Search Results

Search found 28928 results on 1158 pages for 'line of sight'.

Page 322/1158 | < Previous Page | 318 319 320 321 322 323 324 325 326 327 328 329  | Next Page >

  • Server 2008 SP1 VSS Writers Not Responding

    - by Jason
    I've got a Windows Server 08 box on SP1 that is having some problems. We've experienced backup problems and I've traced it down to VSS Writers not responding. From the command line, if I type vssadmin list providers, I get Provider name: 'Microsoft Software Shadow Copy provider 1.0' Provider type: System Provider Id: {b5946137-7b9f-4925-af80-51abd60b20d5} Version: 1.0.0.7 If I type vssadmin list writers, I get this vssadmin 1.1 - Volume Shadow Copy Service administrative command-line tool (C) Copyright 2001-2005 Microsoft Corp. Waiting for responses. These may be delayed if a shadow copy is being prepared. I could wait this out for hours and it won't move. I looked up how Server 2008 handles VSS writers, and you can't reregister them like you could in Server 2003 http://social.technet.microsoft.com/Forums/en/windowsserver2008r2general/thread/062cc52c-899b-45f3-8d0c-798b92363f41 Does anyone know how to fix something like this or where to turn next?

    Read the article

  • IIS6 Log time recording problems

    - by Hafthor
    On three separate occasions on two separate servers at nearly the same times, 6.9 hours seemingly went by without any data being written to the IIS logs, but, on closer inspection, it appears that it was all recorded all at once. Here's the facts as I know them: Windows Server 2003 R2 w/ IIS6 Logging using GMT, server local time GMT-7. Application was still operating and I have SQL data to prove that Time gaps appear in log file, not across two # headers appear at gap Load balancer pings every 30 seconds No caching Here's info on a particular case: an entry appears for 2009-09-21 18:09:27 then #headers the next entry is for 2009-09-22 01:21:54, and so are the next 1600 entries in this log file and 370 in the next log file. about half of the ~2000 entries on 2009-09-22 01:21:54 are load balancer pings (est. at 2/min for 6.9hrs = 828 pings) then entries are recorded as normal. I believe that these events may coincide with me deploying an ASP.NET application update into those machines. Here's some relevant content from the logs in question: ex090921.log line 3684 2009-09-21 17:54:40 GET /ping.aspx - 80 404 0 0 3733 122 0 2009-09-21 17:55:11 GET /ping.aspx - 80 404 0 0 3733 122 0 2009-09-21 17:55:42 GET /ping.aspx - 80 404 0 0 3733 122 0 2009-09-21 17:56:13 GET /ping.aspx - 80 404 0 0 3733 122 0 2009-09-21 17:56:45 GET /ping.aspx - 80 404 0 0 3733 122 0 #Software: Microsoft Internet Information Services 6.0 #Version: 1.0 #Date: 2009-09-21 18:04:37 #Fields: date time cs-method cs-uri-stem cs-uri-query s-port sc-status sc-substatus sc-win32-status sc-bytes cs-bytes time-taken 2009-09-22 01:04:06 GET /ping.aspx - 80 404 0 0 3733 122 3078 2009-09-22 01:04:06 GET /ping.aspx - 80 404 0 0 3733 122 109 2009-09-22 01:04:06 GET /ping.aspx - 80 200 0 0 278 122 3828 2009-09-22 01:04:06 GET /ping.aspx - 80 200 0 0 278 122 0 2009-09-22 01:04:06 GET /ping.aspx - 80 200 0 0 278 122 0 ... continues until line 5449 2009-09-22 01:04:06 GET /ping.aspx - 80 200 0 0 277 122 0 <eof> ex090922.log #Software: Microsoft Internet Information Services 6.0 #Version: 1.0 #Date: 2009-09-22 00:00:16 #Fields: date time cs-method cs-uri-stem cs-uri-query s-port sc-status sc-substatus sc-win32-status sc-bytes cs-bytes time-taken 2009-09-22 01:04:06 GET /ping.aspx - 80 200 0 0 277 122 0 2009-09-22 01:04:06 GET /ping.aspx - 80 200 0 0 277 122 0 ... continues until line 367 2009-09-22 01:04:06 GET /ping.aspx - 80 200 0 0 277 122 0 2009-09-22 01:04:30 GET /ping.aspx - 80 200 0 0 277 122 0 ... back to normal behavior Note the seemingly correct date/time written to the #header of the new log file. Also note that /ping.aspx returned 404 then switched to 200 just as the problem started. I rename the "I'm alive page" so the load balancer stops sending requests to the server while I'm working on it. What you see here is me renaming it back so the load balancer will use the server. So, this problem definitely coincides with me re-enabling the server. Any ideas?

    Read the article

  • MSSQL, ASP.NET, IIS. SQL Server perfmon log question

    - by Datapimp23
    Hi, I'm testing a web application that runs on a hypervisor. The database server and the webserver are seperate vm's that run on the same hypervisor. We did some tests and the functions perform ok. I want you guys to look at a screenshot of a permon log of the sql 2005 server on the busiest moment. The webserver perfmon log looks fine and it's obvious that we have enough resources to present the page in a timely fashion. http://d.imagehost.org/view/0919/heavyload http://d.imagehost.org/0253/heavyloadz.jpg Zoomed out The striped blue line maxing out is the Processor que length (scale 100,0) The green line at around value 30 is Available MBytes (scale 0,01) The rest of the counters are visible on the screenshot. The sql server machine has no CPU limitations on the hypervisor resources and has 5 vcpu's and 5 GB RAM. Can someone help me to interpret this log. Thanks

    Read the article

  • Configure PL2303-based USB-to-RS232 adapter to stay awake when no active device is present

    - by casualuser
    I am resurrecting some X10 devices with the aid of a USB-to-RS232 adapter. The problem is, that the adapter only works with the Firecracker device when there is another serial device on the line (the Firecracker is a pass-through device that monitors the RTS and DTR lines to do its magic). Is the PL2303 going to sleep without a real device on the line? Is there an option or command to keep it awake? Is there a cable configuration that would make it work without a real serial device present?

    Read the article

  • Tool to launch a script driven by modem activity

    - by Will M
    Can anyone suggest a software tool (preferably under Windows XP or later) that would launch an application or script in response to a phone call being received on a landline phone line connected to a data modem on the same PC? or, better, in response to a sequence of touch-tones being played over such a phone line. This would allow, for example, using the telephone to manipulate firewall settings so as to create another layer of security in connection with remote internet access to that computer. I seem to recall seeing tools to do this sort of thing in the days before broadband internet access, when there was more attention to various tips and tricks for the dial-up modem, but a few attempts at Google hasn't turned anything up.

    Read the article

  • Enabling openssl With PHP/nginx

    - by reefine
    I'm getting the following error when trying to connect to SMTP + SSL through PHP using nginx + PHP 5, Could not connect to smtp host 'ssl://smtp.gmail.com' (5) (Unable to find the socket transport "ssl" - did you forget to enable it when you configured PHP?) In phpinfo I see: OpenSSL support disabled (install ext/openssl) This leads me to believe I've installed OpenSSL incorrectly. I've read a bunch of places where I should uncomment the following line: extension = php_openssl.dll This line does not exist so I added it to the end of my php.ini to no avail. The php_openssl.dll file does not exist anywhere on my server.

    Read the article

  • -w test on OS X gives command not found error

    - by RobV
    I'm writing a bash script which I'm testing on OS X though it will ultimately run on a standard Linux environment and running into a weird error. I have tests like this in my script: if [ ! -w $BP ]; then echo "'$1' not writable" exit 1 fi Which seems pretty sane to me and works fine under Linux but when trying to test on OS X I get the following error message: startSvr.sh: line 135: [: missing `]' startSvr.sh: line 135: -w: command not found So is this a case of OS X not supporting the -w test or is there some other reason this isn't working for me? e.g. environment

    Read the article

  • iPhone Docked Playing Through PC, Buzzing.

    - by DrFloyd5
    Hi. I have an iPhone that I fit into an Apple dock. There is an audio cable from dock into the line in on my sound card. My headphones are plugged into the line out. I get this really quite buzz that is fairly constant, but changes as the iphone "does stuff". It's not so bad when the music is playing. But when it stops I get the buzz, so I can't really use my headphones as "noise cancellation." It doesn't help to change my volume sliders on the PC. Any ideas? Thanks in advance.

    Read the article

  • Know any file compare utility for chunks of text?

    - by Belun
    Is there any file-compare utility-software that can help me compare chunks of text from two text files ? As in, I want to know what chunks of text that are in one file can be found again in the second file. What I need to do is more like a 'compare and search' operation, not just a compare line by line. I need this for finding common errors in application logs. Eg., I have a Java application and logs from two different days. I want to find out which stack-traces (that are actually chunks of text inside a text file) are common to both days.

    Read the article

  • How to configure Notepad++ (Scintilla) to write below EOF after EOL [on hold]

    - by Piotr Piaseczny
    Is it possible to configure scintilla to "brake" EOL/EOF while writing ? Now, if I want to begin writing in a column after EOL, I use ALT+left mouse button and start typing after click. No idea how to begin writing below EOF. Pressing Enter key many times is the only method now. Other explanation: If You open a new document, doesnt matter what kind of (php/txt etc) all You have is just one line. If You want to write in line 5 - must press Enter 5 times. Every other editor I know (IDE in Builder C++/MultiEdit) "ignore" eof and you can write anywhere in document. Because of php/html I've found notepad++ as a best editor but I'd like to "brake" limitations of (probably) scintilla

    Read the article

  • Unable to delete files in Temporary Internet Files folder

    - by Johnny
    I'm on Win7. I have a large number of of large .bin files, totaling 183GB, in my Temporary Internet Files folder. They all seem to come from video sharing sites like youtube. The files are invisible in Explorer even after allowing viewing of hidden files. The only way I can see them is by issuing "dir /fs" on the command line. Now when I try to delete them from the command line nothing happens. Trying to delete the whole folder from Explorer results in access denied because another process is using a file in the folder (IE is not running while I'm doing this). Trying to clear the folder using IE is also unsuccessful. How do I delete these files? How did they end up being there without being deleted by IE?

    Read the article

  • How do I allow a (local) user to start/stop services with a scheduled task?

    - by Mulmoth
    Hi, on a Windows 2008 R2 server I have two small .cmd-scripts to start/stop a certain service. They look like this net start MyService and net stop MyService I want to execute these script via scheduled task, and I thought it would be best to create a local user for this job. The user is not member of the Administrators group. But the scripts fail with exit code 2. When I logon with this local user and try to execute these script in command line, I see a message like (maybe not exactly translated from german to english): Error code 5: Access denied It doesn't matter whether I start the command line as Administrator or not. How can this local user gain rights to do the job?

    Read the article

  • How to run nodejs on linux platform

    - by rotem
    How to run node.js on host with linux platform? To run node.js on localhost with windows operation system is simple I download package from nodejs.org/download/ and I execute Windows Installer (.msi) I go to console command line and I type node file.js and everything fine. but in my host with linux platform I have control panel with no option to run type file exe, msi and there is no window with command line, So how can I be able to run nodejs on my host? I call to support of my hosting bluehost.com and they don't know. my Details server and control panel Thanks for any help

    Read the article

  • PHP session files have permissions of 000 - They're unusable

    - by vanced
    I kept having issues with a Document Management System I'm trying to install as, at the first step of the installation process, it would error with: Warning: Unknown: open(/tmp/sess_d39cac7f80834b2ee069d0c867ac169c, O_RDWR) failed: Permission denied (13) in Unknown on line 0 Warning: Unknown: Failed to write session data (files). Please verify that the current setting of session.save_path is correct (/tmp) in Unknown on line 0 I looked in /tmp and saw the sess_* files have the following permissions ---------- 1 vanced vanced 1240 Jan 20 08:48 sess_d39cac7f80834b2ee069d0c867ac169c All the session files look like this. So obviously, they're unusable by PHP and it's causing me lots of problems. How can I get PHP to set the correct permissions? I've tried changing the directory which php.ini uses to /tmp/phpsessions and the same thing occurs. The directories are a+rwx.

    Read the article

  • How to failover to local account on a cisco switch/router if radius server fails?

    - by 3d1l
    I have the following configuration on a switch that I testing for RADIUS authentication: aaa new-model aaa authenticaton login default group radius local aaa authentication enable default group radius enable aaa authorization exec default group radius local enable secret 5 XXXXXXXXX ! username admin secret 5 XXXXXXXXX ! ip radius source-interface FastEthernet0/1 radius-server host XXX.XXX.XXX.XXX auth-port 1812 acct-port 1813 key XXXXXXXXX radius-server retransmit 3 ! line con 0 line vty 5 15 Radius authentication is working just fine but if the server is not available I can not log into the router with the ADMIN account. What's wrong there? Thanks!

    Read the article

  • Pressing 'Enter' doesn't really work in Firefox

    - by inkedmn
    When I'm typing just about anywhere in Firefox on OSX and press enter, it simply doesn't do anything. This includes typing in a textarea element (which should take the cursor to the next line), in a search form (which should submit the form). I'm typing this very question in Firefox right now and I'm unable to advance the cursor to the beginning of the next line. I have no clue what I did to make this happen, but it's kinda driving me insane. This is Firefox 3.6.3 under Mac OS X 10.6. Thanks!

    Read the article

  • xm console command is not working in XEN

    - by stillStudent
    I have XEN 4.0.x.x rpm with CENT OS. I have set it up and have many VMs on it. But problem is when I execute 'xm console ' command from dom0, command just hangs dom0 and some 'y' comes up in next line but nothing really happens. Is it a bug in xen 4.0 and I need to upgrade it or I can tweak some configuration file in /etc/xen/ to make it work. I found following at some site but its not working: In order to be able to login to your domU from the console using: xm create {your hostname}.cfg -c (to the set root password for ssh, for instance, or to see more output than just kernel output when debugging) it may be necessary to add the following line to your /etc/xen/{your hostname}.cfg extra='xencons=tty' Is there any other way to solve it?

    Read the article

  • Map keys in Vim

    - by efficiencyIsBliss
    I want to map e to mean end of line. I tried the following mapping in my vimrc: map $ e $ is the default end of line command. However, this doesn't work. I'm wondering what the problem is. Also, I want to map Alt+right/left arrow to navigate words. So, for example, Alt+right arrow would take me to end of word. This command is currently mapped to e. Any tips on how I would go about doing this? Thanks!

    Read the article

  • Automating the installation using SSH

    - by RAY
    I am running a bash script from a remote host to run a binary file which installs 64 bit JDK 6 update 29 on multiple VMs across the Environment. It is installing the file but, at the last line i have to hit a enter to complete the installation. I want to fully automate the script where i do not have to hit the enter at the last line. This is what i am using ssh ${V_TIERS}@${V_TIERS} 'cd JDK; sh jdk-6u29-solaris-sparcv9.sh' It updates as desired, but during install i have to hit enter to continue and complete the installation. Can anybody please help to fully automate the update process.

    Read the article

  • How to reformat reStructuredText?

    - by wal-o-mat
    I'm writing reST in vim, which handles line breaks for me (after 80 chars). However, since I frequently go back and edit the text before, lines get ugly again. For example, in tables, it's sometimes annoying to re-format a complete table just because you need a line break in some place. So I wish I had a program that reads my ugly-but-correct reStructuredText and outputs it nicely formatted and wrapped. I found that pandoc in.rst -w rst mostly works, but it has some drawbacks. For example :author: John Doe becomes author John Doe and title formatting is changed as well. Sadly, there seems to be no rst2rst or something similar. Does anyone have some advice?

    Read the article

  • Convert text to table

    - by Quattro
    I would like convert text into a table. Here is a link to the text http://www.tcdb.org/public/tcdb Short example: >gnl|TC-DB|A0CIB0|1.A.17.3.1 Chromosome undetermined scaffold_19, whole genome shotgun sequence OS=Paramecium tetraurelia GN=GSPATT00007662001 PE=4 SV=1 MDDQNQPILQEQPKPKQKKPLLNTKMVKKQKMQNKKEENLREILNFYTNQVDARKFLQKM KAVVDSNQQEKKYQDDFLNPNEYNEMQDIYEDYNMGDLVIVFPNPDADGVKNPPITYKEA PLTKTNFYSKIGNVSYENDIDELCVDEMEYLRNMRNVDGEHMDQDHVKEEI >gnl|TC-DB|A0CS82|9.B.82.1.5 Chromosome undetermined scaffold_26, whole genome shotgun sequence - Paramecium tetraurelia. MIIEEQIEEKMIYKAIHRVKVNYQKKIDRYILYKKSRWFFNLLLMLLYAYRIQNIGGFYI VTYIYCVYQLQLLIDYFTPLGLPPVNLEDEEEDDDQFQNDFSELPTTLSNKNELNDKEFR PLLRTTSEFKVWQKSVFSVIFAYFCTYIPIWDIPVYWPFLFCYFFVIVGMSIRKYIKHMK KYGYTILDFTKKK I wanted to have columns for example delimited with pipe | or ; |>gnl|TC-DB|A0CIB0|1.A.17.3.1| Chromosome undetermined scaffold_19, whole genome shotgun sequence OS=Paramecium tetraurelia GN=GSPATT00007662001 PE=4 SV=1| MDDQNQPILQEQPKPKQKKPLLNTKMVKKQKMQNKKEENLREILNFYTNQVDARKFLQKM KAVVDSNQQEKKYQDDFLNPNEYNEMQDIYEDYNMGDLVIVFPNPDADGVKNPPITYKEA PLTKTNFYSKIGNVSYENDIDELCVDEMEYLRNMRNVDGEHMDQDHVKEEI I am working with Windows and I don't know how to do it I just know every row starts with > I want to substitute the first whitespace in a row with a delimiter like | or ; after the first regular expression new line in a row, I want also a delimiter everything between the regular expression first new line and > should go into a new column (it's a sequence of a protein)

    Read the article

  • PHPMyAdmin running very slow over internet but fine locally

    - by columbo
    I connect to PHPMyAdmin remotely on a Centos server using my local PC via Firefox. Usually it's fine but today it's really slow (2 minutes to load a page), sometimes timing out. Other connections to the server are fine. The SSH command line is as fast as ever as is the GNOME dekstop over SSH. In fact on the GNOME desktop I can run PHPMyAdmin locally from its browser and it's as quick as ever (which is a solution to the problem of course). I've checked the various log files and seen nothing unusual, I've logged into the MySQL command line and the database is running fine without any slowing what so ever. So it just seems to be slow when I access PHPMyAdmin on the server from the browser on my remote PC (I've tried IE and Firefox, both are slow). Has anyone experienced this or have any ideas what the issue could be. Connecting via CLI through tunnel works OK - problem is in phpMyAdmin for sure. Cheers

    Read the article

  • Underlying Concept Behind Keyboard Mappings

    - by ajay
    I am frustrated with key mapping issues. On my Linux box, if I type Home/End in Vim, then the cursor actually moves to the beginning/end of the line. On my Mac when I am on TextEdit, if I do Fn + Left or Fn + Right, it takes me to beginning/end of the line. But if I am on Vim on my Mac terminal, then the same key combinations don't work. Why? I see online all the different cryptic settings that I have to paste in .vimrc to make this work, but I can't find any explanation for those cryptic map, imap settings. What is the underlying issue here, and how can I fix it? Thanks!

    Read the article

  • What else can I do to secure my Linux server?

    - by eric01
    I want to put a web application on my Linux server: I will first explain to you what the web app will do and then I will tell you what I did so far to secure my brand new Linux system. The app will be a classified ads website (like gumtree.co.uk) where users can sell their items, upload images, send to and receive emails from the admin. It will use SSL for some pages. I will need SSH. So far, what I did to secure my stock Ubuntu (latest version) is the following: NOTE: I probably did some things that will prevent the application from doing all its tasks, so please let me know of that. My machine's sole purpose will be hosting the website. (I put numbers as bullet points so you can refer to them more easily) 1) Firewall I installed Uncomplicated Firewall. Deny IN & OUT by default Rules: Allow IN & OUT: HTTP, IMAP, POP3, SMTP, SSH, UDP port 53 (DNS), UDP port 123 (SNTP), SSL, port 443 (the ones I didn't allow were FTP, NFS, Samba, VNC, CUPS) When I install MySQL & Apache, I will open up Port 3306 IN & OUT. 2) Secure the partition in /etc/fstab, I added the following line at the end: tmpfs /dev/shm tmpfs defaults,rw 0 0 Then in console: mount -o remount /dev/shm 3) Secure the kernel In the file /etc/sysctl.conf, there are a few different filters to uncomment. I didn't know which one was relevant to web app hosting. Which one should I activate? They are the following: A) Turn on Source Address Verification in all interfaces to prevent spoofing attacks B) Uncomment the next line to enable packet forwarding for IPv4 C) Uncomment the next line to enable packet forwarding for IPv6 D) Do no accept ICMP redirects (we are not a router) E) Accept ICMP redirects only for gateways listed in our default gateway list F) Do not send ICMP redirects G) Do not accept IP source route packets (we are not a router) H) Log Martian Packets 4) Configure the passwd file Replace "sh" by "false" for all accounts except user account and root. I also did it for the account called sshd. I am not sure whether it will prevent SSH connection (which I want to use) or if it's something else. 5) Configure the shadow file In the console: passwd -l to lock all accounts except user account. 6) Install rkhunter and chkrootkit 7) Install Bum Disabled those services: "High performance mail server", "unreadable (kerneloops)","unreadable (speech-dispatcher)","Restores DNS" (should this one stay on?) 8) Install Apparmor_profiles 9) Install clamav & freshclam (antivirus and update) What did I do wrong and what should I do more to secure this Linux machine? Thanks a lot in advance

    Read the article

< Previous Page | 318 319 320 321 322 323 324 325 326 327 328 329  | Next Page >