Search Results

Search found 28924 results on 1157 pages for 'open sourse'.

Page 321/1157 | < Previous Page | 317 318 319 320 321 322 323 324 325 326 327 328  | Next Page >

  • Access Denied Java FileWriter / FileInputStream

    - by Matt
    My program downloads a websites source code, modifies it, creates the file, and then reuploads it through the FTP. However, I receive the following error when trying to open the created file: java.io.FileNotFoundException: misc.html (Access is denied) at java.io.FileInputStream.open(Native Method) at java.io.FileInputStream.<init>(Unknown Source) at Manipulator.uploadSource(Manipulator.java:63) at Start.addPicture(Start.java:130) at Start$2.actionPerformed(Start.java:83) at javax.swing.AbstractButton.fireActionPerformed(Unknown Source) at javax.swing.AbstractButton$Handler.actionPerformed(Unknown Source) at javax.swing.DefaultButtonModel.fireActionPerformed(Unknown Source) at javax.swing.DefaultButtonModel.setPressed(Unknown Source) at javax.swing.plaf.basic.BasicButtonListener.mouseReleased(Unknown Source) at java.awt.Component.processMouseEvent(Unknown Source) at javax.swing.JComponent.processMouseEvent(Unknown Source) at java.awt.Component.processEvent(Unknown Source) at java.awt.Container.processEvent(Unknown Source) at java.awt.Component.dispatchEventImpl(Unknown Source) at java.awt.Container.dispatchEventImpl(Unknown Source) at java.awt.Component.dispatchEvent(Unknown Source) at java.awt.LightweightDispatcher.retargetMouseEvent(Unknown Source) at java.awt.LightweightDispatcher.processMouseEvent(Unknown Source) at java.awt.LightweightDispatcher.dispatchEvent(Unknown Source) at java.awt.Container.dispatchEventImpl(Unknown Source) at java.awt.Window.dispatchEventImpl(Unknown Source) at java.awt.Component.dispatchEvent(Unknown Source) at java.awt.EventQueue.dispatchEvent(Unknown Source) at java.awt.EventDispatchThread.pumpOneEventForFilters(Unknown Source) at java.awt.EventDispatchThread.pumpEventsForFilter(Unknown Source) at java.awt.EventDispatchThread.pumpEventsForHierarchy(Unknown Source) at java.awt.EventDispatchThread.pumpEvents(Unknown Source) at java.awt.EventDispatchThread.pumpEvents(Unknown Source) at java.awt.EventDispatchThread.run(Unknown Source) When I navigate to the folder directory and attempt to open "misc.html" with Notepad I receive Access is Denied. My code is fairly simple: File f = new File(page.sourceFileName); try { FileWriter out = new FileWriter(f); out.write(page.source); out.close(); } catch (IOException e) { e.printStackTrace(); } InputStream input = new FileInputStream(f); This is the vital excerpt from my program. I have copied this into a different test program and it works fine, I create a misc.html file and reopen it with both FileInputStream and manually. I would be worried about Administrator rights but the Test program works fine when I run it RIGHT after the problem program. I also have checked if the file exists and is a file with File methods and it is as well. Is this a result of me not closing a previous Input/Output properly? I've tried to check everything and I am fairly positive I close all streams as soon as they finish... Help! :)

    Read the article

  • Collaborative localization website supporting Android strings.xml?

    - by Nicolas Raoul
    My open source Android application has internationalization done the Android way, with strings.xml files. The community has many people from many countries, and they are willing to contribute/improve translations using a collaborative website. There is Launchpad but it only supports the gettext format so we would have to use scripts, not very convenient. There is Crowdin but somehow this website seems dead, nearly no projects, and the download links do not work. Actually we started using Crowdin but all download links fail to give any strings.xml file back, see here. What website is convenient for translating open source Android applications?

    Read the article

  • simple python file writing question

    - by aharon
    I'm learning Python, and have run into a bit of a problem. On my OSX install of Python 3.1, this happens in the console: >>> filename = "test" >>> reader = open(filename, 'r') >>> writer = open(filename, 'w') >>> reader.read() '' >>> writer.write("hello world\n") 12 >>> reader.read() '' And calling more test in BASH confirms that there is nothing in test. What's going on? Thanks.

    Read the article

  • Extract a C/C++ header file from a C# class exposed to COM

    - by isorfir
    I'm not sure I've setup everything I've needed to in my C# class to properly, but it does work in COM. I've been looking for an example of a C# class that was successfully used in a C/C++ project, but haven't come across anything. I've tried using the OLE/COM Object View app to open the .tlb file and save as .h, but it gives some errors: MIDL1009: unknown argument ignored; MIDL1001: cannot open input file Studio "Studio" isn't the name of the file, it's Syslog, so that raises a red flag to me. Any ideas?

    Read the article

  • Link to another file in chrome extension

    - by Hintswen
    I want to have a link in the popup.html file for my extension that loads another file (which will be included with the extension) how can I do this? or will I need to keep it in the same page? I tried using this code: <a href="/mail.html"> <img id="newmail_icon" src="" width="16" height="16" /> <span id="newmail">loading</span><br /> </a> But when I click the link nothing happens. I just found out that adding target="_blank" to the link will make it work and open in a new tab, but I can't get it to open in the popup. I have tried target="_self" but it didn't do anything.

    Read the article

  • Virtual drivers with Windows Driver Model - where to begin?

    - by waitinforatrain
    I've never written drivers before but I'm starting an open-source project that involves creating virtual MIDI ports that will send the MIDI data over a network. For this, I presume I would be creating some sort of virtual driver using WDM (unless it's possible with kernel hooks?) - but being a beginner to driver development I don't know where to begin. Does anyone know any useful resources that would help me with this project? Or some open-source code from a similar project that I could fork as a starting point?

    Read the article

  • XSLT: How to escape square brackets in Urls

    - by ilariac
    I have a set of records from Solr where field[@name='url'] can have the following format: http://url/blabla/blabla.aspx?sv=[keyword%20keyword,%201] My understanding is that the square brackets denote an array syntax and I would like to use XSLT to remove the square brackets from all Urls. The reason for this is that I am using an Open URL resolver, which does not currently handle well those characters. The best option would be to strip the square brackets from all URLs before such resources are mediated by the Open URL resolver. There are cases where I have multiple occurrences of square brackets per Url. Can you please help me with this? Thanks for your help, I.

    Read the article

  • Excel macro send rich mail using LotusNotes

    - by CC
    Hi everybody. I'm working on a small macro to send mail from excel 2007 using my Lotus Notes session. The sending mail part is working fine. Now I need to send in the body part, a part of a stylesheet (for instance the area from A1:B20). This area has colors, bold font. To send my email here is the code: Set oSess = CreateObject("Notes.NotesSession") Set oDB = oSess.GETDATABASE("", "") Call oDB.OPENMAIL flag = True If Not (oDB.IsOpen) Then flag = oDB.Open("", "") If Not flag Then MsgBox "Can't open mail file: " & oDB.SERVER & " " & oDB.FILEPATH End If On Error GoTo err_handler 'Building Message Set oDoc = oDB.CREATEDOCUMENT Set oItem = oDoc.CREATERICHTEXTITEM("BODY") oDoc.Form = "Memo" 'mail subject oDoc.Subject = "subject" 'mail body oDoc.sendto = "[email protected]" oDoc.body = "my text" oDoc.postdate = Date oDoc.SaveMessageOnSend = True oDoc.visable = True 'Sending Message oDoc.SEND False Does anybody has an idea about how to send a stylesheet ? Thanks alot.

    Read the article

  • Avoiding nesting two for loops

    - by chavanak
    Hi, Please have a look at the code below: import string from collections import defaultdict first_complex=open( "residue_a_chain_a_b_backup.txt", "r" ) first_complex_lines=first_complex.readlines() first_complex_lines=map( string.strip, first_complex_lines ) first_complex.close() second_complex=open( "residue_a_chain_a_c_backup.txt", "r" ) second_complex_lines=second_complex.readlines() second_complex_lines=map( string.strip, second_complex_lines ) second_complex.close() list_1=[] list_2=[] for x in first_complex_lines: if x[0]!="d": list_1.append( x ) for y in second_complex_lines: if y[0]!="d": list_2.append( y ) j=0 list_3=[] list_4=[] for a in list_1: pass for b in list_2: pass if a==b: list_3.append( a ) kvmap=defaultdict( int ) for k in list_3: kvmap[k]+=1 print kvmap Normally I use izip or izip_longest to club two for loops, but this time the length of the files are different. I don't want a None entry. If I use the above method, the run time becomes incremental and useless. How am I supposed to get the two for loops going? Cheers, Chavanak

    Read the article

  • File.OpenText method is not declared error

    - by Nandini
    Hi, i have a fileupload control from which i need the path of a text file. After selecting the file,i need to open the file for reading the data from the text file.For this, i used the following code to open the text file. fp=File.OpenText(FileUpload2.PostedFile.FileName) This is working fine in my system.The FileUpload2.PostedFile.FileName statement gives the path of the file.The File.OpenText method opens the selected file.But when i run my project in IIS,it gives the following error: "File.OpenText is not declared." The FileUpload2.PostedFile.FileName statement is not retrieving the path, it retrieves only only the filename.what could be the reason?

    Read the article

  • JSF HIBERNATE POSTGRESQL

    - by user312619
    When I press "Save" button I get an exception like that ; javax.servlet.ServletException: org.hibernate.exception.JDBCConnectionException: Cannot open connection javax.faces.webapp.FacesServlet.service(FacesServlet.java:325) root cause javax.faces.el.EvaluationException: org.hibernate.exception.JDBCConnectionException: Cannot open connection javax.faces.component.MethodBindingMethodExpressionAdapter.invoke(MethodBindingMethodExpressionAdapter.java:102) com.sun.faces.application.ActionListenerImpl.processAction(ActionListenerImpl.java:102) javax.faces.component.UICommand.broadcast(UICommand.java:315) javax.faces.component.UIViewRoot.broadcastEvents(UIViewRoot.java:775) javax.faces.component.UIViewRoot.processApplication(UIViewRoot.java:1267) com.sun.faces.lifecycle.InvokeApplicationPhase.execute(InvokeApplicationPhase.java:82) com.sun.faces.lifecycle.Phase.doPhase(Phase.java:101) com.sun.faces.lifecycle.LifecycleImpl.execute(LifecycleImpl.java:118) javax.faces.webapp.FacesServlet.service(FacesServlet.java:312) root cause org.hibernate.exception.JDBCConnectionException: Cannot open connection org.hibernate.exception.SQLStateConverter.convert(SQLStateConverter.java:98) org.hibernate.exception.JDBCExceptionHelper.convert(JDBCExceptionHelper.java:66) org.hibernate.exception.JDBCExceptionHelper.convert(JDBCExceptionHelper.java:52) org.hibernate.jdbc.ConnectionManager.openConnection(ConnectionManager.java:449) org.hibernate.jdbc.ConnectionManager.getConnection(ConnectionManager.java:167) org.hibernate.jdbc.JDBCContext.connection(JDBCContext.java:142) org.hibernate.transaction.JDBCTransaction.begin(JDBCTransaction.java:85) org.hibernate.impl.SessionImpl.beginTransaction(SessionImpl.java:1463) sun.reflect.NativeMethodAccessorImpl.invoke0(Native Method) sun.reflect.NativeMethodAccessorImpl.invoke(Unknown Source) sun.reflect.DelegatingMethodAccessorImpl.invoke(Unknown Source) java.lang.reflect.Method.invoke(Unknown Source) org.hibernate.context.ThreadLocalSessionContext$TransactionProtectionWrapper.invoke(ThreadLocalSessionContext.java:344) $Proxy108.beginTransaction(Unknown Source) com.yemex.beans.CompanyBean.saveOrUpdate(CompanyBean.java:52) sun.reflect.NativeMethodAccessorImpl.invoke0(Native Method) sun.reflect.NativeMethodAccessorImpl.invoke(Unknown Source) sun.reflect.DelegatingMethodAccessorImpl.invoke(Unknown Source) java.lang.reflect.Method.invoke(Unknown Source) org.apache.el.parser.AstValue.invoke(AstValue.java:196) org.apache.el.MethodExpressionImpl.invoke(MethodExpressionImpl.java:276) com.sun.faces.facelets.el.TagMethodExpression.invoke(TagMethodExpression.java:98) javax.faces.component.MethodBindingMethodExpressionAdapter.invoke(MethodBindingMethodExpressionAdapter.java:88) com.sun.faces.application.ActionListenerImpl.processAction(ActionListenerImpl.java:102) javax.faces.component.UICommand.broadcast(UICommand.java:315) javax.faces.component.UIViewRoot.broadcastEvents(UIViewRoot.java:775) javax.faces.component.UIViewRoot.processApplication(UIViewRoot.java:1267) com.sun.faces.lifecycle.InvokeApplicationPhase.execute(InvokeApplicationPhase.java:82) com.sun.faces.lifecycle.Phase.doPhase(Phase.java:101) com.sun.faces.lifecycle.LifecycleImpl.execute(LifecycleImpl.java:118) javax.faces.webapp.FacesServlet.service(FacesServlet.java:312) root cause java.sql.SQLException: No suitable driver found for jdbc:postgresql://localhost/postgres java.sql.DriverManager.getConnection(Unknown Source) java.sql.DriverManager.getConnection(Unknown Source) org.hibernate.connection.DriverManagerConnectionProvider.getConnection(DriverManagerConnectionProvider.java:133) org.hibernate.jdbc.ConnectionManager.openConnection(ConnectionManager.java:446) org.hibernate.jdbc.ConnectionManager.getConnection(ConnectionManager.java:167) org.hibernate.jdbc.JDBCContext.connection(JDBCContext.java:142) org.hibernate.transaction.JDBCTransaction.begin(JDBCTransaction.java:85) org.hibernate.impl.SessionImpl.beginTransaction(SessionImpl.java:1463) sun.reflect.NativeMethodAccessorImpl.invoke0(Native Method) sun.reflect.NativeMethodAccessorImpl.invoke(Unknown Source) sun.reflect.DelegatingMethodAccessorImpl.invoke(Unknown Source) java.lang.reflect.Method.invoke(Unknown Source) org.hibernate.context.ThreadLocalSessionContext$TransactionProtectionWrapper.invoke(ThreadLocalSessionContext.java:344) $Proxy108.beginTransaction(Unknown Source) com.yemex.beans.CompanyBean.saveOrUpdate(CompanyBean.java:52) sun.reflect.NativeMethodAccessorImpl.invoke0(Native Method) sun.reflect.NativeMethodAccessorImpl.invoke(Unknown Source) sun.reflect.DelegatingMethodAccessorImpl.invoke(Unknown Source) java.lang.reflect.Method.invoke(Unknown Source) org.apache.el.parser.AstValue.invoke(AstValue.java:196) org.apache.el.MethodExpressionImpl.invoke(MethodExpressionImpl.java:276) com.sun.faces.facelets.el.TagMethodExpression.invoke(TagMethodExpression.java:98) javax.faces.component.MethodBindingMethodExpressionAdapter.invoke(MethodBindingMethodExpressionAdapter.java:88) com.sun.faces.application.ActionListenerImpl.processAction(ActionListenerImpl.java:102) javax.faces.component.UICommand.broadcast(UICommand.java:315) javax.faces.component.UIViewRoot.broadcastEvents(UIViewRoot.java:775) javax.faces.component.UIViewRoot.processApplication(UIViewRoot.java:1267) com.sun.faces.lifecycle.InvokeApplicationPhase.execute(InvokeApplicationPhase.java:82) com.sun.faces.lifecycle.Phase.doPhase(Phase.java:101) com.sun.faces.lifecycle.LifecycleImpl.execute(LifecycleImpl.java:118) javax.faces.webapp.FacesServlet.service(FacesServlet.java:312)

    Read the article

  • SSL confirmation dialog popup auto closes in IE8 when re-accessing a JNLP file

    - by haylem
    I'm having this very annoying problem to troubleshoot and have been going at it for way too many days now, so have a go at it. The Environment We have 2 app-servers, which can be located on either the same machine or 2 different machines, and use the same signing certificate, and host 2 different web-apps. Though let's say, for the sake of our study case here, that they are on the same physical machine. So, we have: https://company.com/webapp1/ https://company.com/webapp2/ webapp1 is GWT-based rich-client which contains on one of its screens a menu with an item that is used to invoke a Java WebStart Client located on webapp2. It does so by performing a simple window.open call via this GWT call: Window.open("https://company.com/webapp2/app.jnlp", "_blank", null); Expected Behavior User merrilly goes to webapp1 User navigates to menu entry to start the WebStart app and clicks on it browser fires off a separate window/dialog which, depending on the browser and its security settings, will: request confirmation to navigate to this secure site, directly download the file, and possibly auto-execute a javaws process if there's a file association, otherwise the user can simply click on the file and start the app (or go about doing whatever it takes here). If you close the app, close the dialog, and re-click the menu entry, the same thing should happen again. Actual Behavior On Anything but God-forsaken IE 8 (Though I admit there's also all the god-forsaken pre-IE8 stuff, but the Requirements Lords being merciful we have already recently managed to make them drop these suckers. That was close. Let's hold hands and say a prayer of gratitude.) Stuff just works. JNLP gets downloaded, app executes just fine, you can close the app and re-do all the steps and it will restart happily. People rejoice. Puppies are safe and play on green hills in the sunshine. Developers can go grab a coffee and move on to more meaningful and rewarding tasks, like checking out on SO questions. Chrome doesn't want to execute the JNLP, but who cares? Customers won't get RSI from clicking a file every other week. On God-forsaken IE8 On the first visit, the dialog opens and requests confirmation for the user to continue to webapp2, though it could be unsafe (here be dragons, I tell you). The JNLP downloads and auto-opens, the app start. Your breathing is steady and slow. You close the app, close that SSL confirmation dialog, and re-click the menu entry. The dialog opens and auto-closes. Nothing starts, the file wasn't downloaded to any known location and Fiddler just reports the connection was closed. If you close IE and reach that menu item to click it again, it is now back to working correctly. Until you try again during the same session, of course. Your heart-rate goes up, you get some more coffee to make matters worse, and start looking for plain tickets online and a cheap but heavy golf-club on an online auction site to go clubbing baby polar seals to avenge your bloodthirst, as the gates to the IE team in Redmond are probably more secured than an ice block, as one would assume they get death threats often. Plus, the IE9 and IE10 teams are already hard at work fxing the crap left by their predecessors, so maybe you don't want to be too hard on them, and you don't have money to waste on a PI to track down the former devs responsible for this mess. Added Details I have come across many problems with IE8 not downloading files over SSL when it uses a no-cache header. This was indeed one of our problems, which seems to be worked out now. It downloads files fine, webapp2 uses the following headers to serve the JNLP file: response.setHeader("Cache-Control", "private, must-revalidate"); // IE8 happy response.setHeader("Pragma", "private"); // IE8 happy response.setHeader("Expires", "0"); // IE8 happy response.setHeader("Access-Control-Allow-Origin", "*"); // allow to request via cross-origin AJAX response.setContentType("application/x-java-jnlp-file"); // please exec me As you might have inferred, we get some confirmation dialog because there's something odd with the SSL certificate. Unfortunately I have no control over that. Assuming that's only temporary and for development purposes as we usually don't get our hands on the production certs. So the SSL cert is expired and doesn't specify the server. And the confirmation dialog. Wouldn't be that bad if it weren't for IE, as other browsers don't care, just ask for confirmation, and execute as expected and consistantly. Please, pretty please, help me, or I might consider sacrificial killings as an option. And I think I just found a decently prized stainless steel golf-club, so I'm right on the edge of gore. Side Notes Might actually be related to IE8 window.open SSL Certificate issue. Though it doesn't explain why the dialog would auto-close (that really is beyong me...), it could help to not have the confirmation dialog and not need the dialog at all. For instance, I was thinking that just having a simple URL in that menu instead of have it entirely managed by GWT code to invoke a Window.open would solve the problem. But I don't have control on that menu, and also I'm very curious how this could be fixed otherwise and why the hell it happens in the first place...

    Read the article

  • How do I run a vim script that alters the current buffer?

    - by Dan
    I'm trying to write a beautify.vim script that makes C-like code adhere to a standard that I can easily read. My file contains only substitution commands that all begin with %s/... However, when I try to run the script with my file open, in the manner :source beautify.vim, or :runtime beautify.vim, it runs but all the substitute commands state that their pattern wasn't found (patterns were tested by entering them manually and should work). Is there some way to make vim run the commands in the context of the current buffer? beautify.vim: " add spaces before open braces sil! :%s/\%>1c>\s\@<!{/ {/g " beautify for sil! :%s/for *( *\([^;]*\) *; *\([^;]*\) *; *\([^;]*\) *)/for (\1; \2; \3)/ " add spaces after commas sil! :%s/,\s\@!/, /g In my tests the first :s command should match (it matches when applied manually).

    Read the article

  • Looping an executable to get the result from Python script

    - by fx
    In my python script, I need to call within a for loop an executable, and waiting for that executable to write the result on the "output.xml". How do I manage to use wait() & how do I know when one of my executable is finished generating the result to get the result? How do I close that process and open a new one to call again the executable and wait for the new result? import subprocess args = ("bin/bar") popen = subprocess.Popen(args) I need to wait for the output from "bin/bar" to generate the "output.xml" and from there, read it's content. for index, result in enumerate(results): myModule.callSubProcess(index) #this is where the problem is. fileOutput = open("output.xml") parseAndStoreInSQLiteFileOutput(index, file)

    Read the article

  • Ruby Thread with "watchdog"

    - by Sergio Campamá
    I'm implementing a ruby server for handling sockets being created from GPRS modules. The thing is that when the module powers down, there's no indication that the socket closed. I'm doing threads to handle multiple sockets with the same server. What I'm asking is this: Is there a way to use a timer inside a thread, reset it after every socket input, and that if it hits the timeout, closes the thread? Where can I find more information about this? EDIT: Code example that doesn't detect the socket closing require 'socket' server = TCPServer.open(41000) loop do Thread.start(server.accept) do |client| puts "Client connected" begin loop do line = client.readline open('log.txt', 'a') { |f| f.puts line.strip } end rescue puts "Client disconnected" end end end

    Read the article

  • how to show a html webpage in a GUI in Java

    - by Robert
    Dear all, I've recently worked on a project on search query,and I am only last step away from completion. Now I have a nice URL,and can open it in "cmd /c start" statement in Java,and it causes an IE window open. However,my advisor is not satisfied with that,he wants to see this webpage(actually,two webpages) opened in a GUI interface. So could you please give a detailed instruction on how to achieve this in Java,please?If you are trying to offer me a helpful package,would you please kindly also show how to use that as well,since I am new to this GUI development,and I only know the basics of Swing. Thanks a lot,it is dued within this week.

    Read the article

  • properies profile when writing word file

    - by avani-nature
    Hai frnds i am new to php i am having following problems in my coding... 1.Actually i am opening word document with com object and storing it in textarea. 2.when content gets opened in textarea i am editing that content and saving the document 3.actually when i edited that file and done save after that if i open word document then file properties-custom the old content getting removed i wannt to retain that even if i edited the word document..please do the needful i am using below code <?php $filename = 'C:/xampp/htdocs/mts/sites/default/files/a.doc'; //echo $filename; if(isset($_REQUEST['Save'])){ $somecontent = stripslashes($_POST['somecontent']); // Let's make sure the file exists and is writable first. if (is_writable($filename)) { // In our example we're opening $filename in append mode. // The file pointer is at the bottom of the file hence // that's where $somecontent will go when we fwrite() it. if (!$handle = fopen($filename, 'w')) { echo "Cannot open file ($filename)"; exit; } // Write $somecontent to our opened fi<form action="" method="get"></form>le. if (fwrite($handle, $somecontent) === FALSE) { echo "Cannot write to file ($filename)"; exit; } echo "Success, wrote ($somecontent) to file ($filename) <a href=".$_SERVER['PHP_SELF']."> - Continue - "; fclose($handle); } else { echo "The file $filename is not writable"; } } else{ // get contents of a file into a string $handle = fopen($filename, "r"); $somecontent = fread($handle, filesize($filename)); $word = new COM("word.application") or die ("Could not initialise MS Word object."); $word->Documents->Open(realpath("$filename")); // Extract content. $somecontent = (string) $word->ActiveDocument->Content; //echo $somecontent; $word->ActiveDocument->Close(false); $word->Quit(); $word = null; unset($word); fclose($handle); } ?> <h6>Edit file --------><? $filenam=explode("/",$filename);$filename=$filename[7]; echo $filename ;?></h6> <form name="form1" method="post" action=""> <p> <textarea name="somecontent" cols="100" rows="20"><? echo $somecontent ;?></textarea> </p> <div style='padding-left:250px;'><input type="submit" name="Save" value="Save"></div> </p> </form> <? } ?>

    Read the article

  • Posting an action works... but no image

    - by Brian Rice
    I'm able to post an open graph action to facebook using the following url: https://graph.facebook.com/me/video.watches with the following post data: video=http://eqnetwork.com/home/video.html?f=8e7b4f27-8cbd-4430-84df-d9ccb46da45f.mp4 It seems to be getting the title from the open graph metatags at the "video" object. But, it's not getting the image (even though one is specified in the metatag "og:image"). Also, if I add this to the post data: picture=http://eqnetwork.com/icons/mgen/overplayThumbnail.ms?drid=14282&subType=ljpg&w=120&h=120&o=1&thumbnail= still no image. Any thoughts? Brian

    Read the article

  • Activation rectangle

    - by Knowing me knowing you
    Making UML sequence diagram in VS 2010RC I've observed that there is no activation rectangle in first object. Is this correct? Not according to my tutor and I have to quote him: "Finally, you have no activation rectangle for the userInterface instance, so the initial message could never have been sent." But I'm thinking that if guys from VS did that it must/should be correct. Another thing he is picking me at is and I'm quoting him: "In class diagram the generalisation arrow heads should be open triangles." In my opinion there isn't strictly said that they must be open triangles especially when software lets you choose their form. Looking forward to hear your opinions. Thanks for answers.

    Read the article

  • Reading a file with a supplied name in C++

    - by Cosmina
    I must read a file with a given name (it's caled "hamlet.txt"). The class used to read the file is defined like this #ifndef READWORDS_H #define READWORDS_H /** * ReadWords class. Provides mechanisms to read a text file, and return * capitalized words from that file. */ using namespace std; #include <string> #include <fstream> class ReadWords { public: /** * Constructor. Opens the file with the default name "text.txt". * Program exits with an error message if the file does not exist. */ ReadWords(); /** * Constructor. Opens the file with the given filename. * Program exits with an error message if the file does not exist. * @param filename - a C string naming the file to read. */ ReadWords(char *filename); My definition of the members of the classis this: #include<string> #include<fstream> #include<iostream> #include "ReadWords.h" using namespace std; ReadWords::ReadWords() { wordfile.open("text.txt"); if( !wordfile ) { cout<<"Errors while opening the file!"<<endl; } } ReadWords::ReadWords(char *filename) { wordfile.open(filename); if ( !wordfile ) { cout<<"Errors while opening the file!"<<endl; } wordfile>>nextword; } And the main to test it. using namespace std; #include #include #include "ReadWords.h" int main() { char name[30]; cout<<"Please input a name for the file that you wish to open"; cin>>name; ReadWords x( name[] ); } When I complie it gives me the error: main.cpp:14: error: expected primary-expression before ']' token I know it's got something to do with the function ReadWords( char *filename), but I do not know what. Any help please?

    Read the article

  • what's the purpose of fcntl with parameter F_DUPFD

    - by Daniel
    I traced an oracle process, and find it first open a file /etc/netconfig as file handle 11, and then duplicate it as 256 by calling fcntl with parameter F_DUPFD, and then close the original file handle 11. Later it read using file handle 256. So what's the point to duplicate the file handle? Why not just work on the original file handle? 12931: 0.0006 open("/etc/netconfig", O_RDONLY|O_LARGEFILE) = 11 12931: 0.0002 fcntl(11, F_DUPFD, 0x00000100) = 256 12931: 0.0001 close(11) = 0 12931: 0.0002 read(256, " # p r a g m a i d e n".., 1024) = 1024 12931: 0.0003 read(256, " t s t p i _ c".., 1024) = 215 12931: 0.0002 read(256, 0x106957054, 1024) = 0 12931: 0.0001 lseek(256, 0, SEEK_SET) = 0 12931: 0.0002 read(256, " # p r a g m a i d e n".., 1024) = 1024 12931: 0.0003 read(256, " t s t p i _ c".., 1024) = 215 12931: 0.0003 read(256, 0x106957054, 1024) = 0 12931: 0.0001 close(256) = 0

    Read the article

  • Python file input string: how to handle escaped unicode characters?

    - by Michi
    In a text file (test.txt), my string looks like this: Gro\u00DFbritannien Reading it, python escapes the backslash: >>> file = open('test.txt', 'r') >>> input = file.readline() >>> input 'Gro\\u00DFbritannien' How can I have this interpreted as unicode? decode() and unicode() won't do the job. The following code writes Gro\u00DFbritannien back to the file, but I want it to be Großbritannien >>> input.decode('latin-1') u'Gro\\u00DFbritannien' >>> out = codecs.open('out.txt', 'w', 'utf-8') >>> out.write(input)

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • What is preferred accessible and semantically correct method to code this type of data design?

    - by jitendra
    What is preferred accessible and semantically correct method to code this type of data design? Table UL, LI DIV,SPAN For icons should i use for each place or i should is icon from CSS sprites? If we use css sprite here then how to code, and what will happen when images will be disabled ? Every link will open in new window and I have to indicate about file size also for both sighted and blind users? So what is the best method to make this design and what is best method to show icon and to indicate all type of users that file will open in new window and what is file size? Content of table should be accessible and understandable in as good as possible manner in all conditions For sighted user even if images are disabled for screen user for text browser user and if css is disabled And What is the role of Filenames of PDF, video, audio here?

    Read the article

< Previous Page | 317 318 319 320 321 322 323 324 325 326 327 328  | Next Page >