Search Results

Search found 37915 results on 1517 pages for 'text editor'.

Page 31/1517 | < Previous Page | 27 28 29 30 31 32 33 34 35 36 37 38  | Next Page >

  • What needs to be passed to an editor from a keyboard app to move the cursor one char left?

    - by yno
    What key code does an Android editor app expect the keyboard app to send when it is going to be interpreted as a left arrow? In other words, what is the keyboard program supposed to send to its calling program (some kind of editor) if the user intends to move the cursor one char to the left? A related issue: what do the minus values for the "android:codes" attribute mean? () Any pointers to these issues will be appreciated.

    Read the article

  • Writing text file on local server MVC 2.0

    - by Liado
    Hi, i'm trying to write a text file on remote server, i'm using the following code: [AcceptVerbs(HttpVerbs.Post)] public ActionResult Index(UserModels model) { if (!ModelState.IsValid) { return View("Index"); } try { using (StreamWriter w = new StreamWriter(Server.MapPath(TEXT_FILE_NAME), true)) { w.WriteLine(model.Email.ToString()); // Write the text } } catch { } the folder is still empty, can someone help? what should be the problem? Thanks

    Read the article

  • Reading a Text file in xcode

    - by Nicolaj Zefting
    First off, I'm a complete beginner. This might be a stupid question, but here it goes: I'm currently working on an App than contains Latin texts that the users can view and read. I'm using Xcode 4 with the storybord function. Theway the app is built: user selects author - then the book - then app shows the text. I am kind of confused because i need to have various text files, depending on the users choice.

    Read the article

  • Generating text file from database

    - by Goldmember
    I have a requirement to hand-code an text file from data residing in a SQL table. Just wondering if there are any best practices here. Should I write it as an XMLDocument first and transform using XSL or just use Streamwriter and skip transformation altogether? The generated text file will be in EDIFACT format, so layout is very specific.

    Read the article

  • What font do you use for your code editor?

    - by Harmen
    For a long time I used Courier New as default font for my code editor, until I got more into typography and found this new fixed-width font called Triskweline: The font is beautiful, but unfortunately it works only at size 10pt. This made me wonder: what (custom) font do you use for your code editor?

    Read the article

  • Text extra aliased(jagged) in IE - looks terrible - but OK in FF and Chrome

    - by jon
    I am building a website - http://www.efficaxdevelopment.com As you can see when you load the page(in IE) the text on the page that isn't an image or the menu looks terrible, while in FF and Chrome the text looks fine. you can view the source on the page and the css is here http://www.efficaxdevelopment.com/styles/mainstyle.css Also, the sliding bar over the menu appears a few pixels left of where it appears in FF and IE. Any ideas?

    Read the article

  • Appcelerator Titanium - auto height table views break with shortish text

    - by ceejayoz
    I posted this on the Appcelerator Titanium dev Q&A site, but maybe someone here has had this issue... KitchenSink 1.1 illustrates this issue. In table_view_api_auto_height.js, changing row: addRow(0,'This is some long text. This is some long text. This is some long text. This is some long text. This is some long text. This is some long text. This is some long text. This is some long text. This is some long text. This is some long text. This is some long text. This is some long text. This is some long text. This is some long text. This is some long text. This is some long text. This is some long text. This is some long text.'); to something like: addRow(0,'This is some long text. This is some long text.'); results in incorrect left padding on the row. See screenshot:

    Read the article

  • Using Rich Text Editor (WYSIWYG) in ASP.NET MVC

    - by imran_ku07
       Introduction:          In ASP.NET MVC forum I found some question regarding a sample HTML Rich Text Box Editor(also known as wysiwyg).So i decided to create a sample ASP.NET MVC web application which will use a Rich Text Box Editor. There are are lot of Html Editors are available, but for creating a sample application, i decided to use cross-browser WYSIWYG editor from openwebware. In this article I will discuss what changes needed to work this editor with ASP.NET MVC. Also I had attached the sample application for download at http://www.speedfile.org/155076. Also note that I will only show the important features, not discuss every feature in detail.   Description:          So Let's start create a sample ASP.NET MVC application. You need to add the following script files,         jquery-1.3.2.min.js        jquery_form.js        wysiwyg.js        wysiwyg-settings.js        wysiwyg-popup.js          Just put these files inside Scripts folder. Also put wysiwyg.css in your Content Folder and add the following folders in your project        addons        popups          Also create a empty folder Uploads to store the uploaded images. Next open wysiwyg.js and set your configuration                  // Images Directory        this.ImagesDir = "/addons/imagelibrary/images/";                // Popups Directory        this.PopupsDir = "/popups/";                // CSS Directory File        this.CSSFile = "/Content/wysiwyg.css";              Next create a simple View TextEditor.aspx inside View / Home Folder and add the folllowing HTML.        <%@ Page Language="C#" Inherits="System.Web.Mvc.ViewPage" %>            <!DOCTYPE html PUBLIC "-//W3C//DTD XHTML 1.0 Transitional//EN" "http://www.w3.org/TR/xhtml1/DTD/xhtml1-transitional.dtd">        <html >            <head runat="server">                <title>TextEditor</title>                <script src="../../Scripts/wysiwyg.js" type="text/javascript"></script>                <script src="../../Scripts/wysiwyg-settings.js" type="text/javascript"></script>                <script type="text/javascript">                            WYSIWYG.attach('text', full);                            </script>            </head>            <body>                <% using (Html.BeginForm()){ %>                    <textarea id="text" name="test2" style="width:850px;height:200px;">                    </textarea>                    <input type="submit" value="submit" />                <%} %>            </body>        </html>                  Here i have just added a text area control and a submit button inside a form. Note the id of text area and WYSIWYG.attach function's first parameter is same and next to watch is the HomeController.cs        using System;        using System.Collections.Generic;        using System.Linq;        using System.Web;        using System.Web.Mvc;        using System.IO;        namespace HtmlTextEditor.Controllers        {            [HandleError]            public class HomeController : Controller            {                public ActionResult Index()                {                    ViewData["Message"] = "Welcome to ASP.NET MVC!";                    return View();                }                    public ActionResult About()                {                                return View();                }                        public ActionResult TextEditor()                {                    return View();                }                [AcceptVerbs(HttpVerbs.Post)]                [ValidateInput(false)]                public ActionResult TextEditor(string test2)                {                    Session["html"] = test2;                            return RedirectToAction("Index");                }                        public ActionResult UploadImage()                {                    if (Request.Files[0].FileName != "")                    {                        Request.Files[0].SaveAs(Server.MapPath("~/Uploads/" + Path.GetFileName(Request.Files[0].FileName)));                        return Content(Url.Content("~/Uploads/" + Path.GetFileName(Request.Files[0].FileName)));                    }                    return Content("a");                }            }        }          So simple code, just save the posted Html into Session. Here the parameter of TextArea action is test2 which is same as textarea control name of TextArea.aspx View. Also note ValidateInputAttribute is false, so it's up to you to defends against XSS. Also there is an Action method which simply saves the file inside Upload Folder.          I am uploading the file using Jquery Form Plugin. Here is the code which is found in insert_image.html inside addons folder,        function ChangeImage() {            var myform=document.getElementById("formUpload");                    $(myform).ajaxSubmit({success: function(responseText){                insertImage(responseText);                        window.close();                }            });        }          and here is the Index View which simply renders the html of Editor which was saved in Session        <%@ Page Language="C#" MasterPageFile="~/Views/Shared/Site.Master" Inherits="System.Web.Mvc.ViewPage" %>        <asp:Content ID="indexTitle" ContentPlaceHolderID="TitleContent" runat="server">            Home Page        </asp:Content>        <asp:Content ID="indexContent" ContentPlaceHolderID="MainContent" runat="server">            <h2><%= Html.Encode(ViewData["Message"]) %></h2>            <p>                To learn more about ASP.NET MVC visit <a href="http://asp.net/mvc" title="ASP.NET MVC Website">http://asp.net/mvc</a>.            </p>            <%if (Session["html"] != null){                  Response.Write(Session["html"].ToString());            } %>                    </asp:Content>   Summary:          Hopefully you will enjoy this article. Just download the code and see the effect. From security point, you must handle the XSS attack your self. I had uploaded the sample application in http://www.speedfile.org/155076

    Read the article

  • Webrat says it can't find some text, but the text is actually there

    - by Jason
    I have a webpage that has a form button on it called "delete", and a cuke scenario that has the line: And I should see "delete" When I run the scenario, I get this error: expected the following element's content to include "delete" ...and it dumps the webrat page to stdout and the "delete" is, in fact, not there. So far so good. However, when I tell webrat to show me the page before the error happens: Then show me the page And I should see "delete" ...Safari fires up and shows me the page, and in Safari there's the "delete" button, totally there. Why is webrat not finding the form button? I've also had this same problem with form fields, such as text inputs that have a value in them when the page loads, but webrat says there's nothing there. Looking at it in Safari shows, again, that the field does have the right text in it. Is this a bug, or is webrat just not suitable for checking form elements? Is there a different way to do this? Thanks!

    Read the article

  • Change input text to regular text on blur and ability to edit jQuery

    - by eknown
    I'm creating a form where I'm eliminating the use of a save button. The form is made up of input text boxes and textareas. After the user enters data into the input field, I want to trigger an onBlur function and change the input into a span that contains the information that the user entered. I also want to have the ability to edit this information, so if the user clicks on the newly created span with text, it will turn back into the input field with the current information for their editing pleasure. For reference, I'm looking to have a functionality pretty much like on editing a photo title on Flickr. If possible, I'd also like to have the textbox show "saving..." for half a second after the blur to reflect interaction with server.

    Read the article

  • ASP.NET Conditionally Change ButtonField text at runTime

    - by Rodney Vinyard
    ASP.NET Conditionally Change ButtonField text at runTime   <asp:ButtonField CommandName="Edit" HeaderText="" Text="Edit" ButtonType="Link" />       protected void gvRequests_RowDataBound(object sender, GridViewRowEventArgs e)     {         if (e.Row.RowType == DataControlRowType.DataRow)         {             //----------------------------------------------------             // If status = "Saved", change buttonField.LinkButton.Text to "Copy"             //----------------------------------------------------             if (e.Row.Cells[(int)gCol.Status].Text == "Saved")             {                 //----------------------------------------------------                 // no !                 //----------------------------------------------------                 //string x = e.Row.Cells[(int)gCol.EditLink].Text;                 //e.Row.Cells[(int)gCol.EditLink].Text = "Copy";                   //----------------------------------------------------                 // yes !                 //----------------------------------------------------                 LinkButton linkButton = (LinkButton)e.Row.Cells[(int)gCol.EditLink].Controls[0];                 linkButton.Text = "Copy";             }         }     }

    Read the article

  • Issue with parsed text with HTMLCleaner - spaces at the begining of text

    - by ansol90
    Im able to get text using HTMLCleaner from website. The problem is that when I set the text to a TextView it shows the beginning of the text with a big space on it. Here is the screenshot of what im talking about. I have tried android:gravity but nothing happened. Please help. Here is my Code: private class SiteParser extends AsyncTask<String, Void, String> { protected String doInBackground(String... arg) { String output = null; try { HtmlHelper hh = new HtmlHelper(new URL(arg[0])); List<TagNode> news = hh.getnewsByClass("TextoPrint"); for (Iterator<TagNode> iterator = newss.iterator(); iterator .hasNext();) { TagNode divElement = (TagNode) iterator.next(); output = divElement.getText().toString(); } } catch (Exception e) { e.printStackTrace(); } return output; } protected void onPostExecute(String output) { Bundle bundle=new Bundle(); bundle.putString("body",output); Intent mainIntent = new Intent(act, MyView.class); mainIntent.putExtras(bundle); startActivity(mainIntent); act.finish(); } } public class HtmlHelper { TagNode rootNode; public HtmlHelper(URL htmlPage) throws IOException, XPatherException { HtmlCleaner cleaner = new HtmlCleaner(); rootNode = cleaner.clean(htmlPage); } List<TagNode> getnewsByClass(String Classname){ List<TagNode> newsList = new ArrayList<TagNode>(); TagNode divElements[] = rootNode.getElementsByName("div", true); for (int i = 0; divElements != null && i < divElements.length; i++) { String classType = divElements[i].getAttributeByName("id"); if (classType != null && classType.equals(Classname)) { newsList.add(divElements[i]); } } return newsList; } }

    Read the article

  • Emacs editor copy and deletion

    - by Null pointer
    I am a huge fan of emacs.. But even after 1 year of practising on emacs I am unable to solve these three annoying issues about emacs please help me! 1.Whenever I want to copy the content from emacs into other things such as a website textarea I have to use GUI copy button because ctrl+w doesn't work. Is there any way to do this from emacs-command line. 2.Whenever I delete something using ctrl+shft+SPC or ctrl+k etc I don't want it to be stored in kill ring how do I do it(I know ctrl+D does this but it deletes only one char at a time)? 3.Whenever I select text by mouse and press backspace then text goes into kill ring(Which I want to change as mentioned) but same doesn't happen when I select text with ctrl+SPC(set mark) and then ctrl+f/ctrl+b etc. Please help me! Thanks in Advanced!

    Read the article

  • Send SMS text messages for FREE using Java ME

    - by hinkmond
    Here's a way to get around those nasty SMS text messages charges (and maybe a way to get around the Pakistan SMS text censors too!). Use this Java ME SMS text app for your Java ME mobile phone, called JaxtrSMS: See: JaxtrSMS free Java ME SMS Here's a quote: JaxtrSMS lets you send FREE SMS and txt messages to any mobile phone in the world. Best of all, the receiver does not have to have the JaxtrSMS app. International and local SMS/texting can be expensive but with JaxtrSMS you can text anyone in the world for FREE! Great! Now, you can send 2,000 text messages from your phone every month and not worry about a huge bill. You don't send 2,000 text message in a month? Well, get it for your teenage kids then. They certainly send 2,000 text messages in a month... Hinkmond

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • knockout bind text label to dropdown value selected option text

    - by Adam Levitt
    Is there a simple way to bind the textbox of a div to change based on the text value of the selected option in a dropdown on the same page? <div data-bind="text: dropdownValue"></div> <select> <option value="1">Value1</option> <option value="2">Value2</option> </select> Please note, I don't want to put the values into the select element using javascript. I'd like to bind to the value straight from the HTML. I can also include jQuery to make it work.

    Read the article

  • Colour scheme for editor - guidelines or medical reccomendations

    - by Kevin D
    Is anyone aware of any studies on what colour scheme is best for use in multi-coloured text based computer work? Specifically in terms of reducing eye strain. For instance is a black back ground and light text best? Should it be a dark colour rather than going all the way to black? I've seen the questions on this site about "which is your favourite" that is not what I am after. I also aware that my question may be to specific asking for a colour scheme, if anyone could link me to some guidelines instead that would be appreciated as well. I'm concious of the fact that anyone using a computer is really using it for text based work but with the multitude of colours used to convey information within our modern IDEs I feel this is a good StackExchange site for this question.

    Read the article

  • Changing Text colour in text field by dropdown menu - Visual Studio 2008

    - by Wayne
    Hey, i'm just doing some testing on Visual Studio 2008, what i'm trying to do is to change the text colour inside the multi-textfield which isn't working and I don't know why... Public Class Form1 Dim ColourValue As Color Private Sub Form1_Load(ByVal sender As System.Object, ByVal e As System.EventArgs) Handles MyBase.Load rbBlue.Checked = False rbRed.Checked = False rbGreen.Checked = False End Sub Private Sub rbRed_CheckedChanged(ByVal sender As System.Object, ByVal e As System.EventArgs) Handles rbRed.CheckedChanged txtSpace.BackColor = Color.Red End Sub Private Sub rbBlue_CheckedChanged(ByVal sender As System.Object, ByVal e As System.EventArgs) Handles rbBlue.CheckedChanged txtSpace.BackColor = Color.Blue End Sub Private Sub rbGreen_CheckedChanged(ByVal sender As System.Object, ByVal e As System.EventArgs) Handles rbGreen.CheckedChanged txtSpace.BackColor = Color.Green End Sub Private Sub cbColours_SelectedValueChanged(ByVal sender As Object, ByVal e As System.EventArgs) Handles cbColours.SelectedValueChanged ColourValue = cbColours.SelectedValue txtSpace.BackColor = ColourValue End Sub End Class Basically i have the radio buttons that would change the background colour of the textfield, but i just need the dropdown menu to change the text colour. Many thanks :)

    Read the article

  • When page loads display 1st image text - hide all other text

    - by Jonah1289
    Hi I have created http://techavid.com/design/test3.html and when you load the page you see there are 3 images. The sun image is focused(in color), while the others are greyed out until clicked. That is how it should be for the images. Also when you load the page you see under each image it's own text(i.e. 1st: Sun, 2nd: Airplane, 3rd: Nano), but on page load I only want 1st:Sun to display and hide all other text until their respective image is clicked. Any idea how to do this? thanks :) J

    Read the article

  • Rendering only a part of text FTGL, OpenGL

    - by Mosquito
    I'm using FTGL library to render text in my C++ project. I can easily render text by using: CFontManager::Instance().renderWrappedText(font, lineLength, position, text); Unfortunately there is a situation in which this Button which displays text, is partly hidden because of resizing container in which it is situated. I'm able without any problem to draw Button's background to fit the container, but I've got a problem with doing the same with a text. Is it possible to somehow draw only text for given width and the rest just ignore? This is a screen which presents my problem: As you can see, the Button "Click here" is being drawn properly, but I can't do the same with "Click here" text.

    Read the article

  • Improve Efficiency for This Text Processing Code

    - by johnv
    I am writing a program that counts the number of words in a text file which is already in lowercase and separated by spaces. I want to use a dictionary and only count the word IF it's within the dictionary. The problem is the dictionary is quite large (~100,000 words) and each text document has also ~50,000 words. As such, the codes that I wrote below gets very slow (takes about 15 sec to process one document on a quad i7 machine). I'm wondering if there's something wrong with my coding and if the efficiency of the program can be improved. Thanks so much for your help. Code below: public static string WordCount(string countInput) { string[] keywords = ReadDic(); /* read dictionary txt file*/ /*then reads the main text file*/ Dictionary<string, int> dict = ReadFile(countInput).Split(' ') .Select(c => c) .Where(c => keywords.Contains(c)) .GroupBy(c => c) .Select(g => new { word = g.Key, count = g.Count() }) .OrderBy(g => g.word) .ToDictionary(d => d.word, d => d.count); int s = dict.Sum(e => e.Value); string k = s.ToString(); return k; }

    Read the article

  • Search implementation dilemma: full text vs. plain SQL

    - by Ethan
    I have a MySQL/Rails app that needs search. Here's some info about the data: Users search within their own data only, so searches are narrowed down by user_id to begin with. Each user will have up to about five thousand records (they accumulate over time). I wrote out a typical user's records to a text file. The file size is 2.9 MB. Search has to cover two columns: title and body. title is a varchar(255) column. body is column type text. This will be lightly used. If I average a few searches per second that would be surprising. It's running an a 500 MB CentOS 5 VPS machine. I don't want relevance ranking or any kind of fuzziness. Searches should be for exact strings and reliably return all records containing the string. Simple date order -- newest to oldest. I'm using the InnoDB table type. I'm looking at plain SQL search (through the searchlogic gem) or full text search using Sphinx and the Thinking Sphinx gem. Sphinx is very fast and Thinking Sphinx is cool, but it adds complexity, a daemon to maintain, cron jobs to maintain the index. Can I get away with plain SQL search for a small scale app?

    Read the article

< Previous Page | 27 28 29 30 31 32 33 34 35 36 37 38  | Next Page >