Search Results

Search found 29101 results on 1165 pages for 'open basedir'.

Page 327/1165 | < Previous Page | 323 324 325 326 327 328 329 330 331 332 333 334  | Next Page >

  • SSL confirmation dialog popup auto closes in IE8 when re-accessing a JNLP file

    - by haylem
    I'm having this very annoying problem to troubleshoot and have been going at it for way too many days now, so have a go at it. The Environment We have 2 app-servers, which can be located on either the same machine or 2 different machines, and use the same signing certificate, and host 2 different web-apps. Though let's say, for the sake of our study case here, that they are on the same physical machine. So, we have: https://company.com/webapp1/ https://company.com/webapp2/ webapp1 is GWT-based rich-client which contains on one of its screens a menu with an item that is used to invoke a Java WebStart Client located on webapp2. It does so by performing a simple window.open call via this GWT call: Window.open("https://company.com/webapp2/app.jnlp", "_blank", null); Expected Behavior User merrilly goes to webapp1 User navigates to menu entry to start the WebStart app and clicks on it browser fires off a separate window/dialog which, depending on the browser and its security settings, will: request confirmation to navigate to this secure site, directly download the file, and possibly auto-execute a javaws process if there's a file association, otherwise the user can simply click on the file and start the app (or go about doing whatever it takes here). If you close the app, close the dialog, and re-click the menu entry, the same thing should happen again. Actual Behavior On Anything but God-forsaken IE 8 (Though I admit there's also all the god-forsaken pre-IE8 stuff, but the Requirements Lords being merciful we have already recently managed to make them drop these suckers. That was close. Let's hold hands and say a prayer of gratitude.) Stuff just works. JNLP gets downloaded, app executes just fine, you can close the app and re-do all the steps and it will restart happily. People rejoice. Puppies are safe and play on green hills in the sunshine. Developers can go grab a coffee and move on to more meaningful and rewarding tasks, like checking out on SO questions. Chrome doesn't want to execute the JNLP, but who cares? Customers won't get RSI from clicking a file every other week. On God-forsaken IE8 On the first visit, the dialog opens and requests confirmation for the user to continue to webapp2, though it could be unsafe (here be dragons, I tell you). The JNLP downloads and auto-opens, the app start. Your breathing is steady and slow. You close the app, close that SSL confirmation dialog, and re-click the menu entry. The dialog opens and auto-closes. Nothing starts, the file wasn't downloaded to any known location and Fiddler just reports the connection was closed. If you close IE and reach that menu item to click it again, it is now back to working correctly. Until you try again during the same session, of course. Your heart-rate goes up, you get some more coffee to make matters worse, and start looking for plain tickets online and a cheap but heavy golf-club on an online auction site to go clubbing baby polar seals to avenge your bloodthirst, as the gates to the IE team in Redmond are probably more secured than an ice block, as one would assume they get death threats often. Plus, the IE9 and IE10 teams are already hard at work fxing the crap left by their predecessors, so maybe you don't want to be too hard on them, and you don't have money to waste on a PI to track down the former devs responsible for this mess. Added Details I have come across many problems with IE8 not downloading files over SSL when it uses a no-cache header. This was indeed one of our problems, which seems to be worked out now. It downloads files fine, webapp2 uses the following headers to serve the JNLP file: response.setHeader("Cache-Control", "private, must-revalidate"); // IE8 happy response.setHeader("Pragma", "private"); // IE8 happy response.setHeader("Expires", "0"); // IE8 happy response.setHeader("Access-Control-Allow-Origin", "*"); // allow to request via cross-origin AJAX response.setContentType("application/x-java-jnlp-file"); // please exec me As you might have inferred, we get some confirmation dialog because there's something odd with the SSL certificate. Unfortunately I have no control over that. Assuming that's only temporary and for development purposes as we usually don't get our hands on the production certs. So the SSL cert is expired and doesn't specify the server. And the confirmation dialog. Wouldn't be that bad if it weren't for IE, as other browsers don't care, just ask for confirmation, and execute as expected and consistantly. Please, pretty please, help me, or I might consider sacrificial killings as an option. And I think I just found a decently prized stainless steel golf-club, so I'm right on the edge of gore. Side Notes Might actually be related to IE8 window.open SSL Certificate issue. Though it doesn't explain why the dialog would auto-close (that really is beyong me...), it could help to not have the confirmation dialog and not need the dialog at all. For instance, I was thinking that just having a simple URL in that menu instead of have it entirely managed by GWT code to invoke a Window.open would solve the problem. But I don't have control on that menu, and also I'm very curious how this could be fixed otherwise and why the hell it happens in the first place...

    Read the article

  • File.OpenText method is not declared error

    - by Nandini
    Hi, i have a fileupload control from which i need the path of a text file. After selecting the file,i need to open the file for reading the data from the text file.For this, i used the following code to open the text file. fp=File.OpenText(FileUpload2.PostedFile.FileName) This is working fine in my system.The FileUpload2.PostedFile.FileName statement gives the path of the file.The File.OpenText method opens the selected file.But when i run my project in IIS,it gives the following error: "File.OpenText is not declared." The FileUpload2.PostedFile.FileName statement is not retrieving the path, it retrieves only only the filename.what could be the reason?

    Read the article

  • simple python file writing question

    - by aharon
    I'm learning Python, and have run into a bit of a problem. On my OSX install of Python 3.1, this happens in the console: >>> filename = "test" >>> reader = open(filename, 'r') >>> writer = open(filename, 'w') >>> reader.read() '' >>> writer.write("hello world\n") 12 >>> reader.read() '' And calling more test in BASH confirms that there is nothing in test. What's going on? Thanks.

    Read the article

  • Extract a C/C++ header file from a C# class exposed to COM

    - by isorfir
    I'm not sure I've setup everything I've needed to in my C# class to properly, but it does work in COM. I've been looking for an example of a C# class that was successfully used in a C/C++ project, but haven't come across anything. I've tried using the OLE/COM Object View app to open the .tlb file and save as .h, but it gives some errors: MIDL1009: unknown argument ignored; MIDL1001: cannot open input file Studio "Studio" isn't the name of the file, it's Syslog, so that raises a red flag to me. Any ideas?

    Read the article

  • Looping an executable to get the result from Python script

    - by fx
    In my python script, I need to call within a for loop an executable, and waiting for that executable to write the result on the "output.xml". How do I manage to use wait() & how do I know when one of my executable is finished generating the result to get the result? How do I close that process and open a new one to call again the executable and wait for the new result? import subprocess args = ("bin/bar") popen = subprocess.Popen(args) I need to wait for the output from "bin/bar" to generate the "output.xml" and from there, read it's content. for index, result in enumerate(results): myModule.callSubProcess(index) #this is where the problem is. fileOutput = open("output.xml") parseAndStoreInSQLiteFileOutput(index, file)

    Read the article

  • Link to another file in chrome extension

    - by Hintswen
    I want to have a link in the popup.html file for my extension that loads another file (which will be included with the extension) how can I do this? or will I need to keep it in the same page? I tried using this code: <a href="/mail.html"> <img id="newmail_icon" src="" width="16" height="16" /> <span id="newmail">loading</span><br /> </a> But when I click the link nothing happens. I just found out that adding target="_blank" to the link will make it work and open in a new tab, but I can't get it to open in the popup. I have tried target="_self" but it didn't do anything.

    Read the article

  • JSF HIBERNATE POSTGRESQL

    - by user312619
    When I press "Save" button I get an exception like that ; javax.servlet.ServletException: org.hibernate.exception.JDBCConnectionException: Cannot open connection javax.faces.webapp.FacesServlet.service(FacesServlet.java:325) root cause javax.faces.el.EvaluationException: org.hibernate.exception.JDBCConnectionException: Cannot open connection javax.faces.component.MethodBindingMethodExpressionAdapter.invoke(MethodBindingMethodExpressionAdapter.java:102) com.sun.faces.application.ActionListenerImpl.processAction(ActionListenerImpl.java:102) javax.faces.component.UICommand.broadcast(UICommand.java:315) javax.faces.component.UIViewRoot.broadcastEvents(UIViewRoot.java:775) javax.faces.component.UIViewRoot.processApplication(UIViewRoot.java:1267) com.sun.faces.lifecycle.InvokeApplicationPhase.execute(InvokeApplicationPhase.java:82) com.sun.faces.lifecycle.Phase.doPhase(Phase.java:101) com.sun.faces.lifecycle.LifecycleImpl.execute(LifecycleImpl.java:118) javax.faces.webapp.FacesServlet.service(FacesServlet.java:312) root cause org.hibernate.exception.JDBCConnectionException: Cannot open connection org.hibernate.exception.SQLStateConverter.convert(SQLStateConverter.java:98) org.hibernate.exception.JDBCExceptionHelper.convert(JDBCExceptionHelper.java:66) org.hibernate.exception.JDBCExceptionHelper.convert(JDBCExceptionHelper.java:52) org.hibernate.jdbc.ConnectionManager.openConnection(ConnectionManager.java:449) org.hibernate.jdbc.ConnectionManager.getConnection(ConnectionManager.java:167) org.hibernate.jdbc.JDBCContext.connection(JDBCContext.java:142) org.hibernate.transaction.JDBCTransaction.begin(JDBCTransaction.java:85) org.hibernate.impl.SessionImpl.beginTransaction(SessionImpl.java:1463) sun.reflect.NativeMethodAccessorImpl.invoke0(Native Method) sun.reflect.NativeMethodAccessorImpl.invoke(Unknown Source) sun.reflect.DelegatingMethodAccessorImpl.invoke(Unknown Source) java.lang.reflect.Method.invoke(Unknown Source) org.hibernate.context.ThreadLocalSessionContext$TransactionProtectionWrapper.invoke(ThreadLocalSessionContext.java:344) $Proxy108.beginTransaction(Unknown Source) com.yemex.beans.CompanyBean.saveOrUpdate(CompanyBean.java:52) sun.reflect.NativeMethodAccessorImpl.invoke0(Native Method) sun.reflect.NativeMethodAccessorImpl.invoke(Unknown Source) sun.reflect.DelegatingMethodAccessorImpl.invoke(Unknown Source) java.lang.reflect.Method.invoke(Unknown Source) org.apache.el.parser.AstValue.invoke(AstValue.java:196) org.apache.el.MethodExpressionImpl.invoke(MethodExpressionImpl.java:276) com.sun.faces.facelets.el.TagMethodExpression.invoke(TagMethodExpression.java:98) javax.faces.component.MethodBindingMethodExpressionAdapter.invoke(MethodBindingMethodExpressionAdapter.java:88) com.sun.faces.application.ActionListenerImpl.processAction(ActionListenerImpl.java:102) javax.faces.component.UICommand.broadcast(UICommand.java:315) javax.faces.component.UIViewRoot.broadcastEvents(UIViewRoot.java:775) javax.faces.component.UIViewRoot.processApplication(UIViewRoot.java:1267) com.sun.faces.lifecycle.InvokeApplicationPhase.execute(InvokeApplicationPhase.java:82) com.sun.faces.lifecycle.Phase.doPhase(Phase.java:101) com.sun.faces.lifecycle.LifecycleImpl.execute(LifecycleImpl.java:118) javax.faces.webapp.FacesServlet.service(FacesServlet.java:312) root cause java.sql.SQLException: No suitable driver found for jdbc:postgresql://localhost/postgres java.sql.DriverManager.getConnection(Unknown Source) java.sql.DriverManager.getConnection(Unknown Source) org.hibernate.connection.DriverManagerConnectionProvider.getConnection(DriverManagerConnectionProvider.java:133) org.hibernate.jdbc.ConnectionManager.openConnection(ConnectionManager.java:446) org.hibernate.jdbc.ConnectionManager.getConnection(ConnectionManager.java:167) org.hibernate.jdbc.JDBCContext.connection(JDBCContext.java:142) org.hibernate.transaction.JDBCTransaction.begin(JDBCTransaction.java:85) org.hibernate.impl.SessionImpl.beginTransaction(SessionImpl.java:1463) sun.reflect.NativeMethodAccessorImpl.invoke0(Native Method) sun.reflect.NativeMethodAccessorImpl.invoke(Unknown Source) sun.reflect.DelegatingMethodAccessorImpl.invoke(Unknown Source) java.lang.reflect.Method.invoke(Unknown Source) org.hibernate.context.ThreadLocalSessionContext$TransactionProtectionWrapper.invoke(ThreadLocalSessionContext.java:344) $Proxy108.beginTransaction(Unknown Source) com.yemex.beans.CompanyBean.saveOrUpdate(CompanyBean.java:52) sun.reflect.NativeMethodAccessorImpl.invoke0(Native Method) sun.reflect.NativeMethodAccessorImpl.invoke(Unknown Source) sun.reflect.DelegatingMethodAccessorImpl.invoke(Unknown Source) java.lang.reflect.Method.invoke(Unknown Source) org.apache.el.parser.AstValue.invoke(AstValue.java:196) org.apache.el.MethodExpressionImpl.invoke(MethodExpressionImpl.java:276) com.sun.faces.facelets.el.TagMethodExpression.invoke(TagMethodExpression.java:98) javax.faces.component.MethodBindingMethodExpressionAdapter.invoke(MethodBindingMethodExpressionAdapter.java:88) com.sun.faces.application.ActionListenerImpl.processAction(ActionListenerImpl.java:102) javax.faces.component.UICommand.broadcast(UICommand.java:315) javax.faces.component.UIViewRoot.broadcastEvents(UIViewRoot.java:775) javax.faces.component.UIViewRoot.processApplication(UIViewRoot.java:1267) com.sun.faces.lifecycle.InvokeApplicationPhase.execute(InvokeApplicationPhase.java:82) com.sun.faces.lifecycle.Phase.doPhase(Phase.java:101) com.sun.faces.lifecycle.LifecycleImpl.execute(LifecycleImpl.java:118) javax.faces.webapp.FacesServlet.service(FacesServlet.java:312)

    Read the article

  • Avoiding nesting two for loops

    - by chavanak
    Hi, Please have a look at the code below: import string from collections import defaultdict first_complex=open( "residue_a_chain_a_b_backup.txt", "r" ) first_complex_lines=first_complex.readlines() first_complex_lines=map( string.strip, first_complex_lines ) first_complex.close() second_complex=open( "residue_a_chain_a_c_backup.txt", "r" ) second_complex_lines=second_complex.readlines() second_complex_lines=map( string.strip, second_complex_lines ) second_complex.close() list_1=[] list_2=[] for x in first_complex_lines: if x[0]!="d": list_1.append( x ) for y in second_complex_lines: if y[0]!="d": list_2.append( y ) j=0 list_3=[] list_4=[] for a in list_1: pass for b in list_2: pass if a==b: list_3.append( a ) kvmap=defaultdict( int ) for k in list_3: kvmap[k]+=1 print kvmap Normally I use izip or izip_longest to club two for loops, but this time the length of the files are different. I don't want a None entry. If I use the above method, the run time becomes incremental and useless. How am I supposed to get the two for loops going? Cheers, Chavanak

    Read the article

  • Excel macro send rich mail using LotusNotes

    - by CC
    Hi everybody. I'm working on a small macro to send mail from excel 2007 using my Lotus Notes session. The sending mail part is working fine. Now I need to send in the body part, a part of a stylesheet (for instance the area from A1:B20). This area has colors, bold font. To send my email here is the code: Set oSess = CreateObject("Notes.NotesSession") Set oDB = oSess.GETDATABASE("", "") Call oDB.OPENMAIL flag = True If Not (oDB.IsOpen) Then flag = oDB.Open("", "") If Not flag Then MsgBox "Can't open mail file: " & oDB.SERVER & " " & oDB.FILEPATH End If On Error GoTo err_handler 'Building Message Set oDoc = oDB.CREATEDOCUMENT Set oItem = oDoc.CREATERICHTEXTITEM("BODY") oDoc.Form = "Memo" 'mail subject oDoc.Subject = "subject" 'mail body oDoc.sendto = "[email protected]" oDoc.body = "my text" oDoc.postdate = Date oDoc.SaveMessageOnSend = True oDoc.visable = True 'Sending Message oDoc.SEND False Does anybody has an idea about how to send a stylesheet ? Thanks alot.

    Read the article

  • how to show a html webpage in a GUI in Java

    - by Robert
    Dear all, I've recently worked on a project on search query,and I am only last step away from completion. Now I have a nice URL,and can open it in "cmd /c start" statement in Java,and it causes an IE window open. However,my advisor is not satisfied with that,he wants to see this webpage(actually,two webpages) opened in a GUI interface. So could you please give a detailed instruction on how to achieve this in Java,please?If you are trying to offer me a helpful package,would you please kindly also show how to use that as well,since I am new to this GUI development,and I only know the basics of Swing. Thanks a lot,it is dued within this week.

    Read the article

  • Python file input string: how to handle escaped unicode characters?

    - by Michi
    In a text file (test.txt), my string looks like this: Gro\u00DFbritannien Reading it, python escapes the backslash: >>> file = open('test.txt', 'r') >>> input = file.readline() >>> input 'Gro\\u00DFbritannien' How can I have this interpreted as unicode? decode() and unicode() won't do the job. The following code writes Gro\u00DFbritannien back to the file, but I want it to be Großbritannien >>> input.decode('latin-1') u'Gro\\u00DFbritannien' >>> out = codecs.open('out.txt', 'w', 'utf-8') >>> out.write(input)

    Read the article

  • Reading a file with a supplied name in C++

    - by Cosmina
    I must read a file with a given name (it's caled "hamlet.txt"). The class used to read the file is defined like this #ifndef READWORDS_H #define READWORDS_H /** * ReadWords class. Provides mechanisms to read a text file, and return * capitalized words from that file. */ using namespace std; #include <string> #include <fstream> class ReadWords { public: /** * Constructor. Opens the file with the default name "text.txt". * Program exits with an error message if the file does not exist. */ ReadWords(); /** * Constructor. Opens the file with the given filename. * Program exits with an error message if the file does not exist. * @param filename - a C string naming the file to read. */ ReadWords(char *filename); My definition of the members of the classis this: #include<string> #include<fstream> #include<iostream> #include "ReadWords.h" using namespace std; ReadWords::ReadWords() { wordfile.open("text.txt"); if( !wordfile ) { cout<<"Errors while opening the file!"<<endl; } } ReadWords::ReadWords(char *filename) { wordfile.open(filename); if ( !wordfile ) { cout<<"Errors while opening the file!"<<endl; } wordfile>>nextword; } And the main to test it. using namespace std; #include #include #include "ReadWords.h" int main() { char name[30]; cout<<"Please input a name for the file that you wish to open"; cin>>name; ReadWords x( name[] ); } When I complie it gives me the error: main.cpp:14: error: expected primary-expression before ']' token I know it's got something to do with the function ReadWords( char *filename), but I do not know what. Any help please?

    Read the article

  • How do I run a vim script that alters the current buffer?

    - by Dan
    I'm trying to write a beautify.vim script that makes C-like code adhere to a standard that I can easily read. My file contains only substitution commands that all begin with %s/... However, when I try to run the script with my file open, in the manner :source beautify.vim, or :runtime beautify.vim, it runs but all the substitute commands state that their pattern wasn't found (patterns were tested by entering them manually and should work). Is there some way to make vim run the commands in the context of the current buffer? beautify.vim: " add spaces before open braces sil! :%s/\%>1c>\s\@<!{/ {/g " beautify for sil! :%s/for *( *\([^;]*\) *; *\([^;]*\) *; *\([^;]*\) *)/for (\1; \2; \3)/ " add spaces after commas sil! :%s/,\s\@!/, /g In my tests the first :s command should match (it matches when applied manually).

    Read the article

  • Posting an action works... but no image

    - by Brian Rice
    I'm able to post an open graph action to facebook using the following url: https://graph.facebook.com/me/video.watches with the following post data: video=http://eqnetwork.com/home/video.html?f=8e7b4f27-8cbd-4430-84df-d9ccb46da45f.mp4 It seems to be getting the title from the open graph metatags at the "video" object. But, it's not getting the image (even though one is specified in the metatag "og:image"). Also, if I add this to the post data: picture=http://eqnetwork.com/icons/mgen/overplayThumbnail.ms?drid=14282&subType=ljpg&w=120&h=120&o=1&thumbnail= still no image. Any thoughts? Brian

    Read the article

  • Upload and parse csv file with "universal newline" in python on Google App Engine

    - by greg
    Hi, I'm uploading a csv/tsv file from a form in GAE, and I try to parse the file with python csv module. Like describe here, uploaded files in GAE are strings. So I treat my uploaded string a file-like object : file = self.request.get('catalog') catalog = csv.reader(StringIO.StringIO(file),dialect=csv.excel_tab) But new lines in my files are not necessarily '\n' (thanks to excel..), and it generated an error : Error: new-line character seen in unquoted field - do you need to open the file in universal-newline mode? Does anyone know how to use StringIO.StringIO to treat strings like files open in universal-newline?

    Read the article

  • Creating and writing file from a FileOutputStream in Java

    - by Althane
    Okay, so I'm working on a project where I use a Java program to initiate a socket connection between two classes (a FileSender and FileReceiver). My basic idea was that the FileSender would look like this: try { writer = new DataOutputStream(connect.getOutputStream()); } catch (IOException e) { // TODO Auto-generated catch block e.printStackTrace(); } //While we have bytes to send while(filein.available() >0){ //We write them out to our buffer writer.write(filein.read(outBuffer)); writer.flush(); } //Then close our filein filein.close(); //And then our socket; connect.close(); } catch (IOException e) { // TODO Auto-generated catch block e.printStackTrace(); The constructor contains code that checks to see if the file exists, and that the socket is connected, and so on. Inside my FileReader is this though: input = recvSocket.accept(); BufferedReader br = new BufferedReader(new InputStreamReader(input.getInputStream())); FileOutputStream fOut= new FileOutputStream(filename); String line = br.readLine(); while(line != null){ fOut.write(line.getBytes()); fOut.flush(); line = br.readLine(); } System.out.println("Before RECV close statements"); fOut.close(); input.close(); recvSocket.close(); System.out.println("After RECV clsoe statements"); All inside a try-catch block. So, what I'm trying to do is have the FileSender reading in the file, converting to bytes, sending and flushing it out. FileReceiver, then reads in the bytes, writes to the fileOut, flushes, and continues waiting for more. I make sure to close all the things that I open, so... here comes the weird part. When I try and open the created text file in Eclipse, it tells me "An SWT error has occured ... recommended to exit the workbench... see .log for more details.". Another window pops up saying "Unhandled event loop exception, (no more handles)". However, if I try to open the sent text file in notepad2, I get ThisIsASentTextfile Which is good (well, minus the fact that there should be line breaks, but I'm working on that...). Does anyone know why this is happening? And while we're checking, how to add the line breaks? (And is this a particularly bad way to transfer files over java without getting some other libraries?)

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • what's the purpose of fcntl with parameter F_DUPFD

    - by Daniel
    I traced an oracle process, and find it first open a file /etc/netconfig as file handle 11, and then duplicate it as 256 by calling fcntl with parameter F_DUPFD, and then close the original file handle 11. Later it read using file handle 256. So what's the point to duplicate the file handle? Why not just work on the original file handle? 12931: 0.0006 open("/etc/netconfig", O_RDONLY|O_LARGEFILE) = 11 12931: 0.0002 fcntl(11, F_DUPFD, 0x00000100) = 256 12931: 0.0001 close(11) = 0 12931: 0.0002 read(256, " # p r a g m a i d e n".., 1024) = 1024 12931: 0.0003 read(256, " t s t p i _ c".., 1024) = 215 12931: 0.0002 read(256, 0x106957054, 1024) = 0 12931: 0.0001 lseek(256, 0, SEEK_SET) = 0 12931: 0.0002 read(256, " # p r a g m a i d e n".., 1024) = 1024 12931: 0.0003 read(256, " t s t p i _ c".., 1024) = 215 12931: 0.0003 read(256, 0x106957054, 1024) = 0 12931: 0.0001 close(256) = 0

    Read the article

  • Ruby Thread with "watchdog"

    - by Sergio Campamá
    I'm implementing a ruby server for handling sockets being created from GPRS modules. The thing is that when the module powers down, there's no indication that the socket closed. I'm doing threads to handle multiple sockets with the same server. What I'm asking is this: Is there a way to use a timer inside a thread, reset it after every socket input, and that if it hits the timeout, closes the thread? Where can I find more information about this? EDIT: Code example that doesn't detect the socket closing require 'socket' server = TCPServer.open(41000) loop do Thread.start(server.accept) do |client| puts "Client connected" begin loop do line = client.readline open('log.txt', 'a') { |f| f.puts line.strip } end rescue puts "Client disconnected" end end end

    Read the article

  • Error opening streamreader because file is used by another process

    - by Geri Langlois
    I am developing an application to read an excel spreadsheet, validate the data and then map it to a sql table. The process is to read the file via a streamreader, validate the data, manually make corrections to the excel spreadsheet, validate again -- repeat this process until all data validates. If the excel spreadsheet is open, then when I attempt to read the data via a streamreader I get an error, "The process cannot access the file ... because it is being used by another process." Is there a way to remove the lock or otherwise read the data into a streamreader without having to open and close excel each time?

    Read the article

  • Yes, another thread question...

    - by Michael
    I can't understand why I am loosing control of my GUI even though I am implementing a thread to play a .wav file. Can someone pin point what is incorrect? #!/usr/bin/env python import wx, pyaudio, wave, easygui, thread, time, os, sys, traceback, threading import wx.lib.delayedresult as inbg isPaused = False isStopped = False class Frame(wx.Frame): def __init__(self): print 'Frame' wx.Frame.__init__(self, parent=None, id=-1, title="Jasmine", size=(720, 300)) #initialize panel panel = wx.Panel(self, -1) #initialize grid bag sizer = wx.GridBagSizer(hgap=20, vgap=20) #initialize buttons exitButton = wx.Button(panel, wx.ID_ANY, "Exit") pauseButton = wx.Button(panel, wx.ID_ANY, 'Pause') prevButton = wx.Button(panel, wx.ID_ANY, 'Prev') nextButton = wx.Button(panel, wx.ID_ANY, 'Next') stopButton = wx.Button(panel, wx.ID_ANY, 'Stop') #add widgets to sizer sizer.Add(pauseButton, pos=(1,10)) sizer.Add(prevButton, pos=(1,11)) sizer.Add(nextButton, pos=(1,12)) sizer.Add(stopButton, pos=(1,13)) sizer.Add(exitButton, pos=(5,13)) #initialize song time gauge #timeGauge = wx.Gauge(panel, 20) #sizer.Add(timeGauge, pos=(3,10), span=(0, 0)) #initialize menuFile widget menuFile = wx.Menu() menuFile.Append(0, "L&oad") menuFile.Append(1, "E&xit") menuBar = wx.MenuBar() menuBar.Append(menuFile, "&File") menuAbout = wx.Menu() menuAbout.Append(2, "A&bout...") menuAbout.AppendSeparator() menuBar.Append(menuAbout, "Help") self.SetMenuBar(menuBar) self.CreateStatusBar() self.SetStatusText("Welcome to Jasime!") #place sizer on panel panel.SetSizer(sizer) #initialize icon self.cd_image = wx.Image('cd_icon.png', wx.BITMAP_TYPE_PNG) self.temp = self.cd_image.ConvertToBitmap() self.size = self.temp.GetWidth(), self.temp.GetHeight() wx.StaticBitmap(parent=panel, bitmap=self.temp) #set binding self.Bind(wx.EVT_BUTTON, self.OnQuit, id=exitButton.GetId()) self.Bind(wx.EVT_BUTTON, self.pause, id=pauseButton.GetId()) self.Bind(wx.EVT_BUTTON, self.stop, id=stopButton.GetId()) self.Bind(wx.EVT_MENU, self.loadFile, id=0) self.Bind(wx.EVT_MENU, self.OnQuit, id=1) self.Bind(wx.EVT_MENU, self.OnAbout, id=2) #Load file usiing FileDialog, and create a thread for user control while running the file def loadFile(self, event): foo = wx.FileDialog(self, message="Open a .wav file...", defaultDir=os.getcwd(), defaultFile="", style=wx.FD_MULTIPLE) foo.ShowModal() self.queue = foo.GetPaths() self.threadID = 1 while len(self.queue) != 0: self.song = myThread(self.threadID, self.queue[0]) self.song.start() while self.song.isAlive(): time.sleep(2) self.queue.pop(0) self.threadID += 1 def OnQuit(self, event): self.Close() def OnAbout(self, event): wx.MessageBox("This is a great cup of tea.", "About Jasmine", wx.OK | wx.ICON_INFORMATION, self) def pause(self, event): global isPaused isPaused = not isPaused def stop(self, event): global isStopped isStopped = not isStopped class myThread (threading.Thread): def __init__(self, threadID, wf): self.threadID = threadID self.wf = wf threading.Thread.__init__(self) def run(self): global isPaused global isStopped self.waveFile = wave.open(self.wf, 'rb') #initialize stream self.p = pyaudio.PyAudio() self.stream = self.p.open(format = self.p.get_format_from_width(self.waveFile.getsampwidth()), channels = self.waveFile.getnchannels(), rate = self.waveFile.getframerate(), output = True) self.data = self.waveFile.readframes(1024) isPaused = False isStopped = False #main play loop, with pause event checking while self.data != '': # while isPaused != True: # if isStopped == False: self.stream.write(self.data) self.data = self.waveFile.readframes(1024) # elif isStopped == True: # self.stream.close() # self.p.terminate() self.stream.close() self.p.terminate() class App(wx.App): def OnInit(self): self.frame = Frame() self.frame.Show() self.SetTopWindow(self.frame) return True def main(): app = App() app.MainLoop() if __name__=='__main__': main()

    Read the article

  • New hire expectations... (Am I being unreasonable?)

    - by user295841
    I work for a very small custom software shop. We currently consist me and my boss. My boss is an old FoxPro DOS developer and OOP makes him uncomfortable. He is planning on taking a back seat in the next few years to hopefully enjoy a “partial retirement”. I will be taking over the day to day operations and we are now desperately looking for more help. We tried Monster.com, Dice.com, and others a few years ago when we started our search. We had no success. We have tried outsourcing overseas (total disaster), hiring kids right out of college (mostly a disaster but that’s where I came from), interns (good for them, not so good for us) and hiring laid off “experienced” developers (there was a reason they were laid off). I have heard hiring practices discussed on podcasts, blogs, etc... and have tried a few. The “Fizz Buzz” test was a good one. One kid looked physically ill before he finally gave up. I think my problem is that I have grown so much as a developer since I started here that I now have a high standard. I hear/read very intelligent people podcasts and blogs and I know that there are lots of people out there that can do the job. I don’t want to settle for less than a “good” developer. Perhaps my expectations are unreasonable. I expect any good developer (entry level or experienced) to be billable (at least paying their own wage) in under one month. I expect any good developer to be able to be productive (at least dangerous) in any language or technology with only a few days of research/training. I expect any good developer to be able to take a project from initial customer request to completion with little or no help from others. Am I being unreasonable? What constitutes a valuable developer? What should be expected of an entry level developer? What should be expected of an experienced developer? I realize that everyone is different but there has to be some sort of expectations standard, right? I have been giving the test project below to potential canidates to weed them out. Good idea? Too much? Too little? Please let me know what you think. Thanks. Project ID: T00001 Description: Order Entry System Deadline: 1 Week Scope The scope of this project is to develop a fully function order entry system. Screen/Form design must be user friendly and promote efficient data entry and modification. User experience (Navigation, Screen/Form layouts, Look and Feel…) is at the developer’s discretion. System may be developed using any technologies that conform to the technical and system requirements. Deliverables Complete source code Database setup instructions (Scripts or restorable backup) Application installation instructions (Installer or installation procedure) Any necessary documentation Technical Requirements Server Platform – Windows XP / Windows Server 2003 / SBS Client Platform – Windows XP Web Browser (If applicable) – IE 8 Database – At developer’s discretion (Must be a relational SQL database.) Language – At developer’s discretion All data must be normalized. (+) All data must maintain referential integrity. (++) All data must be indexed for optimal performance. System must handle concurrency. System Requirements Customer Maintenance Customer records must have unique ID. Customer data will include Name, Address, Phone, etc. User must be able to perform all CRUD (Create, Read, Update, and Delete) operations on the Customer table. User must be able to enter a specific Customer ID to edit. User must be able to pull up a sortable/queryable search grid/utility to find a customer to edit. Validation must be performed prior to database commit. Customer record cannot be deleted if the customer has an order in the system. (++) Inventory Maintenance Part records must have unique ID. Part data will include Description, Price, UOM (Unit of Measure), etc. User must be able to perform all CRUD operations on the part table. User must be able to enter a specific Part ID to edit. User must be able to pull up a sortable/queryable search grid/utility to find a part to edit. Validation must be performed prior to database commit. Part record cannot be deleted if the part has been used in an order. (++) Order Entry Order records must have a unique auto-incrementing key (Order Number). Order data must be split into a header/detail structure. (+) Order can contain an infinite number of detail records. Order header data will include Order Number, Customer ID (++), Order Date, Order Status (Open/Closed), etc. Order detail data will include Part Number (++), Quantity, Price, etc. User must be able to perform all CRUD operations on the order tables. User must be able to enter a specific Order Number to edit. User must be able to pull up a sortable/queryable search grid/utility to find an order to edit. User must be able to print an order form from within the order entry form. Validation must be performed prior to database commit. Reports Customer Listing – All Customers in the system. Inventory Listing – All parts in the system. Open Order Listing – All open orders in system. Customer Order Listing – All orders for specific customer. All reports must include sorts and filter functions where applicable. Ex. Customer Listing by range of Customer IDs. Open Order Listing by date range.

    Read the article

  • try catch finally

    - by gligom
    Maby this is simple for you, but for me is not. I have this code: Private int InsertData() { int rezultat = 0; try { if (sqlconn.State != ConnectionState.Open) { sqlconn.Open(); } rezultat = (int)cmd.ExecuteScalar(); } catch (Exception ex) { lblMesaje.Text = "Eroare: " + ex.Message.ToString(); } finally { if (sqlconn.State != ConnectionState.Closed) { sqlconn.Close(); } } return rezultat; } Is just for inserting a new record in a table. Even if this throw an error "Specified cast is not valid." "rezultat=(int)cmd.ExecuteScalar();" - the code is executed and the row is inserted in the database, and the execution continues. Why it continues? Maby i don't understand the try catch finally yet Smile | :) Thank you!

    Read the article

  • Android: how to set click events on ListView?

    - by Capsud
    Hey there, I'm looking to be able to open up a new view or activity when I click on an item in my ListView. Currently I have a list of restaurants, and when i click on a particular restaurant I want it to open up another screen that will show its address, google map etc. What I need help with is knowing how to set click events on the items in the list. At the moment I dont have a database of the items, they're just Strings. Can someone help me with getting me to this stage? Thanks alot.

    Read the article

< Previous Page | 323 324 325 326 327 328 329 330 331 332 333 334  | Next Page >