Search Results

Search found 35784 results on 1432 pages for 'number format'.

Page 339/1432 | < Previous Page | 335 336 337 338 339 340 341 342 343 344 345 346  | Next Page >

  • Refreshing a binding that uses a value converter

    - by Hadi Eskandari
    I have a WPF UI that is bound to an object. I'm using a ValueConverter to convert a property to a specific image by a business rule: public class ProposalStateImageConverter : IValueConverter { public object Convert(object value, Type targetType, object parameter, CultureInfo culture) { var proposal = value as Proposal; var basePath = "pack://application:,,,/ePub.Content;component/Images/General/Flag_{0}.png"; string imagePath; if(proposal.Invoice != null) { imagePath = string.Format(basePath, "Good"); } else { imagePath = string.Format(basePath, "Warning"); } var uri = new Uri(imagePath); var src = uri.GetImageSource(); //Extention method return src; } } It is working fine, but later, when the object's state changes, I want to refresh the image and make the value converter reevaluate. How is this possible?

    Read the article

  • Hiding Opetions of a Selection with JQuery

    - by Syed Abdul Rahman
    Okay, let's start with an example. <select id = "selection1">     <option value = "1" id = "1">Number 1</option>     <option value = "2" id = "2">Number 2</option>     <option value = "3" id = "3">Number 3</option> </select> Now from here, we have a dropdown with 3 options. What I want to do now is to hide an option. Adding style = "display:none" will not help. The option would not appear in the dropdownlist, but using the arrow keys, you can still select it. Essentially, it does exactly what the code says. It isn't displayed, and it stops there. A JQuery function of $("1").hide() will not work. Plus, I don't only want to hide the option, I want to completely remove it. Any possibility on doing so? Do I have to use parent/sibling/child elements? If so, I'm still not sure how. Any help on this would be greatly appreciated. Thanks.

    Read the article

  • Why do I get two clicked or released signals when using a custom slot for a QPushButton ?

    - by Chris
    here's the main code at first I thought is was the message box but setting a label instead has the same effect. #include <time.h> #include "ui_mainwindow.h" #include <QMessageBox> class MainWindow : public QWidget, private Ui::MainWindow { Q_OBJECT public: MainWindow(QWidget *parent = 0); void makeSum(void); private: int r1; int r2; private slots: void on_pushButton_released(void); }; MainWindow::MainWindow(QWidget *parent) : QWidget(parent) { setupUi(this); } void MainWindow::on_pushButton_released(void) { bool ok; int a = lineEdit->text().toInt(&ok, 10); if (ok) { if (r1+r2==a) { QMessageBox::information( this, "Sums","Correct!" ); } else { QMessageBox::information( this, "Sums","Wrong!" ); } } else { QMessageBox::information( this, "Sums","You need to enter a number" ); } makeSum(); } void MainWindow::makeSum(void) { r1 = rand() % 10 + 1; r2 = rand() % 10 + 1; label->setText(QString::number(r1)); label_3->setText(QString::number(r2)); } int main(int argc, char *argv[]) { srand ( time(NULL) ); QApplication app(argc, argv); MainWindow mw; mw.makeSum(); mw.show(); return app.exec(); } #include "main.moc"

    Read the article

  • Loop over a file and write the next line if a condition is met

    - by 111078384259264152964
    Having a hard time fixing this or finding any good hints about it. I'm trying to loop over one file, modify each line slightly, and then loop over a different file. If the line in the second file starts with the line from the first then the following line in the second file should be written to a third file. !/usr/bin/env python with open('ids.txt', 'rU') as f: with open('seqres.txt', 'rU') as g: for id in f: id=id.lower()[0:4]+'_'+id[4] with open(id + '.fasta', 'w') as h: for line in g: if line.startswith(''+ id): h.write(g.next()) All the correct files appear, but they are empty. Yes, I am sure the if has true cases. :-) "seqres.txt" has lines with an ID number in a certain format, each followed by a line with data. The "ids.txt" has lines with the ID numbers of interest in a different format. I want each line of data with an interesting ID number in its own file. Thanks a million to anyone with a little advice!

    Read the article

  • Problem changing Java version using alternatives

    - by Brian Lewis
    I'm not quite sure how I got into this mess, but for some reason I'm not able to change the current version of Java using alternatives. I can run alternatives --config java and type my selection but when I echo the version number for either java or javac, it spits back out 1.5 every time (despite alternatives showing the current version is 1.6). The server I'm working with is running RHEL5, by the way. I have verified that the paths used in alternatives are pointing to the correct directories. Here's some output from my session: [brilewis@myserver]$ sudo /usr/sbin/update-alternatives --config java There are 3 programs which provide 'java'. Selection Command ** 1 /usr/lib/jvm/jre-1.4.2-gcj/bin/java + 2 /usr/java/jdk1.5.0_10/bin/java 3 /usr/java/jdk1.6.0_16/bin/java Enter to keep the current selection[+], or type selection number: 3 [brilewis@myserver]$ java -version java version "1.5.0_10" Java(TM) 2 Runtime Environment, Standard Edition (build 1.5.0_10-b03) Java HotSpot(TM) Server VM (build 1.5.0_10-b03, mixed mode) [brilewis@myserver]$ sudo /usr/sbin/update-alternatives --config java There are 3 programs which provide 'java'. Selection Command ** 1 /usr/lib/jvm/jre-1.4.2-gcj/bin/java 2 /usr/java/jdk1.5.0_10/bin/java + 3 /usr/java/jdk1.6.0_16/bin/java Enter to keep the current selection[+], or type selection number:

    Read the article

  • What is the form_for syntax for nested resources?

    - by Kris
    I am trying to create a form for a nested resource. Here is my route: map.resources :websites do |website| website.resources :domains end Here are my attempts and the errors: <% form_for(@domain, :url => website_domains_path(@website)) do | form | %> <%= form.text_field :name %> # ArgumentError: wrong number of arguments (1 for 0) # form_helper.rb:290:in 'respond_to?' # form_helper.rb:290:in 'apply_form_for_options!' # form_helper.rb:277:in 'form_for' <% form_for([@website, @domain]) do | form | %> <%= form.text_field :name %> # ArgumentError: wrong number of arguments (1 for 0) # form_helper.rb:290:in 'respond_to?' # form_helper.rb:290:in 'apply_form_for_options!' # form_helper.rb:277:in 'form_for' <% form_for(:domain, @domain, :url => website_domains_path(@website)) do | form | %> <%= form.text_field :name %> # ArgumentError: wrong number of arguments (1 for 0) # wrapper.rb:14:in 'respond_to?' # wrapper.rb:14:in 'wrap' # active_record_helper.rb:174:in 'error_messages_for' <% form_for(:domain, [@website, @domain]) do | form | %> <%= form.text_field :name %> # UndefinedMethodError 'name' for #<Array:0x40fa498> I have confirmed both @website and @domain contain instances of the correct class. The routes also generate correctly is used like this for example, so I dont think their is an issue with the route or url helpers. <%= website_domains_path(1) %> <%= website_data_source_path(1, 1) %> Rails 2.3.5

    Read the article

  • How to get JSON back from HTTP POST Request (to another domain)

    - by roman m
    I'm trying to use the API on a website, here's the part of the manual: Authenticated Sessions (taken from here) To create an authenticated session, you need to request an authToken from the '/auth' API resource. URL: http://stage.amee.com/auth (this is not my domain) Method: POST Request format: application/x-www-form-urlencoded Response format: application/xml, application/json Response code: 200 OK Response body: Details of the authenticated user, including API version. Extra data: "authToken" cookie and header, containing the authentication token that should be used for subsequent calls. Parameters: username / password Example Request POST /auth HTTP/1.1 Accept: application/xml Content-Type: application/x-www-form-urlencoded username=my_username&password=my_password Response HTTP/1.1 200 OK Set-Cookie: authToken=1KVARbypAjxLGViZ0Cg+UskZEHmqVkhx/Pm...; authToken: 1KVARbypAjxLGViZ0Cg+UskZEHmqVkhx/PmEvzkPGp...== Content-Type: application/xml; charset=UTF-8 QUESTION: How do I get that to work? I tried jQuery, but it seems to have problem with XSS. Actual code snippet would be greatly appreciated. p.s. All I was looking for was WebClient class in C#

    Read the article

  • current_date casting

    - by Armen Mkrtchyan
    Hi. string selectSql = "update " + table + " set state_" + mode + "_id=1 WHERE stoping_" + mode + " < current_date;"; when i call current_date, it return yyyy-MM-dd format, but i want to return dd.MM.yyyy format, how can i do that. please help. my program works fine when i am trying string selectSql = "update " + table + " set state_" + mode + "_id=1 WHERE stoping_" + mode + " < '16.04.2010';";

    Read the article

  • Binary files printing and desired precision

    - by yCalleecharan
    Hi, I'm printing a variable say z1 which is a 1-D array containing floating point numbers to a text file so that I can import into Matlab or GNUPlot for plotting. I've heard that binary files (.dat) are smaller than .txt files. The definition that I currently use for printing to a .txt file is: void create_out_file(const char *file_name, const long double *z1, size_t z_size){ FILE *out; size_t i; if((out = _fsopen(file_name, "w+", _SH_DENYWR)) == NULL){ fprintf(stderr, "***> Open error on output file %s", file_name); exit(-1); } for(i = 0; i < z_size; i++) fprintf(out, "%.16Le\n", z1[i]); fclose(out); } I have three questions: Are binary files really more compact than text files?; If yes, I would like to know how to modify the above code so that I can print the values of the array z1 to a binary file. I've read that fprintf has to be replaced with fwrite. My output file say dodo.dat should contain the values of array z1 with one floating number per line. I have %.16Le up in my code but I think that %.15Le is right as I have 15 precision digits with long double. I have put a dot (.) in the width position as I believe that this allows expansion to an arbitrary field to hold the desired number. Am I right? As an example with %.16Le, I can have an output like 1.0047914240730432e-002 which gives me 16 precision digits and the width of the field has the right width to display the number correctly. Is placing a dot (.) in the width position instead of a width value a good practice? Thanks a lot...

    Read the article

  • How to send a Timestamp field to Oracle stored proc. from Java despite the DB config?

    - by Alfabravo
    I'm making a request from a java webapp to an Oracle' stored procedure which happens to have a Timestamp IN parameter. In the testing environment, it works sending: SimpleDateFormat dateFormat = new SimpleDateFormat("dd-MMM-yyyy hh:mm:ss a"); input.setTimestampField(dateFormat.format(new Date())); But in the production environment, it raises an exception ORA-01830: date format picture ends before converting entire input string. I know the testing environment should be a replica of the production site, but it is not in my hands to set them properly. And I need to send the Timestamp field despite the way they setup the database. Any ideas? Thanks in advance.

    Read the article

  • Python Imaging: YCbCr problems

    - by daver
    Hi, I'm doing some image processing in Python using PIL, I need to extract the luminance layer from a series of images, and do some processing on that using numpy, then put the edited luminance layer back into the image and save it. The problem is, I can't seem to get any meaningful representation of my Image in a YCbCr format, or at least I don't understand what PIL is giving me in YCbCr. PIL documentation claims YCbCr format gives three channels, but when I grab the data out of the image using np.asarray, I get 4 channels. Ok, so I figure one must be alpha. Here is some code I'm using to test this process: import Image as im import numpy as np pengIm = im.open("Data\\Test\\Penguins.bmp") yIm = pengIm.convert("YCbCr") testIm = np.asarray(yIm) grey = testIm[:,:,0] grey = grey.astype('uint8') greyIm = im.fromarray(grey, "L") greyIm.save("Data\\Test\\grey.bmp") I'm expecting a greyscale version of my image, but what I get is this jumbled up mess: http://i.imgur.com/zlhIh.png Can anybody explain to me where I'm going wrong? The same code in matlab works exactly as I expect.

    Read the article

  • java version of python-dateutil

    - by elhefe
    Python has a very handy package that can parse nearly any unambiguous date and provides helpful error messages on a parse failure, python-dateutil. Comparison to the SimpleDateFormat class is not favorable - AFAICT SimpleDateFormat can only handle one exact date format and the error messages have no granularity. I've looked through the Joda API but it appears Joda is the same way - only one explicit format can be parsed at a time. Is there any package or library that reproduces the python-dateutil behavior? Or am I missing something WRT Joda/SimpleDateFormat?

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • Why must "stride" in the System.Drawing.Bitmap constructor be a multiple of 4?

    - by Gorchestopher H
    I am writing an application that requires me to take a proprietary bitmap format (an MVTec Halcon HImage) and convert it into a System.Drawing.Bitmap in C#. The only proprietary functions given to me to help me do this involve me writing to file, except for the use of a "get pointer" function. This function is great, it gives me a pointer to the pixel data, the width, the height, and the type of the image. My issue is that when I create my System.Drawing.Bitmap using the constructor: new System.Drawing.Bitmap(width, height, stride, format, scan) I need to specify a "stride" that is a multiple of 4. This may be a problem as I am unsure what size bitmap my function will be hit with. Supposing I end up with a bitmap that is 111x111 pixels, I have no way to run this function other than adding a bogus column to my image or subtracting 3 columns. Is there a way I can sneak around this limitation?

    Read the article

  • Why this code generates different numbers?

    - by frbry
    Hello, I have this function that creates a unique number for hard-disk and CPU combination. DWORD hw_hash() { char drv[4]; char szNameBuffer[256]; DWORD dwHddUnique; DWORD dwProcessorUnique; DWORD dwUniqueKey; char *sysDrive = getenv ("SystemDrive"); strcpy(drv, sysDrive); drv[2] = '\\'; drv[3] = 0; GetVolumeInformation(drv, szNameBuffer, 256, &dwHddUnique, NULL, NULL, NULL, NULL); SYSTEM_INFO si; GetSystemInfo(&si); dwProcessorUnique = si.dwProcessorType + si.wProcessorArchitecture + si.wProcessorRevision; dwUniqueKey = dwProcessorUnique + dwHddUnique; return dwUniqueKey; } It returns different numbers if I format my hard-disk and install a new Windows. Any ideas, why? Thank you. Edit: OK, Got it: This function returns the volume serial number that the operating system assigns when a hard disk is formatted. To programmatically obtain the hard disk's serial number that the manufacturer assigns, use the Windows Management Instrumentation (WMI) Win32_PhysicalMedia property SerialNumber. I should do more research before posting my problems online. Sorry to bother you, let's keep this here in case anybody else can need it.

    Read the article

  • The fastest way to iterate through a collection of objects

    - by Trev
    Hello all, First to give you some background: I have some research code which performs a Monte Carlo simulation, essential what happens is I iterate through a collection of objects, compute a number of vectors from their surface then for each vector I iterate through the collection of objects again to see if the vector hits another object (similar to ray tracing). The pseudo code would look something like this for each object { for a number of vectors { do some computations for each object { check if vector intersects } } } As the number of objects can be quite large and the amount of rays is even larger I thought it would be wise to optimise how I iterate through the collection of objects. I created some test code which tests arrays, lists and vectors and for my first test cases found that vectors iterators were around twice as fast as arrays however when I implemented a vector in my code in was somewhat slower than the array I was using before. So I went back to the test code and increased the complexity of the object function each loop was calling (a dummy function equivalent to 'check if vector intersects') and I found that when the complexity of the function increases the execution time gap between arrays and vectors reduces until eventually the array was quicker. Does anyone know why this occurs? It seems strange that execution time inside the loop should effect the outer loop run time.

    Read the article

  • API for accessing PHP documentation?

    - by Chad Johnson
    I'm done some Googling, and I've found nothing. I'm scoping out writing a plugin for an editor I use, and I am wondering whether there is a way I can access the PHP documentation via an API? For instance, I'd like to get raw access to the information (besides the comments) located here: http://php.net/file_exists. php.net seemingly uses MediaWiki which provides an API. The tutorial provides the example URL, http://en.wikipedia.org/w/api.php?action=login&format=xml. This does not work for php.net, however (http://php.net/w/api.php?action=login&format=xml). I'm just looking for a little information on how to interface with the PHP documentation.

    Read the article

  • Substrings, timer and LED lights, as3

    - by VideoDnd
    How would I sync my timer with my LED lights? I don't understand how to to set up the strings and conditions, so that they are unique to each number space. Need a condition and values for each blinker var condition:Number = 5; if(condition==5){ blink.visible = !blink.visible; //blink_.visible = !box.visible; //blink__.visible = !box.visible; } } Complete code //MY TIMER var timer:Timer = new Timer(100); //INTEGER VALUES var count:int = 0; var fcount:int = 0; var oldcount:int = 0; //FORMATTING STRING function formatCount(i:int):String { var fraction:int = i % 100; var whole:int = i / 100; return ("00" + whole).substr(-2, 2) + "." + (fraction < 10 ? "0" + fraction : fraction); } //START TIMER timer.start(); timer.addEventListener(TimerEvent.TIMER, condition); //ANIMATION function condition(event:TimerEvent):void{ count++; fcount=int(count) var toText:String = formatCount(fcount); dec.text = toText.substr(4, 1); decimal.text = toText.substr(3, 1); ones.text = toText.substr(1, 1); //LED LIGHTS var condition:Number = 5; if(condition==5){ blink.visible = !blink.visible; //blink_.visible = !box.visible; //blink__.visible = !box.visible; } }

    Read the article

  • Use boost date_time to parse and create HTTP-dates

    - by John Price
    I'm writing a kind of HTTP proxy, so I need to be able to do 3 things: Parse an HTTP-date given any of the 3 formats specified in RFC 2616, sec 3.3, Convert a file date-time to an HTTP-date string, and Output the date to a string. For reference, theses are examples of the date-times I need to parse. I will output only the first format: Sun, 06 Nov 1994 08:49:37 GMT ; RFC 822, updated by RFC 1123 Sunday, 06-Nov-94 08:49:37 GMT ; RFC 850, obsoleted by RFC 1036 Sun Nov 6 08:49:37 1994 ; ANSI C's asctime() format I'm pretty sure Boost date_time can do all of this, but I'm having some trouble with number 1. Does anyone already have code to do this? Perhaps I'm not using google proficiently, but I can't find an example of how to do this with boost anywhere. Thanks for any help!

    Read the article

  • MySQL LEFT JOIN, INNER JOIN etc, complicated query, PHP + MySQL for a forum

    - by Sven Eriksson
    So I've got a little forum I'm trying to get data for, there are 4 tables, forum, forum_posts, forum_threads and users. What i'm trying to do is to get the latest post for each forum and giving the user a sneak peek of that post, i want to get the number of posts and number of threads in each forum aswell. Also, i want to do this in one query. So here's what i came up with: SELECT lfx_forum_posts.*, lfx_forum.*, COUNT(lfx_forum_posts.pid) as posts_count, lfx_users.username, lfx_users.uid, lfx_forum_threads.tid, lfx_forum_threads.parent_forum as t_parent, lfx_forum_threads.text as t_text, COUNT(lfx_forum_threads.tid) as thread_count FROM lfx_forum LEFT JOIN (lfx_forum_threads INNER JOIN (lfx_forum_posts INNER JOIN lfx_users ON lfx_users.uid = lfx_forum_posts.author) ON lfx_forum_threads.tid = lfx_forum_posts.parent_thread AND lfx_forum_posts.pid = (SELECT MAX(lfx_forum_posts.pid) FROM lfx_forum_posts WHERE lfx_forum_posts.parent_forum = lfx_forum.fid GROUP BY lfx_forum_posts.parent_forum) ) ON lfx_forum.fid = lfx_forum_posts.parent_forum GROUP BY lfx_forum.fid ORDER BY lfx_forum.fid ASC This get the latest post in each forum and gives me a sneakpeek of it, the problem is that lfx_forum_posts.pid = (SELECT MAX(lfx_forum_posts.pid) FROM lfx_forum_posts WHERE lfx_forum_posts.parent_forum = lfx_forum.fid GROUP BY lfx_forum_posts.parent_forum) Makes my COUNT(lfx_forum_posts.pid) go to one (aswell as the COUNT(lfx_forum_threads.tid) which isn't how i would like it to work. My question is: is there some somewhat easy way to make it show the correct number and at the same time fetch the correct post info (the latest one that is)? If something is unclear please tell and i'll try to explain my issue further, it's my first time posting something here.

    Read the article

  • R: Using sapply on vector of POSIXct

    - by Chris
    I have what may be a very simple question. I want to process a column of POSIXct objects from a dataframe and generate a vector of datetime strings. I tried to use the following sapply call dt <- sapply(df$datetime, function(x) format(x,"%Y-%m-%dT%H:%M:%S")) but to no avail. I keep getting the following error Error in prettyNum(.Internal(format(x, trim, digits, nsmall, width, 3L, : invalid 'trim' argument When I apply this function to a single POSIXct object from the column, I have no problem. So I'm stumped at the moment about what the problem is. Do I need to do something special with POSIXct objects?

    Read the article

  • Microsoft Word Document Controls not accepting carriage returns

    - by Scott
    So, I have a Microsoft Word 2007 Document with several Plain Text Format (I have tried Rich Text Format as well) controls which accept input via XML. For carriage returns, I had the string being passed through XML containing "\r\n" when I wanted a carriage return, but the word document ignored that and just kept wrapping things on the same line. I also tried replacing the \r\n with System.Environment.NewLine in my C# mapper, but that just put in \r\n anyway, which still didn't work. Note also that on the control itself I have set it to "Allow Carriage Returns (Multiple Paragrpahs)" in the control properties. This is the XML for the listMapper <Field id="32" name="32" fieldType="SimpleText"> <DataSelector path="/Data/DB/DebtProduct"> <InputField fieldType="" path="/Data/DB/Client/strClientFirm" link="" type=""/> <InputField fieldType="" path="strClientRefDebt" link="" type=""/> </DataSelector> <DataMapper formatString="{0} Account Number: {1}" name="SimpleListMapper" type=""> <MapperData> </MapperData> </DataMapper> </Field> Note that this is the listMapper C# where I actually map the list (notice where I try and append the system.environment.newline) namespace DocEngine.Core.DataMappers { public class CSimpleListMapper:CBaseDataMapper { public override void Fill(DocEngine.Core.Interfaces.Document.IControl control, CDataSelector dataSelector) { if (control != null && dataSelector != null) { ISimpleTextControl textControl = (ISimpleTextControl)control; IContent content = textControl.CreateContent(); CInputFieldCollection fileds = dataSelector.Read(Context); StringBuilder builder = new StringBuilder(); if (fileds != null) { foreach (List<string> lst in fileds) { if (CanMap(lst) == false) continue; if (builder.Length > 0 && lst[0].Length > 0) builder.Append(Environment.NewLine); if (string.IsNullOrEmpty(FormatString)) builder.Append(lst[0]); else builder.Append(string.Format(FormatString, lst.ToArray())); } content.Value = builder.ToString(); textControl.Content = content; applyRules(control, null); } } } } } Does anybody have any clue at all how I can get MS Word 2007 (docx) to quit ignoring my newline characters??

    Read the article

  • How to compare two variables from a java class in jess and execute a rule?

    - by user3417084
    I'm beginner in Jess. I'm trying to compare two variables from a Java class in Jess and trying to execute a rule. I have imported cTNumber and measuredCurrent (both are integer)form a java class called CurrentSignal. Similarly imported vTNumberand measuredVoltage form a java class DERSignal. Now I want to make a rule such that if cTNumber is equal to vTNumber then multiply measuredCurrent and measuredVoltage (Both are double) for calculating power. I'm trying in this way.... (import signals.*) (deftemplate CurrentSignal (declare (from-class CurrentSignal))) (deftemplate DERSignal (declare (from-class DERSignal))) (defglobal ?*CTnumber* = 0) (defglobal ?*VTnumber* = 0) (defglobal ?*VTnumberDER* = 0) (defglobal ?*measuredCurrent* = 0) (defglobal ?*measuredVoltage* = 0) (defglobal ?*measuredVoltageDER* = 0) (defrule Get-CT-Number (CurrentSignal (cTNumber ?m)) (CurrentSignal (measuredCurrent ?c)) => (bind ?*measuredCurrent* ?c) (printout t "Measured Current : " ?*measuredCurrent*" Amps"crlf) (bind ?*CTnumber* ?m) (printout t ?*CTnumber* crlf) ) (defrule Get-DER-Number (DERSignal (vTNumber ?o)) (DERSignal (measuredVoltage ?V)) => (bind ?*measuredVoltageDER* ?V) (printout t "Measured Voltage : " ?*measuredVoltageDER* " V" crlf) (bind ?*VTnumberDER* ?o) (printout t ?*VTnumberDER* crlf) ) (defrule Power-Calculation-DER-signal "Power calculation of DER Bay" (test (= ?*CTnumber* ?*VTnumberDER* )) => (printout t "Total Generation : " (* ?*measuredCurrent* ?*measuredVoltageDER*) crlf) ) But the Total Generation is showing 0. But I tried calculating in Java and it's showing a number. Can anyone please help me to solve this problem. Thank you.

    Read the article

< Previous Page | 335 336 337 338 339 340 341 342 343 344 345 346  | Next Page >