeadba :)  SQLBob Whenever someone you know gets pregnant you bring up INNER JOINs or SQL Injection attacks... #youmightbeaDBA  SQLChicken You know one or more SQL folks in the community with an animal in their username #youmightbeaDBA  SQLChicken You've used one or more car analogies to explain how a database works #youmightbeaDBA  SQLChicken “@sqljoe: #youmightbeaDBA if you applied to attend #sqlu and requested @SQLChicken to pull strings for you” lmao nice!  SQLChicken When talking about SSIS your discussions break down into various jokes about packages #youmightbeaDBA  SQLChicken Just SEEING the code for cursors makes you break out in hives #youmightbeaDBA  SQLChicken Just SEEING the code for cursors makes you break out in hives #youmightbeaDBA  SQLCraftsman You coined the phrase "Magic SAN Dust" because calling a vendor's marketing claims BS is not acceptable in a meeting. #YouMightBeADBA  SQLCraftsman If you hear about a new feature with the acronym "DAC" and wonder what disaster of a feature it is attached to this time. #YouMightBeADBA  SQLCraftsman You really own a "Stick of Much Developer Whacking" #YouMightBeADBA  SQLCraftsman You coined the phrase "Magic SAN Dust" because calling a vendor's marketing claims BS is not acceptable in a meeting. #YouMightBeADBA  SQLCraftsman Default Blame Acceptor #YouMightBeADBA  SQLCraftsman If you hear about a new feature with the acronym "DAC" and wonder what disaster of a feature it is attached to this time. #YouMightBeADBA  SQLCraftsman Default Blame Acceptor #YouMightBeADBA  SQLCraftsman If you hear about a new feature with the acronym "DAC" and wonder what disaster of a feature it is attached to this time. #YouMightBeADBA  sqljoe #youmightbeaDBA if you wished your wife knew T-sql. USE ShoppingList SELECT NecessaryItems from Supermarket WHERE Category<> ("junk food")  sqljoe #youmightbeaDBA if the first thing you kiss when you wake up is your mobile for not waking you up in the middle of the night  sqljoe #youmightbeaDBA if your wife has a "Do Not Fly" family vacation list of her own including your laptop and mobile  sqljoe #youmightbeaDBA if you have researched for DBA Anonymous groups and attended a #SSUG willing to drop your database (vice)  sqljoe #youmightbeaDBA if your only maintenance windows are staff meetings  sqljoe #youmightbeaDBA if you think of yourself as "The One" in The Matrix "balancing the equation" from The Architect's (developers) poor coding  sqljoe #youmightbeaDBA if you think @PaulRandal should have played the Oracle in The Matrix  sqljoe #youmightbeaDBA if home CD & Movie collection is stored in secured containers,in logical order & naming convention,and with a backup copy  sqljoe #youmightbeaDBA if you applied to attend #sqlu and requested @SQLChicken to pull strings for you  sqljoe #youmightbeaDBA if you have tried to TiVo @MidnightDBA broadcasts  sqljoe #youmightbeaDBA if your #sql user group feels like #AA meetings  sqljoe #youmightbeaDBA if you thought of bringing your #sql books to #sqlsaturday and #sqlpass for autographs  sqljoe #youmightbeaDBA if #sqlpass feels like the #oscars  sqljoe #youmightbeaDBA if you are proud of your small package  SQLLawman #youmightbeaDBA when you hear MDX and Acura is not first thought that comes to mind.  sqlrunner If your wife double checks that there isn't a SQLSat within 200 miles of your vacation destination #youmightbeaDBA  sqlrunner When you're on a conference call and your wife thinks your speaking in a foreign language #youmightbeaDBA  sqlrunner When you're on a conference call and your wife thinks your speaking in a foreign language #youmightbeaDBA  sqlrunner You treat the word 'access' as a verb, not a noun #youmightbeaDBA  sqlrunner If you are happy with sub-second performance #youmightbeaDBA  sqlrunner When you know the names of the NOC people AND their families #youmightbeadba  sqlrunner When you know the names of the NOC people AND their families #youmightbeadba  sqlrunner Your company set's up international phone coverage for your cruise #youmightbeaDBA  sqlsamson @buckwoody if your manager asks you for data and you respond with "there's a script for that" #youmightbeadba  sqlsamson @buckwoody If you receive more messages from your server then your spouse #youmightbeadba  SQLSoldier You've spent all night Valentines Day upgrading the SQL Servers and forgot to tell your wife you'd be working late. #youmightbeadba  SQLSoldier You're flattered when someone calls you a geek. #youmightbeadba  SQLSoldier @llangit @mrdenny it's 11pm on a holiday weekend, & your reading stupid jokes on Twitter then #youmightbeadba  SQLSoldier Your manager borrows lunch money from you because your salary is 30% higher than his. #youmightbeaDBA  SQLSoldier You think "intellisense" is a double negative because it's not intelligent nor makes sense. #youmightbeaDBA  SQLSoldier 75% of the emails you receive at home have the phrase "now following you on Twitter!" in the subject line. #youmightbeaDBA  SQLSoldier You petition Ken Burns to remake Office Space because it should have been 18 hours long. #youmightbeaDBA  SQLSoldier You select a candidate for a Jr DBA position because his resume said he's willing to get your coffee. #youmightbeaDBA  SQLSoldier Somebody misquotes @PaulRandall and you call him on your cell to verify. #youmightbeaDBA  SQLSoldier You wish the elevator in your building was slower because it's the last time you'll be left alone all day. #youmightbeaDBA  SQLSoldier The developers sacrifice small animals before giving you their code for review. #youmightbeaDBA  SQLSoldier Developers bring you coffee and a BLT when you review their code. #youmightbeaDBA #IWish  SQLSoldier You can get out of any family get-together by saying you have to work and nobody questions it. #youmightbeaDBA  SQLSoldier You've requested a HP Superdome for you "test" box. #youmightbeaDBA  SQLSoldier Your leave work early because your internet connection to the data center is better at home #youmightbeaDBA  SQLSoldier The new CEO asks you to justify your salary, so you go on vacation for 2 weeks. And he never questions you again. #youmightbeaDBA  SQLSoldier You cheer when Milton burns down the company in Office Space #youmightbeaDBA  SQLSoldier A dev. asks if you've heard about some great new feature in SQL and you show the 16 blog posts you wrote on it ... last year #youmightbeaDBA  SQLSoldier Your dev team is still testing SQL 2008 and you're already planning for SQL 11. #youmightbeaDBA #TrueStory  SQLSoldier The new CEO asks you to justify your salary, so you go on vacation for 2 weeks. And he never questions you again. #youmightbeaDBA  SQLSoldier Your dev team is still testing SQL 2008 and you're already planning for SQL 11. #youmightbeaDBA  SQLSoldier You use a cell phone service coverage map to plan your next vacation. #youmightbeaDBA  SQLSoldier You come in to work at 7 AM because it gives you at least 3 hours without any developers around. #youmightbeaDBA  SQLSoldier You figure out a way to make take your wife on a cruise and deduct it as a business expense. #youmightbeaDBA #sqlcruise  SQLSoldier You name your cat SQLDog because the name @SQLCat was already taken. #youmightbeaDBA  SQLSoldier You rate your blog posts based on the number of retweets you get. #youmightbeaDBA  SQLSoldier You disable random logins just to mess with people. #youmightbeaDBA  SQLSoldier You fall for the pickup line, "Hey baby, what's your collation?" #youmightbeaDBA  SQLSoldier You can blame an outage on anyone in the company because you're the only one that knows how to find out what really happened #youmightbeaDBA  SQLSoldier You can blame an outage on anyone in the company because you're the only one that knows how to find out what really happened #youmightbeaDBA  SQLSoldier You cheer when Milton burns down the company in Office Space #youmightbeaDBA  SQLSoldier Your leave work early because your internet connection to the data center is better at home #youmightbeaDBA  SQLSoldier You cheer when Milton burns down the company in Office Space #youmightbeaDBA  SQLSoldier Your think the 4 food groups are coffee, bacon, fast food, and Mountain Dew. #youmightbeaDBA  SQLSoldier You tell someone your job title and they ask "What?" You describe it and they ask "What?". So you say "computer geek". #youmightbeaDBA  SQLSoldier The #1 referrer to your blog is Twitter.com. #youmightbeaDBA  SQLSoldier Your idea of a good time on a Saturday involves free training. #youmightbeaDBA #sqlsat43  SQLSoldier You write a book that all of your co-workers have and none have read it. #youmightbeaDBA  SQLSoldier You write a book that sells a couple thousand copies and is heralded a best seller. #youmightbeaDBA  SQLSoldier No matter how sick you are, you go to work if it's time to pass the pager on to the next guy. #youmightbeaDBA #TrueStory  SQLSoldier You go out on the town, and strangers walk up to you and say, "Hey you're that SQL guy" #youmightbeaDBA #TrueStory  SQLSoldier Your wife asks you to fix something, and you request a downtime window. #youmightbeaDBA  SQLSoldier Your wife asks when you'll be home, and you tell her that you wish you knew. #youmightbeaDBA  SQLSoldier Your best pickup line, "Hey baby, what's your collation?" #youmightbeaDBA  SQLSoldier Your wife asks when you'll be home, and you tell her that you wish you knew. #youmightbeaDBA  SQLSoldier You know that @BuckWoody is not someone's porno name. #youmightbeaDBA  SQLSoldier You list TSQL as your native language on the 2010 census. #youmightbeaDBA  SQLSoldier Starbucks' stock price drops every time you go on vacation. #youmightbeaDBA  SQLSoldier You're happy when the web master says that the website is down. #youmightbeaDBA  SQLSoldier You know that @BuckWoody is not someone's porno name. #youmightbeaDBA  SQLSoldier You get mad when someone calls your car a "heap" because you've always considered it to be a "clustered index". #youmightbeaDBA  SQLSoldier Your blog has more hits than your company's website. #youmightbeaDBA  SQLSoldier You systematically remove the asterisk key from all keyboards in the company except yours. #youmightbeaDBA  SQLSoldier When asked if you recycle, you reply that you run sp_cycle_errorlog every night at midnight #youmightbeaDBA  SQLSoldier You wouldn't allow someone named @AdamMachanic to work on your car. #youmightbeaDBA  SQLSoldier You switch offices every 3 days to avoid developers #youmightbeaDBA  SQLSoldier PSS has your number on speed dial. #youmightbeaDBA  SQLSoldier You frown when you they tell Neo that he's going to the Oracle #youmightbeaDBA  swhaley you regretted saying "This shouldn't effect production" #youmightbeaDBA  swhaley you regretted saying "This shouldn't effect production" #youmightbeaDBA  Tarwn A pleasurable saturday means spending the day learning more about what you already do the rest of the week #youmightbeaDBA ...oh, wait...  thelostforum For great justice; all our base are belong to YOU !! #youmightbeadba  thelostforum @SQLSoldier: You need a witness to use a mirror #youmightbeaDBA ;)  TimCost you capitalize key words. always. everywhere. you can't help it, usually don't even notice. #youmightbeaDBA  Toshana Your the only one in your company not impressed with the developers new application. #youmightbeaDBA  venzann Coming soon from a (respected) book publisher - @buckwoody's #youmightbeaDBA  venzann He's on a role tonight. @buckwoody is summing up my life with his #youmightbeaDBA tweets...  venzann I love the #youmightbeaDBA tag. Found at least 6 new DBAs to follow..  venzann He's on a role tonight. @buckwoody is summing up my life with his #youmightbeaDBA tweets...  venzann You use #sqlhelp as a primary resource during troubleshooting #youmightbeaDBA  venzann You insist on stricter password security for your sql servers than you implement on your own laptop #youmightbeaDBA  WesBrownSQL @buckwoody you are up so late the only tweets you see are from @buckwoody #youmightbeaDBA  WesBrownSQL @SQLSoldier you are upgrading all your 2005 prod servers to 2008 R2 on a three day weekend... #youmightbeaDBA  zippy1981 #youmightbeaDBA if everytime you do something with #mongodb you think of the Vulcan proverb "only Nixon could go to China."  Share this post: email it! | bookmark it! | digg it! | reddit! | kick it! | live it!

  Read the article

• Using HTML 5 SessionState to save rendered Page Content

  - by Rick Strahl

  HTML 5 SessionState and LocalStorage are very useful and super easy to use to manage client side state. For building rich client side or SPA style applications it's a vital feature to be able to cache user data as well as HTML content in order to swap pages in and out of the browser's DOM. What might not be so obvious is that you can also use the sessionState and localStorage objects even in classic server rendered HTML applications to provide caching features between pages. These APIs have been around for a long time and are supported by most relatively modern browsers and even all the way back to IE8, so you can use them safely in your Web applications. SessionState and LocalStorage are easy The APIs that make up sessionState and localStorage are very simple. Both object feature the same API interface which  is a simple, string based key value store that has getItem, setItem, removeitem, clear and  key methods. The objects are also pseudo array objects and so can be iterated like an array with  a length property and you have array indexers to set and get values with. Basic usage  for storing and retrieval looks like this (using sessionStorage, but the syntax is the same for localStorage - just switch the objects):// set var lastAccess = new Date().getTime(); if (sessionStorage) sessionStorage.setItem("myapp_time", lastAccess.toString()); // retrieve in another page or on a refresh var time = null; if (sessionStorage) time = sessionStorage.getItem("myapp_time"); if (time) time = new Date(time * 1); else time = new Date(); sessionState stores data that is browser session specific and that has a liftetime of the active browser session or window. Shut down the browser or tab and the storage goes away. localStorage uses the same API interface, but the lifetime of the data is permanently stored in the browsers storage area until deleted via code or by clearing out browser cookies (not the cache). Both sessionStorage and localStorage space is limited. The spec is ambiguous about this - supposedly sessionStorage should allow for unlimited size, but it appears that most WebKit browsers support only 2.5mb for either object. This means you have to be careful what you store especially since other applications might be running on the same domain and also use the storage mechanisms. That said 2.5mb worth of character data is quite a bit and would go a long way. The easiest way to get a feel for how sessionState and localStorage work is to look at a simple example. You can go check out the following example online in Plunker: http://plnkr.co/edit/0ICotzkoPjHaWa70GlRZ?p=preview which looks like this: Plunker is an online HTML/JavaScript editor that lets you write and run Javascript code and similar to JsFiddle, but a bit cleaner to work in IMHO (thanks to John Papa for turning me on to it). The sample has two text boxes with counts that update session/local storage every time you click the related button. The counts are 'cached' in Session and Local storage. The point of these examples is that both counters survive full page reloads, and the LocalStorage counter survives a complete browser shutdown and restart. Go ahead and try it out by clicking the Reload button after updating both counters and then shutting down the browser completely and going back to the same URL (with the same browser). What you should see is that reloads leave both counters intact at the counted values, while a browser restart will leave only the local storage counter intact. The code to deal with the SessionStorage (and LocalStorage not shown here) in the example is isolated into a couple of wrapper methods to simplify the code: function getSessionCount() { var count = 0; if (sessionStorage) { var count = sessionStorage.getItem("ss_count"); count = !count ? 0 : count * 1; } $("#txtSession").val(count); return count; } function setSessionCount(count) { if (sessionStorage) sessionStorage.setItem("ss_count", count.toString()); } These two functions essentially load and store a session counter value. The two key methods used here are: sessionStorage.getItem(key); sessionStorage.setItem(key,stringVal); Note that the value given to setItem and return by getItem has to be a string. If you pass another type you get an error. Don't let that limit you though - you can easily enough store JSON data in a variable so it's quite possible to pass complex objects and store them into a single sessionStorage value:var user = { name: "Rick", id="ricks", level=8 } sessionStorage.setItem("app_user",JSON.stringify(user)); to retrieve it:var user = sessionStorage.getItem("app_user"); if (user) user = JSON.parse(user); Simple! If you're using the Chrome Developer Tools (F12) you can also check out the session and local storage state on the Resource tab:   You can also use this tool to refresh or remove entries from storage. What we just looked at is a purely client side implementation where a couple of counters are stored. For rich client centric AJAX applications sessionStorage and localStorage provide a very nice and simple API to store application state while the application is running. But you can also use these storage mechanisms to manage server centric HTML applications when you combine server rendering with some JavaScript to perform client side data caching. You can both store some state information and data on the client (ie. store a JSON object and carry it forth between server rendered HTML requests) or you can use it for good old HTTP based caching where some rendered HTML is saved and then restored later. Let's look at the latter with a real life example. Why do I need Client-side Page Caching for Server Rendered HTML? I don't know about you, but in a lot of my existing server driven applications I have lists that display a fair amount of data. Typically these lists contain links to then drill down into more specific data either for viewing or editing. You can then click on a link and go off to a detail page that provides more concise content. So far so good. But now you're done with the detail page and need to get back to the list, so you click on a 'bread crumbs trail' or an application level 'back to list' button and… …you end up back at the top of the list - the scroll position, the current selection in some cases even filters conditions - all gone with the wind. You've left behind the state of the list and are starting from scratch in your browsing of the list from the top. Not cool! Sound familiar? This a pretty common scenario with server rendered HTML content where it's so common to display lists to drill into, only to lose state in the process of returning back to the original list. Look at just about any traditional forums application, or even StackOverFlow to see what I mean here. Scroll down a bit to look at a post or entry, drill in then use the bread crumbs or tab to go back… In some cases returning to the top of a list is not a big deal. On StackOverFlow that sort of works because content is turning around so quickly you probably want to actually look at the top posts. Not always though - if you're browsing through a list of search topics you're interested in and drill in there's no way back to that position. Essentially anytime you're actively browsing the items in the list, that's when state becomes important and if it's not handled the user experience can be really disrupting. Content Caching If you're building client centric SPA style applications this is a fairly easy to solve problem - you tend to render the list once and then update the page content to overlay the detail content, only hiding the list temporarily until it's used again later. It's relatively easy to accomplish this simply by hiding content on the page and later making it visible again. But if you use server rendered content, hanging on to all the detail like filters, selections and scroll position is not quite as easy. Or is it??? This is where sessionStorage comes in handy. What if we just save the rendered content of a previous page, and then restore it when we return to this page based on a special flag that tells us to use the cached version? Let's see how we can do this. A real World Use Case Recently my local ISP asked me to help out with updating an ancient classifieds application. They had a very busy, local classifieds app that was originally an ASP classic application. The old app was - wait for it: frames based - and even though I lobbied against it, the decision was made to keep the frames based layout to allow rapid browsing of the hundreds of posts that are made on a daily basis. The primary reason they wanted this was precisely for the ability to quickly browse content item by item. While I personally hate working with Frames, I have to admit that the UI actually works well with the frames layout as long as you're running on a large desktop screen. You can check out the frames based desktop site here: http://classifieds.gorge.net/ However when I rebuilt the app I also added a secondary view that doesn't use frames. The main reason for this of course was for mobile displays which work horribly with frames. So there's a somewhat mobile friendly interface to the interface, which ditches the frames and uses some responsive design tweaking for mobile capable operation: http://classifeds.gorge.net/mobile  (or browse the base url with your browser width under 800px)   Here's what the mobile, non-frames view looks like:   As you can see this means that the list of classifieds posts now is a list and there's a separate page for drilling down into the item. And of course… originally we ran into that usability issue I mentioned earlier where the browse, view detail, go back to the list cycle resulted in lost list state. Originally in mobile mode you scrolled through the list, found an item to look at and drilled in to display the item detail. Then you clicked back to the list and BAM - you've lost your place. Because there are so many items added on a daily basis the full list is never fully loaded, but rather there's a "Load Additional Listings"  entry at the button. Not only did we originally lose our place when coming back to the list, but any 'additionally loaded' items are no longer there because the list was now rendering  as if it was the first page hit. The additional listings, and any filters, the selection of an item all were lost. Major Suckage! Using Client SessionStorage to cache Server Rendered Content To work around this problem I decided to cache the rendered page content from the list in SessionStorage. Anytime the list renders or is updated with Load Additional Listings, the page HTML is cached and stored in Session Storage. Any back links from the detail page or the login or write entry forms then point back to the list page with a back=true query string parameter. If the server side sees this parameter it doesn't render the part of the page that is cached. Instead the client side code retrieves the data from the sessionState cache and simply inserts it into the page. It sounds pretty simple, and the overall the process is really easy, but there are a few gotchas that I'll discuss in a minute. But first let's look at the implementation. Let's start with the server side here because that'll give a quick idea of the doc structure. As I mentioned the server renders data from an ASP.NET MVC view. On the list page when returning to the list page from the display page (or a host of other pages) looks like this: https://classifieds.gorge.net/list?back=True The query string value is a flag, that indicates whether the server should render the HTML. Here's what the top level MVC Razor view for the list page looks like:@model MessageListViewModel @{ ViewBag.Title = "Classified Listing"; bool isBack = !string.IsNullOrEmpty(Request.QueryString["back"]); } <form method="post" action="@Url.Action("list")"> <div id="SizingContainer"> @if (!isBack) { @Html.Partial("List_CommandBar_Partial", Model) <div id="PostItemContainer" class="scrollbox" xstyle="-webkit-overflow-scrolling: touch;"> @Html.Partial("List_Items_Partial", Model) @if (Model.RequireLoadEntry) { <div class="postitem loadpostitems" style="padding: 15px;"> <div id="LoadProgress" class="smallprogressright"></div> <div class="control-progress"> Load additional listings... </div> </div> } </div> } </div> </form> As you can see the query string triggers a conditional block that if set is simply not rendered. The content inside of #SizingContainer basically holds  the entire page's HTML sans the headers and scripts, but including the filter options and menu at the top. In this case this makes good sense - in other situations the fact that the menu or filter options might be dynamically updated might make you only cache the list rather than essentially the entire page. In this particular instance all of the content works and produces the proper result as both the list along with any filter conditions in the form inputs are restored. Ok, let's move on to the client. On the client there are two page level functions that deal with saving and restoring state. Like the counter example I showed earlier, I like to wrap the logic to save and restore values from sessionState into a separate function because they are almost always used in several places.page.saveData = function(id) { if (!sessionStorage) return; var data = { id: id, scroll: $("#PostItemContainer").scrollTop(), html: $("#SizingContainer").html() }; sessionStorage.setItem("list_html",JSON.stringify(data)); }; page.restoreData = function() { if (!sessionStorage) return; var data = sessionStorage.getItem("list_html"); if (!data) return null; return JSON.parse(data); }; The data that is saved is an object which contains an ID which is the selected element when the user clicks and a scroll position. These two values are used to reset the scroll position when the data is used from the cache. Finally the html from the #SizingContainer element is stored, which makes for the bulk of the document's HTML. In this application the HTML captured could be a substantial bit of data. If you recall, I mentioned that the server side code renders a small chunk of data initially and then gets more data if the user reads through the first 50 or so items. The rest of the items retrieved can be rather sizable. Other than the JSON deserialization that's Ok. Since I'm using SessionStorage the storage space has no immediate limits. Next is the core logic to handle saving and restoring the page state. At first though this would seem pretty simple, and in some cases it might be, but as the following code demonstrates there are a few gotchas to watch out for. Here's the relevant code I use to save and restore:$( function() { … var isBack = getUrlEncodedKey("back", location.href); if (isBack) { // remove the back key from URL setUrlEncodedKey("back", "", location.href); var data = page.restoreData(); // restore from sessionState if (!data) { // no data - force redisplay of the server side default list window.location = "list"; return; } $("#SizingContainer").html(data.html); var el = $(".postitem[data-id=" + data.id + "]"); $(".postitem").removeClass("highlight"); el.addClass("highlight"); $("#PostItemContainer").scrollTop(data.scroll); setTimeout(function() { el.removeClass("highlight"); }, 2500); } else if (window.noFrames) page.saveData(null); // save when page loads $("#SizingContainer").on("click", ".postitem", function() { var id = $(this).attr("data-id"); if (!id) return true; if (window.noFrames) page.saveData(id); var contentFrame = window.parent.frames["Content"]; if (contentFrame) contentFrame.location.href = "show/" + id; else window.location.href = "show/" + id; return false; }); … The code starts out by checking for the back query string flag which triggers restoring from the client cache. If cached the cached data structure is read from sessionStorage. It's important here to check if data was returned. If the user had back=true on the querystring but there is no cached data, he likely bookmarked this page or otherwise shut down the browser and came back to this URL. In that case the server didn't render any detail and we have no cached data, so all we can do is redirect to the original default list view using window.location. If we continued the page would render no data - so make sure to always check the cache retrieval result. Always! If there is data the it's loaded and the data.html data is restored back into the document by simply injecting the HTML back into the document's #SizingContainer element:$("#SizingContainer").html(data.html); It's that simple and it's quite quick even with a fully loaded list of additional items and on a phone. The actual HTML data is stored to the cache on every page load initially and then again when the user clicks on an element to navigate to a particular listing. The former ensures that the client cache always has something in it, and the latter updates with additional information for the selected element. For the click handling I use a data-id attribute on the list item (.postitem) in the list and retrieve the id from that. That id is then used to navigate to the actual entry as well as storing that Id value in the saved cached data. The id is used to reset the selection by searching for the data-id value in the restored elements. The overall process of this save/restore process is pretty straight forward and it doesn't require a bunch of code, yet it yields a huge improvement in the usability of the site on mobile devices (or anybody who uses the non-frames view). Some things to watch out for As easy as it conceptually seems to simply store and retrieve cached content, you have to be quite aware what type of content you are caching. The code above is all that's specific to cache/restore cycle and it works, but it took a few tweaks to the rest of the script code and server code to make it all work. There were a few gotchas that weren't immediately obvious. Here are a few things to pay attention to: Event Handling Logic Timing of manipulating DOM events Inline Script Code Bookmarking to the Cache Url when no cache exists Do you have inline script code in your HTML? That script code isn't going to run if you restore from cache and simply assign or it may not run at the time you think it would normally in the DOM rendering cycle. JavaScript Event Hookups The biggest issue I ran into with this approach almost immediately is that originally I had various static event handlers hooked up to various UI elements that are now cached. If you have an event handler like:$("#btnSearch").click( function() {…}); that works fine when the page loads with server rendered HTML, but that code breaks when you now load the HTML from cache. Why? Because the elements you're trying to hook those events to may not actually be there - yet. Luckily there's an easy workaround for this by using deferred events. With jQuery you can use the .on() event handler instead:$("#SelectionContainer").on("click","#btnSearch", function() {…}); which monitors a parent element for the events and checks for the inner selector elements to handle events on. This effectively defers to runtime event binding, so as more items are added to the document bindings still work. For any cached content use deferred events. Timing of manipulating DOM Elements Along the same lines make sure that your DOM manipulation code follows the code that loads the cached content into the page so that you don't manipulate DOM elements that don't exist just yet. Ideally you'll want to check for the condition to restore cached content towards the top of your script code, but that can be tricky if you have components or other logic that might not all run in a straight line. Inline Script Code Here's another small problem I ran into: I use a DateTime Picker widget I built a while back that relies on the jQuery date time picker. I also created a helper function that allows keyboard date navigation into it that uses JavaScript logic. Because MVC's limited 'object model' the only way to embed widget content into the page is through inline script. This code broken when I inserted the cached HTML into the page because the script code was not available when the component actually got injected into the page. As the last bullet - it's a matter of timing. There's no good work around for this - in my case I pulled out the jQuery date picker and relied on native <input type="date" /> logic instead - a better choice these days anyway, especially since this view is meant to be primarily to serve mobile devices which actually support date input through the browser (unlike desktop browsers of which only WebKit seems to support it). Bookmarking Cached Urls When you cache HTML content you have to make a decision whether you cache on the client and also not render that same content on the server. In the Classifieds app I didn't render server side content so if the user comes to the page with back=True and there is no cached content I have to a have a Plan B. Typically this happens when somebody ends up bookmarking the back URL. The easiest and safest solution for this scenario is to ALWAYS check the cache result to make sure it exists and if not have a safe URL to go back to - in this case to the plain uncached list URL which amounts to effectively redirecting. This seems really obvious in hindsight, but it's easy to overlook and not see a problem until much later, when it's not obvious at all why the page is not rendering anything. Don't use <body> to replace Content Since we're practically replacing all the HTML in the page it may seem tempting to simply replace the HTML content of the <body> tag. Don't. The body tag usually contains key things that should stay in the page and be there when it loads. Specifically script tags and elements and possibly other embedded content. It's best to create a top level DOM element specifically as a placeholder container for your cached content and wrap just around the actual content you want to replace. In the app above the #SizingContainer is that container. Other Approaches The approach I've used for this application is kind of specific to the existing server rendered application we're running and so it's just one approach you can take with caching. However for server rendered content caching this is a pattern I've used in a few apps to retrofit some client caching into list displays. In this application I took the path of least resistance to the existing server rendering logic. Here are a few other ways that come to mind: Using Partial HTML Rendering via AJAXInstead of rendering the page initially on the server, the page would load empty and the client would render the UI by retrieving the respective HTML and embedding it into the page from a Partial View. This effectively makes the initial rendering and the cached rendering logic identical and removes the server having to decide whether this request needs to be rendered or not (ie. not checking for a back=true switch). All the logic related to caching is made on the client in this case. Using JSON Data and Client RenderingThe hardcore client option is to do the whole UI SPA style and pull data from the server and then use client rendering or databinding to pull the data down and render using templates or client side databinding with knockout/angular et al. As with the Partial Rendering approach the advantage is that there's no difference in the logic between pulling the data from cache or rendering from scratch other than the initial check for the cache request. Of course if the app is a  full on SPA app, then caching may not be required even - the list could just stay in memory and be hidden and reactivated. I'm sure there are a number of other ways this can be handled as well especially using  AJAX. AJAX rendering might simplify the logic, but it also complicates search engine optimization since there's no content loaded initially. So there are always tradeoffs and it's important to look at all angles before deciding on any sort of caching solution in general. State of the Session SessionState and LocalStorage are easy to use in client code and can be integrated even with server centric applications to provide nice caching features of content and data. In this post I've shown a very specific scenario of storing HTML content for the purpose of remembering list view data and state and making the browsing experience for lists a bit more friendly, especially if there's dynamically loaded content involved. If you haven't played with sessionStorage or localStorage I encourage you to give it a try. There's a lot of cool stuff that you can do with this beyond the specific scenario I've covered here… Resources Overview of localStorage (also applies to sessionStorage) Web Storage Compatibility Modernizr Test Suite© Rick Strahl, West Wind Technologies, 2005-2013Posted in JavaScript  HTML5  ASP.NET  MVC   Tweet !function(d,s,id){var js,fjs=d.getElementsByTagName(s)[0];if(!d.getElementById(id)){js=d.createElement(s);js.id=id;js.src="//platform.twitter.com/widgets.js";fjs.parentNode.insertBefore(js,fjs);}}(document,"script","twitter-wjs"); (function() { var po = document.createElement('script'); po.type = 'text/javascript'; po.async = true; po.src = 'https://apis.google.com/js/plusone.js'; var s = document.getElementsByTagName('script')[0]; s.parentNode.insertBefore(po, s); })();

  Read the article

< Previous Page | 302 303 304 305 306 307 308 309  | Next Page >