Search Results

Search found 80596 results on 3224 pages for 'simplexml load file'.

Page 32/3224 | < Previous Page | 28 29 30 31 32 33 34 35 36 37 38 39  | Next Page >

• What is causing the unusual high load average and IOwait?

  - by James

  I noticed on Tuesday night of last week, the load average went up sharply and it seemed abnormal since the traffic is small. Usually, the numbers usually average around .40 or lower and my server stuff (mysql, php and apache) are optimized. I noticed that the IOWait is unusually high even though the processes is barely using any CPU. top - 01:44:39 up 1 day, 21:13, 1 user, load average: 1.41, 1.09, 0.86 Tasks: 60 total, 1 running, 59 sleeping, 0 stopped, 0 zombie Cpu0 : 0.0%us, 0.0%sy, 0.0%ni,100.0%id, 0.0%wa, 0.0%hi, 0.0%si, 0.0%st Cpu1 : 0.0%us, 0.0%sy, 0.0%ni,100.0%id, 0.0%wa, 0.0%hi, 0.0%si, 0.0%st Cpu2 : 0.0%us, 0.3%sy, 0.0%ni, 99.7%id, 0.0%wa, 0.0%hi, 0.0%si, 0.0%st Cpu3 : 0.0%us, 0.0%sy, 0.0%ni,100.0%id, 0.0%wa, 0.0%hi, 0.0%si, 0.0%st Cpu4 : 0.0%us, 0.0%sy, 0.0%ni,100.0%id, 0.0%wa, 0.0%hi, 0.0%si, 0.0%st Cpu5 : 0.0%us, 0.0%sy, 0.0%ni,100.0%id, 0.0%wa, 0.0%hi, 0.0%si, 0.0%st Cpu6 : 0.0%us, 0.0%sy, 0.0%ni,100.0%id, 0.0%wa, 0.0%hi, 0.0%si, 0.0%st Cpu7 : 0.0%us, 0.0%sy, 0.0%ni, 91.5%id, 8.5%wa, 0.0%hi, 0.0%si, 0.0%st Mem: 1048576k total, 331944k used, 716632k free, 0k buffers Swap: 0k total, 0k used, 0k free, 0k cached PID USER PR NI VIRT RES SHR S %CPU %MEM TIME+ COMMAND 1 root 15 0 2468 1376 1140 S 0 0.1 0:00.92 init 1656 root 15 0 13652 5212 664 S 0 0.5 0:00.00 apache2 9323 root 18 0 13652 5212 664 S 0 0.5 0:00.00 apache2 10079 root 18 0 3972 1248 972 S 0 0.1 0:00.00 su 10080 root 15 0 4612 1956 1448 S 0 0.2 0:00.01 bash 11298 root 15 0 13652 5212 664 S 0 0.5 0:00.00 apache2 11778 chikorit 15 0 2344 1092 884 S 0 0.1 0:00.05 top 15384 root 18 0 17544 13m 1568 S 0 1.3 0:02.28 miniserv.pl 15585 root 15 0 8280 2736 2168 S 0 0.3 0:00.02 sshd 15608 chikorit 15 0 8280 1436 860 S 0 0.1 0:00.02 sshd Here is the VMStat procs -----------memory---------- ---swap-- -----io---- -system-- ----cpu---- r b swpd free buff cache si so bi bo in cs us sy id wa 1 0 0 768644 0 0 0 0 14 23 0 10 1 0 99 0 IOStat - Nothing unusal Total DISK READ: 67.13 K/s | Total DISK WRITE: 0.00 B/s TID PRIO USER DISK READ DISK WRITE SWAPIN IO COMMAND 19496 be/4 chikorit 11.85 K/s 0.00 B/s 0.00 % 0.00 % apache2 -k start 19501 be/4 mysql 3.95 K/s 0.00 B/s 0.00 % 0.00 % mysqld 19568 be/4 chikorit 11.85 K/s 0.00 B/s 0.00 % 0.00 % apache2 -k start 19569 be/4 chikorit 11.85 K/s 0.00 B/s 0.00 % 0.00 % apache2 -k start 19570 be/4 chikorit 11.85 K/s 0.00 B/s 0.00 % 0.00 % apache2 -k start 19571 be/4 chikorit 7.90 K/s 0.00 B/s 0.00 % 0.00 % apache2 -k start 19573 be/4 chikorit 7.90 K/s 0.00 B/s 0.00 % 0.00 % apache2 -k start 1 be/4 root 0.00 B/s 0.00 B/s 0.00 % 0.00 % init 11778 be/4 chikorit 0.00 B/s 0.00 B/s 0.00 % 0.00 % top 19470 be/4 mysql 0.00 B/s 0.00 B/s 0.00 % 0.00 % mysqld Load Average Chart - http://i.stack.imgur.com/kYsD0.png I want to be sure if this is not a MySQL problem before making sure. Also, this is a Ubuntu 10.04 LTS Server on OpenVZ. Edit: This will probably give a good picture on the IO Wait top - 22:12:22 up 17:41, 1 user, load average: 1.10, 1.09, 0.93 Tasks: 33 total, 1 running, 32 sleeping, 0 stopped, 0 zombie Cpu(s): 0.6%us, 0.2%sy, 0.0%ni, 89.0%id, 10.1%wa, 0.0%hi, 0.0%si, 0.0%st Mem: 1048576k total, 260708k used, 787868k free, 0k buffers Swap: 0k total, 0k used, 0k free, 0k cached PID USER PR NI VIRT RES SHR S %CPU %MEM TIME+ COMMAND 1 root 15 0 2468 1376 1140 S 0 0.1 0:00.88 init 5849 root 15 0 12336 4028 668 S 0 0.4 0:00.00 apache2 8063 root 15 0 12336 4028 668 S 0 0.4 0:00.00 apache2 9732 root 16 0 8280 2728 2168 S 0 0.3 0:00.02 sshd 9746 chikorit 18 0 8412 1444 864 S 0 0.1 0:01.10 sshd 9747 chikorit 18 0 4576 1960 1488 S 0 0.2 0:00.24 bash 13706 chikorit 15 0 2344 1088 884 R 0 0.1 0:00.03 top 15745 chikorit 15 0 12968 5108 1280 S 0 0.5 0:00.00 apache2 15751 chikorit 15 0 72184 25m 18m S 0 2.5 0:00.37 php5-fpm 15790 chikorit 18 0 12472 4640 1192 S 0 0.4 0:00.00 apache2 15797 chikorit 15 0 72888 23m 16m S 0 2.3 0:00.06 php5-fpm 16038 root 15 0 67772 2848 592 D 0 0.3 0:00.00 php5-fpm 16309 syslog 18 0 24084 1316 992 S 0 0.1 0:00.07 rsyslogd 16316 root 15 0 5472 908 500 S 0 0.1 0:00.00 sshd 16326 root 15 0 2304 908 712 S 0 0.1 0:00.02 cron 17464 root 15 0 10252 7560 856 D 0 0.7 0:01.88 psad 17466 root 18 0 1684 276 208 S 0 0.0 0:00.31 psadwatchd 17559 root 18 0 11444 2020 732 S 0 0.2 0:00.47 sendmail-mta 17688 root 15 0 10252 5388 1136 S 0 0.5 0:03.81 python 17752 teamspea 19 0 44648 7308 4676 S 0 0.7 1:09.70 ts3server_linux 18098 root 15 0 12336 6380 3032 S 0 0.6 0:00.47 apache2 18099 chikorit 18 0 10368 2536 464 S 0 0.2 0:00.00 apache2 18120 ntp 15 0 4336 1316 984 S 0 0.1 0:00.87 ntpd 18379 root 15 0 12336 4028 668 S 0 0.4 0:00.00 apache2 18387 mysql 15 0 62796 36m 5864 S 0 3.6 1:43.26 mysqld 19584 root 15 0 12336 4028 668 S 0 0.4 0:00.02 apache2 22498 root 16 0 12336 4028 668 S 0 0.4 0:00.00 apache2 24260 root 15 0 67772 3612 1356 S 0 0.3 0:00.22 php5-fpm 27712 root 15 0 12336 4028 668 S 0 0.4 0:00.00 apache2 27730 root 15 0 12336 4028 668 S 0 0.4 0:00.00 apache2 30343 root 15 0 12336 4028 668 S 0 0.4 0:00.00 apache2 30366 root 15 0 12336 4028 668 S 0 0.4 0:00.00 apache2

  Read the article

• How do I get nginx to issue 301 requests to HTTPS location, when SSL handled by a load-balancer?

  - by growse

  I've noticed that there's functionality enabled in nginx by default, whereby a url request without a trailing slash for a directory which exists in the filesystem automatically has a slash added through a 301 redirect. E.g. if the directory css exists within my root, then requesting http://example.com/css will result in a 301 to http://example.com/css/. However, I have another site where the SSL is offloaded by a load-balancer. In this case, when I request https://example.com/css, nginx issues a 301 redirect to http://example.com/css/, despite the fact that the HTTP_X_FORWARDED_PROTO header is set to https by the load balancer. Is this an nginx bug? Or a config setting I've missed somewhere?

  Read the article

• Unset the system immutable bit in Mac OS X

  - by skylarking

  In theory I believe you can unlock and remove the system immutable bit with: chflags noschg /Path/To/File But how can you do this when you've set the bit as root? I have a file that is locked, and even running this command as root will not work as the operation is not permitted. I tried logging in as Single-User mode to no avail. I seem to remember that even though you are in as root you are in at level '1'. And to be able to remove the system-immutable flag you need to be logged in at level '0'. Does this have something to do with this issue?

  Read the article

• LAMP Server without single failure point + Global Server Load Balancing?

  - by José Nobile

  I want implement a LAMP Server (Linux Apache MySQL PHP) without a single failure point and with Global Server Load Balancing. I have a server in Cali, Colombia, and other server will be installed in Melbourne, Australia, user in America can use the Cali Server and in Europe, Asia, Africa or Oceania use the Melbourne Server. If any server fail (or load is excessively high), a server must answer all request. Data in MYSQL must be in sync, php files, any configuration in both server must be in sync. I read about of Google DNS Server 8.8.8.8 and 8.8.4.4 and ANY Cast, also about MySQL semisynchronous replication and MySQL Cluster, but what about other things, as crontabs, and the configurations in server? The solution can't depend of APNIC or BGP, only open source software running in Linux.

  Read the article

• High load on a nagios server -- How many service checks for a nagios server is too many?

  - by Josh

  I have a nagios server running Ubuntu with a 2.0 GHz Intel Processor, a RAID10 array, and 400 MB of RAM. It monitors a total of 42 services across 8 hosts, most of which are checked using the check_http plugin even 5 minutes, some every minute. Recently the load on the nagios server has been above 4, often as high as 6. The server also runs cacti, gathering statistics every minute for 6 hosts. I wonder, how many services should hardware like this be able to handle? Is the load so high because I am pushing the limits of the hardware, or should this hardware be able to handle 42 service checks plus cacti? If the hardware is inadequate, should I look to add more RAM, more cores, or faster cores? What hardware / service checks are others running?

  Read the article

• How can I force all requests to be SSL when using EC2 load balancer?

  - by chris

  I currently have a single EC2 instance which is forcing all requests to be secure by using mod_rewrite: RewriteEngine On RewriteCond %{SERVER_PORT} !443 RewriteRule ^(.*)$ https://%{HTTP_HOST}$1 [R,L] I am planning on moving to a load balanced setup, with multiple back-end instances. If I set up my EC2 load balancer with my certs, do I need to use SSL to communicate between the LB and my instances? If not, is it as simple as replacing the RewriteCond with RewriteCond %{HTTP:X-Forwarded_Proto} ^http$ Edit: I tried using the x-forwarded-proto, but it does not appear to work. Is there another way to detect if someone is connected to the LB via SSL?

  Read the article

• Reliable file copy (move) process - mostly Unix/Linux

  - by mfinni

  Short story : We have a need for a rock-solid reliable file mover process. We have source directories that are often being written to that we need to move files from. The files come in pairs - a big binary, and a small XML index. We get a CTL file that defines these file bundles. There is a process that operates on the files once they are in the destination directory; that gets rid of them when it's done. Would rsync do the best job, or do we need to get more complex? Long story as follows : We have multiple sources to pull from : one set of directories are on a Windows machine (that does have Cygwin and an SSH daemon), and a whole pile of directories are on a set of SFTP servers (Most of these are also Windows.) Our destinations are a list of directories on AIX servers. We used to use a very reliable Perl script on the Windows/Cygwin machine when it was our only source. However, we're working on getting rid of that machine, and there are other sources now, the SFTP servers, that we cannot presently run our own scripts on. For security reasons, we can't run the copy jobs on our AIX servers - they have no access to the source servers. We currently have a homegrown Java program on a Linux machine that uses SFTP to pull from the various new SFTP source directories, copies to a local tmp directory, verifies that everything is present, then copies that to the AIX machines, and then deletes the files from the source. However, we're finding any number of bugs or poorly-handled error checking. None of us are Java experts, so fixing/improving this may be difficult. Concerns for us are: With a remote source (SFTP), will rsync leave alone any file still being written? Some of these files are large. From reading the docs, it seems like rysnc will be very good about not removing the source until the destination is reliably written. Does anyone have experience confirming or disproving this? Additional info We will be concerned about the ingestion process that operates on the files once they are in the destination directory. We don't want it operating on files while we are in the process of copying them; it waits until the small XML index file is present. Our current copy job are supposed to copy the XML file last. Sometimes the network has problems, sometimes the SFTP source servers crap out on us. Sometimes we typo the config files and a destination directory doesn't exist. We never want to lose a file due to this sort of error. We need good logs If you were presented with this, would you just script up some rsync? Or would you build or buy a tool, and if so, what would it be (or what technologies would it use?) I (and others on my team) are decent with Perl.

  Read the article

• Windows 2008 Server Standard Edition, supports Component Load Balancing?

  - by Jedi Master Spooky

  Windows 2008 Server Standard Edition, supports Component Load Balancing? if not, what SO do I need?

  Read the article

• Visual Studio Load Testing using Windows Azure

  - by Tarun Arora

  In my opinion the biggest adoption barrier in performance testing on smaller projects is not the tooling but the high infrastructure and administration cost that comes with this phase of testing. Only if a reusable solution was possible and infrastructure management wasn’t as expensive, adoption would certainly spike. It certainly is possible if you bring Visual Studio and Windows Azure into the equation. It is possible to run your test rig in the cloud without getting tangled in SCVMM or Lab Management. All you need is an active Azure subscription, Windows Azure endpoint enabled developer workstation running visual studio ultimate on premise, windows azure endpoint enabled worker roles on azure compute instances set up to run as test controllers and test agents. My test rig is running SQL server 2012 and Visual Studio 2012 RC agents. The beauty is that the solution is reusable, you can open the azure project, change the subscription and certificate, click publish and *BOOM* in less than 15 minutes you could have your own test rig running in the cloud. In this blog post I intend to show you how you can use the power of Windows Azure to effectively abstract the administration cost of infrastructure management and lower the total cost of Load & Performance Testing. As a bonus, I will share a reusable solution that you can use to automate test rig creation for both VS 2010 agents as well as VS 2012 agents. Introduction The slide show below should help you under the high level details of what we are trying to achive... Leveraging Azure for Performance Testing View more PowerPoint from Avanade Scenario 1 – Running a Test Rig in Windows Azure To start off with the basics, in the first scenario I plan to discuss how to, - Automate deployment & configuration of Windows Azure Worker Roles for Test Controller and Test Agent - Automate deployment & configuration of SQL database on Test Controller on the Test Controller Worker Role - Scaling Test Agents on demand - Creating a Web Performance Test and a simple Load Test - Managing Test Controllers right from Visual Studio on Premise Developer Workstation - Viewing results of the Load Test - Cleaning up - Have the above work in the shape of a reusable solution for both VS2010 and VS2012 Test Rig Scenario 2 – The scaled out Test Rig and sharing data using SQL Azure A scaled out version of this implementation would involve running multiple test rigs running in the cloud, in this scenario I will show you how to sync the load test database from these distributed test rigs into one SQL Azure database using Azure sync. The selling point for this scenario is being able to collate the load test efforts from across the organization into one data store. - Deploy multiple test rigs using the reusable solution from scenario 1 - Set up and configure Windows Azure Sync - Test SQL Azure Load Test result database created as a result of Windows Azure Sync - Cleaning up - Have the above work in the shape of a reusable solution for both VS2010 and VS2012 Test Rig The Ingredients Though with an active MSDN ultimate subscription you would already have access to everything and more, you will essentially need the below to try out the scenarios, 1. Windows Azure Subscription 2. Windows Azure Storage – Blob Storage 3. Windows Azure Compute – Worker Role 4. SQL Azure Database 5. SQL Data Sync 6. Windows Azure Connect – End points 7. SQL 2012 Express or SQL 2008 R2 Express 8. Visual Studio All Agents 2012 or Visual Studio All Agents 2010 9. A developer workstation set up with Visual Studio 2012 – Ultimate or Visual Studio 2010 – Ultimate 10. Visual Studio Load Test Unlimited Virtual User Pack. Walkthrough To set up the test rig in the cloud, the test controller, test agent and SQL express installers need to be available when the worker role set up starts, the easiest and most efficient way is to pre upload the required software into Windows Azure Blob storage. SQL express, test controller and test agent expose various switches which we can take advantage of including the quiet install switch. Once all the 3 have been installed the test controller needs to be registered with the test agents and the SQL database needs to be associated to the test controller. By enabling Windows Azure connect on the machines in the cloud and the developer workstation on premise we successfully create a virtual network amongst the machines enabling 2 way communication. All of the above can be done programmatically, let’s see step by step how… Scenario 1 Video Walkthrough–Leveraging Windows Azure for performance Testing Scenario 2 Work in progress, watch this space for more… Solution If you are still reading and are interested in the solution, drop me an email with your windows live id. I’ll add you to my TFS preview project which has a re-usable solution for both VS 2010 and VS 2012 test rigs as well as guidance and demo performance tests.   Conclusion Other posts and resources available here. Possibilities…. Endless!

  Read the article

• Part 1 - Load Testing In The Cloud

  - by Tarun Arora

  Azure is fascinating, but even more fascinating is the marriage of Azure and TFS! Introduction Recently a client I worked for had 2 major business critical applications being delivered, with very little time budgeted for Performance testing, we immediately hit a bottleneck when the performance testing phase started, the in house infrastructure team could not support the hardware requirements in the short notice. It was suggested that the performance testing be performed on one of the QA environments which was a fraction of the production environment. This didn’t seem right, the team decided to turn to the cloud. The team took advantage of the elasticity offered by Azure, starting with a single test agent which was provisioned and ready for use with in 30 minutes the team scaled up to 17 test agents to perform a very comprehensive performance testing cycle. Issues were identified and resolved but the highlight was that the cost of running the ‘test rig’ proved to be less than if hosted on premise by the infrastructure team. Thank you for taking the time out to read this blog post, in the series of posts, I’ll try and cover the start to end of everything you need to know to use Azure to build your Test Rig in the cloud. But Why Azure? I have my own Data Centre… If the environment is provisioned in your own datacentre, - No matter what level of service agreement you may have with your infrastructure team there will be down time when the environment is patched - How fast can you scale up or down the environments (keeping the enterprise processes in mind) Administration, Cost, Flexibility and Scalability are the areas you would want to think around when taking the decision between your own Data Centre and Azure! How is Microsoft's Public Cloud Offering different from Amazon’s Public Cloud Offering? Microsoft's offering of the Cloud is a hybrid of Platform as a Service (PaaS) and Infrastructure as a Service (IaaS) which distinguishes Microsoft's offering from other providers such as Amazon (Amazon only offers IaaS). PaaS – Platform as a Service IaaS – Infrastructure as a Service Fills the needs of those who want to build and run custom applications as services. Similar to traditional hosting, where a business will use the hosted environment as a logical extension of the on-premises datacentre. A service provider offers a pre-configured, virtualized application server environment to which applications can be deployed by the development staff. Since the service providers manage the hardware (patching, upgrades and so forth), as well as application server uptime, the involvement of IT pros is minimized. On-demand scalability combined with hardware and application server management relieves developers from infrastructure concerns and allows them to focus on building applications. The servers (physical and virtual) are rented on an as-needed basis, and the IT professionals who manage the infrastructure have full control of the software configuration. This kind of flexibility increases the complexity of the IT environment, as customer IT professionals need to maintain the servers as though they are on-premises. The maintenance activities may include patching and upgrades of the OS and the application server, load balancing, failover clustering of database servers, backup and restoration, and any other activities that mitigate the risks of hardware and software failures.   The biggest advantage with PaaS is that you do not have to worry about maintaining the environment, you can focus all your time in solving the business problems with your solution rather than worrying about maintaining the environment. If you decide to use a VM Role on Azure, you are asking for IaaS, more on this later. A nice blog post here on the difference between Saas, PaaS and IaaS. Now that we are convinced why we should be turning to the cloud and why in specific Azure, let’s discuss about the Test Rig. The Load Test Rig – Topology Now the moment of truth, Of course a big part of getting value from cloud computing is identifying the most adequate workloads to take to the cloud, so I’ve decided to try to make a Load Testing rig where the Agents are running on Windows Azure.   I’ll talk you through the above Topology, - User: User kick starts the load test run from the developer workstation on premise. This passes the request to the Test Controller. - Test Controller: The Test Controller is on premise connected to the same domain as the developer workstation. As soon as the Test Controller receives the request it makes use of the Windows Azure Connect service to orchestrate the test responsibilities to all the Test Agents. The Windows Azure Connect endpoint software must be active on all Azure instances and on the Controller machine as well. This allows IP connectivity between them and, given that the firewall is properly configured, allows the Controller to send work loads to the agents. In parallel, the Controller will collect the performance data from the agents, using the traditional WMI mechanisms. - Test Agents: The Test Agents are on the Windows Azure Public Cloud, as soon as the test controller issues instructions to the test agents, the test agents start executing the load tests. The HTTP requests are issued against the web server on premise, the results are captured by the test agents. And finally the results are passed over to the controller. - Servers: The Web Server and DB Server are hosted on premise in the datacentre, this is usually the case with business critical applications, you probably want to manage them your self. Recap and What’s next? So, in the introduction in the series of blog posts on Load Testing in the cloud I highlighted why creating a test rig in the cloud is a good idea, what advantages does Windows Azure offer and the Test Rig topology that I will be using. I would also like to mention that i stumbled upon this [Video] on Azure in a nutshell, great watch if you are new to Windows Azure. In the next post I intend to start setting up the Load Test Environment and discuss pricing with respect to test agent machine types that will be used in the test rig. Hope you enjoyed this post, If you have any recommendations on things that I should consider or any questions or feedback, feel free to add to this blog post. Remember to subscribe to http://feeds.feedburner.com/TarunArora.  See you in Part II.   Share this post : CodeProject

  Read the article

• Copy mdf file and use it in run time

  - by Anibas

  After I copy mdf file (and his log file) I tries to Insert data. I receive the following message: "An attempt to attach an auto-named database for file [fileName].mdf failed. A database with the same name exists, or specified file cannot be opened, or it is located on UNC share. When I copied the file manual everything worked normally. Is it correct the order File.Copy leaves the file engaged?

  Read the article

• vba: find file that could be in one of three locations

  - by every_answer_gets_a_point

  i need to write a vba script that will find a file. the file could be in three different locations how do i find where the file is? the file must have a specific string as part of the file name my file name could be 9424.bas or 9424a.esy or 9424_.bas or 9424...esy, i dotn know what the file name exactly is but i know the important characters 9424

  Read the article

• Parse a text file into multiple text file

  - by Vijay Kumar Singh

  I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

  Read the article

• Designing a database file format

  - by RoliSoft

  I would like to design my own database engine for educational purposes, for the time being. Designing a binary file format is not hard nor the question, I've done it in the past, but while designing a database file format, I have come across a very important question: How to handle the deletion of an item? So far, I've thought of the following two options: Each item will have a "deleted" bit which is set to 1 upon deletion. Pro: relatively fast. Con: potentially sensitive data will remain in the file. 0x00 out the whole item upon deletion. Pro: potentially sensitive data will be removed from the file. Con: relatively slow. Recreating the whole database. Pro: no empty blocks which makes the follow-up question void. Con: it's a really good idea to overwrite the whole 4 GB database file because a user corrected a typo. I will sell this method to Twitter ASAP! Now let's say you already have a few empty blocks in your database (deleted items). The follow-up question is how to handle the insertion of a new item? Append the item to the end of the file. Pro: fastest possible. Con: file will get huge because of all the empty blocks that remain because deleted items aren't actually deleted. Search for an empty block exactly the size of the one you're inserting. Pro: may get rid of some blocks. Con: you may end up scanning the whole file at each insert only to find out it's very unlikely to come across a perfectly fitting empty block. Find the first empty block which is equal or larger than the item you're inserting. Pro: you probably won't end up scanning the whole file, as you will find an empty block somewhere mid-way; this will keep the file size relatively low. Con: there will still be lots of leftover 0x00 bytes at the end of items which were inserted into bigger empty blocks than they are. Rigth now, I think the first deletion method and the last insertion method are probably the "best" mix, but they would still have their own small issues. Alternatively, the first insertion method and scheduled full database recreation. (Probably not a good idea when working with really large databases. Also, each small update in that method will clone the whole item to the end of the file, thus accelerating file growth at a potentially insane rate.) Unless there is a way of deleting/inserting blocks from/to the middle of the file in a file-system approved way, what's the best way to do this? More importantly, how do databases currently used in production usually handle this?

  Read the article

• Find file that could be in one of three locations

  - by every_answer_gets_a_point

  i need to write a vba script that will find a file. the file could be in three different locations how do i find where the file is? the file must have a specific string as part of the file name my file name could be 9424.bas or 9424a.esy or 9424_.bas or 9424...esy, i dotn know what the file name exactly is but i know the important characters 9424

  Read the article

• Reading data from text file in C

  - by themake

  I have a text file which contains words separated by space. I want to take each word from the file and store it. So i have opened the file but am unsure how to assign the word to a char. FILE *fp; fp = fopen("file.txt", "r"); //then i want char one = the first word in the file char two = the second word in the file

  Read the article

• opening and viewing a file in php

  - by Christian Burgos

  how do i open/view for editing an uploaded file in php? i have tried this but it doesn't open the file. $my_file = 'file.txt'; $handle = fopen($my_file, 'r'); $data = fread($handle,filesize($my_file)); i've also tried this but it wont work. $my_file = 'file.txt'; $handle = fopen($my_file, 'w') or die('Cannot open file: '.$my_file); $data = 'This is the data'; fwrite($handle, $data); what i have in mind is like when you want to view an uploaded resume,documents or any other ms office files like .docx,.xls,.pptx and be able to edit them, save and close the said file. edit: latest tried code... <?php // Connects to your Database include "configdb.php"; //Retrieves data from MySQL $data = mysql_query("SELECT * FROM employees") or die(mysql_error()); //Puts it into an array while($info = mysql_fetch_array( $data )) { //Outputs the image and other data //Echo "<img src=localhost/uploadfile/images".$info['photo'] ."> <br>"; Echo "<b>Name:</b> ".$info['name'] . "<br> "; Echo "<b>Email:</b> ".$info['email'] . " <br>"; Echo "<b>Phone:</b> ".$info['phone'] . " <hr>"; //$file=fopen("uploadfile/images/".$info['photo'],"r+"); $file=fopen("Applications/XAMPP/xamppfiles/htdocs/uploadfile/images/file.odt","r") or exit("unable to open file");; } ?> i am getting the error: Warning: fopen(Applications/XAMPP/xamppfiles/htdocs/uploadfile/images/file.odt): failed to open stream: No such file or directory in /Applications/XAMPP/xamppfiles/htdocs/uploadfile/view.php on line 17 unable to open file the file is in that folder, i don't know it wont find it.

  Read the article

• Copied a file with winscp; only winscp can see it

  - by nilbus

  I recently copied a 25.5GB file from another machine using WinSCP. I copied it to C:\beth.tar.gz, and WinSCP can still see the file. However no other app (including Explorer) can see the file. What might cause this, and how can I fix it? The details that might or might not matter WinSCP shows the size of the file (C:\beth.tar.gz) correctly as 27,460,124,080 bytes, which matches the filesize on the remote host Neither explorer, cmd (command line prompt w/ dir C:\), the 7Zip archive program, nor any other File Open dialog can see the beth.tar.gz file under C:\ I have configured Explorer to show hidden files I can move the file to other directories using WinSCP If I try to move the file to Users/, UAC prompts me for administrative rights, which I grant, and I get this error: Could not find this item The item is no longer located in C:\ When I try to transfer the file back to the remote host in a new directory, the transfer starts successfully and transfers data The transfer had about 30 minutes remaining when I left it for the night The morning after the file transfer, I was greeted with a message saying that the connection to the server had been lost. I don't think this is relevant, since I did not tell it to disconnect after the file was done transferring, and it likely disconnected after the file transfer finished. I'm using an old version of WinSCP - v4.1.8 from 2008 I can view the file properties in WinSCP: Type of file: 7zip (.gz) Location: C:\ Attributes: none (Ready-only, Hidden, Archive, or Ready for indexing) Security: SYSTEM, my user, and Administrators group have full permissions - everything other than "special permissions" is checked under Allow for all 3 users/groups (my user, Administrators, SYSTEM) What's going on?!

  Read the article

• C++, Ifstream opens local file but not file on HTTP Server

  - by fammi

  Hi, I am using ifstream to open a file and then read from it. My program works fine when i give location of the local file on my system. for eg /root/Desktop/abc.xxx works fine But once the location is on the http server the file fails to open. for eg http://192.168.0.10/abc.xxx fails to open. Is there any alternate for ifstream when using a URL address? thanks. part of the code where having problem: bool readTillEof = (endIndex == -1) ? true : false; // Open the file in binary mode and seek to the end to determine file size ifstream file ( fileName.c_str ( ), ios::in|ios::ate|ios::binary ); if ( file.is_open ( ) ) { long size = (long) file.tellg ( ); long numBytesRead; if ( readTillEof ) { numBytesRead = size - startIndex; } else { numBytesRead = endIndex - startIndex + 1; } // Allocate a new buffer ptr to read in the file data BufferSptr buf (new Buffer ( numBytesRead ) ); mpStreamingClientEngine->SetResponseBuffer ( nextRequest, buf ); // Seek to the start index of the byte range // and read the data file.seekg ( startIndex, ios::beg ); file.read ( (char *)buf->GetData(), numBytesRead ); // Pass on the data to the SCE // and signal completion of request mpStreamingClientEngine->HandleDataReceived( nextRequest, numBytesRead); mpStreamingClientEngine->MarkRequestCompleted( nextRequest ); // Close the file file.close ( ); } else { // Report error to the Streaming Client Engine // as unable to open file AHS_ERROR ( ConnectionManager, " Error while opening file \"%s\"\n", fileName.c_str ( ) ); mpStreamingClientEngine->HandleRequestFailed( nextRequest, CONNECTION_FAILED ); } }

  Read the article

• How do I open a file in such a way that if the file doesn't exist it will be created and opened automatically?

  - by snakile

  Here's how I open a file for writing+ : if( fopen_s( &f, fileName, "w+" ) !=0 ) { printf("Open file failed\n"); return; } fprintf_s(f, "content"); If the file doesn't exist the open operation fails. What's the right way to fopen if I want to create the file automatically if the file doesn't already exist? EDIT: If the file does exist, I would like fprintf to overwrite the file, not to append to it.

  Read the article

• Problem with File uplolad in javascript.

  - by Nikhil

  I have used javascript to upload more than one file. when user clicks on 'add more' javascript appends new object to older div using innerHTML. Now the problem is if I select a file and then click on "add more" then new file button exist but older selected file removes and two blank file buttons display. I want this old file must be selected when user add new file button. If anybody can, Help Plz!!! tnX.

  Read the article

• How to get the value of an attribute from XML file in PHP?

  - by Matt

  Hi, Sorry if this seems like an easy question, but I've started pulling hair out on this... I have a XML file which looks like this... <VAR VarNum="90"> <option>1</option> </VAR> I'm trying to get the VarNum. So far I've been successful using the follow code to get the other information: $xml=simplexml_load_file($file); $option=$xml->option; I just can't get VarNum (the attribute value I think?) Thanks!

  Read the article

• excel cannot open the file xxx.xlsx' because the file format is not valid error

  - by Yavuz

  I have difficulty open opening word and excel files suddenly. Only particular office file give me the problem. These files were previously scanned by combo fix and I believe they were damaged. The error response that I from office is Excel cannot open the file xxx.xlsx because the file format is not valid. Verify that the file has not been corrupted and that the file extension matches the format of the file. This is for excel and a similar kind of error response comes for word. The file looks fine. I mean the size vise... Please help me with this problem. I really appreciate your help and time....

  Read the article

• Upon clicking on a file, excel opens but not the file itself

  - by william

  Platform: Windows XP SP2, Excel 2007 Problem description: Upon clicking on a file in Windows Explorer (file is either .xls or .xlsx) Excel 2007 opens, but does not open the file itself. I need either to click on a file again in Windows Explorer or open it manually with File/Open ... from Excel. Does anyone know what could cause this rather strange behaviour ? The old versions of Excel worked "normally" ... i.e. upon clicking on a file, an Excel would open along with the file. Please, help !

  Read the article

• PHP won't load php.ini

  - by Chuck

  I am racking my brain here and I must be doing something really stupid. I'm trying to setup PHP on Win2008 R2/IIS 7.5. I unpacked php538 into c:\php538 and renamed the php.ini-development to php.ini. Then i tried going to a command prompt and running: c:\php358\php -info I get: Configuration File (php.ini) Path => C:\windows Loaded Configuration File => (none)Scan this dir for additional .ini files => (none) Additional .ini files parsed => (none) Loaded Configuration File => (none) Scan this dir for additional .ini files => (none) Additional .ini files parsed => (none) I have tried using php5217. I tried putting php.ini in c:\windows. I tried creating the PHPRC envrionment variable and pointing it to c:\php358. Every time I have the same problem. PHP does not find or load the ini file. If I run: c:\php358\php -c php.ini -info Then it will load the file. But I shouldn't have to do this for PHP to find the file in the same directory, in the Windows directory, or using the environment variable, so I'm stumped. When I try to run PHP from IIS I get a 500 error and I can only assume at this time it is because it can't find and load the php.ini file correctly. I see similar questions on here, but none seem to address the problem I am having.

  Read the article

< Previous Page | 28 29 30 31 32 33 34 35 36 37 38 39  | Next Page >