Search Results

Search found 8523 results on 341 pages for 'bobby tables'.

Page 34/341 | < Previous Page | 30 31 32 33 34 35 36 37 38 39 40 41  | Next Page >

  • Auto-creating a "link" table between 2 main tables (ex table EmployeeProject from Employee and Project tables)

    - by user573382
    Hello! I have these 2 tables, Medication containing: IDMedication, IDCategory, Name, and Supplier, containing: IDSupplier, Name. I want to automatically create a relationship table, MedicationSupplier, containing: IDMedication and IDSupplier as keys, Price, and Quantity. My idea was to have a main page where i request the following data: (Medication)Name, IDCAtegory, (Supplier)Name, Price, Quantity. I'm not sure if i'm doing the right thing here. So this is what i'm receiveing in the .php where i do the insert: $Denumire=$_POST['Denumire']; //Medication Name $IDCategorie=$_POST['IDCategorie']; //IDCategory $Nume=$_POST['Nume']; //Supplier Name $Pret=$_POST['Pret']; //Price $Stoc=$_POST['Stoc']; //Quantity And this is my insert: $q_produse = "INSERT INTO produse VALUES ('','$IDCategorie','$Denumire')"; $q_prodfurniz = "INSERT INTO produsfurnizor VALUES ('','$IDFurnizor','$Pret','$Stoc')"; mysql_query($q_produse) or die($error); mysql_query($q_prodfurniz) or die($error); mysql_close(); My main problem at the moment is that i don't know how to insert IDMedication in the relationship table. Any help / suggestions of improving my code would be greatly appreciated. Thanks!

    Read the article

  • Multiple tables\objects in one nHibernate mapping

    - by Morrislgn
    Hi Folks I am trying to create an nHibernate mapping for a class structure like so: class UserDetails{ Guid id; User user; Role role; public User UserInfo{ get;set; } public Role UserRoles{ get;set; } public Guid ID{ Get; set; } } class User{ string name; int id; public string Name{ get;set; } public int ID{ get;set; } } class Role{ string roleName; string roleDesc; int roleId; public string RoleName{ get;set; } public string RoleDesc{ get;set; } public int RoleID{ get;set; } } The underlying DB structure is similar to the tables, but there is a linking table which links user and role using their respective IDs: UserRoleLinkTable[ identity User_Role_ID (pk) userID (FK to User table) roleid (FK to Role table) ] After playing about with nHibernate this is similar to what I want to try and achieve (but it doesnt work!): <?xml version="1.0" encoding="utf-8" ?> <hibernate-mapping xmlns="urn:nhibernate-mapping-2.2" assembly="Admin" namespace="Admin" > <class name="UserDetails" lazy="false" table="USER"> <id name="ID"> <generator class="guid"></generator> </id> <one-to-one name="UserInfo" class="User" lazy="false" cascade="none"/> <bag name="UserRoles" inverse="false" table="Role" lazy="false" cascade="none" > <key column="Role" /> <many-to-many class="Role" column="ROLE_ID" /> </bag> </class> </hibernate-mapping> I have mappings\entities which appear to work for Role and User (used in other aspects of the project) objects but how do I pull this information into one UserDetails class? The point of the user details to be able to return all this information together as one object. Is it possible to create (for want of a better description) a container using an nHibernate mapping and map the data that way? Hopefully there is enough info to help work this out - thanks in advance for all help given! Cheers, Morris

    Read the article

  • T-SQL Script to Delete All The Relationships Between A Bunch Of Tables in a Schema and Other Bunch i

    - by Galilyou
    Guys, I have a set of tables (say Account, Customer) in a schema (say dbo) and I have some other tables (say Order, OrderItem) in another schema (say inventory). There's a relationship between the Order table and the Customer table. I want to delete all the relationships between the tables in the first schema (dbo) and the tables in the second schema (inventory), without deleting the relationships between tables inside the same schema. Is that possible? Any help appreciated.

    Read the article

  • CSS Child selectors in IE7 tables

    - by John
    I'm trying to use the CSS child selector in IE7, and it doesn't seem to work. I have nested tables. My outer table has a class name "mytable", and I want the td's of the outer table to show borders. I don't want the inner table td's to have borders. I think I should be able to have CSS that looks like this: .mytable { border-style: solid } .mytable>tr>td { border-style: solid } But the second line seems to have no effect. If I change the second line to make it less specific, it applies to all the td's - I see too many borders. td { border-style: solid } So I think it really is just an issue with the selectors. Pages like this suggest that IE7 should be able to do what I want. Am I doing something silly? Here's the whole HTML file: <html> <head> <style type="text/css"> .mytable { border-style: solid; border-collapse: collapse;} td { border-style: solid; } </style> </head> <body> <table class="mytable"> <tr> <td>Outer top-left</td> <td>Outer top-right</td> </tr> <tr> <td>Outer bottom-left</td> <td> <table> <tr> <td>Inner top-left</td> <td>Inner top-right</td> </tr> <tr> <td>Inner bottom-left</td> <td>Inner bottom-right</td> </tr> <table> </td> </tr> <table> </body> </html>

    Read the article

  • Using Hibernate to do a query involving two tables

    - by Nathan Spears
    I'm inexperienced with sql in general, so using Hibernate is like looking for an answer before I know exactly what the question is. Please feel free to correct any misunderstandings I have. I am on a project where I have to use Hibernate. Most of what I am doing is pretty basic and I could copy and modify. Now I would like to do something different and I'm not sure how configuration and syntax need to come together. Let's say I have two tables. Table A has two (relevant) columns, user GUID and manager GUID. Obviously managers can have more than one user under them, so queries on manager can return more than one row. Additionally, a manager can be managing the same user on multiple projects, so the same user can be returned multiple times for the same manager query. Table B has two columns, user GUID and user full name. One-to-one mapping there. I want to do a query on manager GUID from Table A, group them by unique User GUID (so the same User isn't in the results twice), then return those users' full names from Table B. I could do this in sql without too much trouble but I want to use Hibernate so I don't have to parse the sql results by hand. That's one of the points of using Hibernate, isn't it? Right now I have Hibernate mappings that map each column in Table A to a field (well the get/set methods I guess) in a DAO object that I wrote just to hold that Table's data. I could also use the Hibernate DAOs I have to access each table separately and do each of the things I mentioned above in separate steps, but that would be less efficient (I assume) that doing one query. I wrote a Service object to hold the data that gets returned from the query (my example is simplified - I'm going to keep some other data from Table A and get multiple columns from Table B) but I'm at a loss for how to write a DAO that can do the join, or use the DAOs I have to do the join. FYI, here is a sample of my hibernate config file (simplified to match my example): <hibernate-mapping package="com.my.dao"> <class name="TableA" table="table_a"> <id name="pkIndex" column="pk_index" /> <property name="userGuid" column="user_guid" /> <property name="managerGuid" column="manager_guid" /> </class> </hibernate-mapping> So then I have a DAOImplementation class that does queries and returns lists like public List<TableA> findByHQL(String hql, Map<String, String> params) etc. I'm not sure how "best practice" that is either.

    Read the article

  • Yii - Custom GridView with Multiple Tables

    - by savinger
    So, I've extended GridView to include an Advanced Search feature tailored to the needs of my organization. Filter - lets you show/hide columns in the table, and you can also reorder columns by dragging the little drag icon to the left of each item. Sort - Allows for the selection of multiple columns, specify Ascending or Descending. Search - Select your column and insert search parameters. Operators tailored to data type of selected column. Version 1 works, albeit slowly. Basically, I had my hands in the inner workings of CGridView, where I snatch the results from the DataProvider and do the searching and sorting in PHP before rendering the table contents. Now writing Version 2, where I aim to focus on clever CDbCriteria creation, allowing MySQL to do the heavy lifting so it will run quicker. The implementation is trivial when dealing with a single database table. The difficulty arises when I'm dealing with 2 or more tables... For example, if the user intends to search on a field that is a STAT relation, I need that relation to be present in my query. Here's the question. How do I assure that Yii includes all with relations in my query so that I include comparisons? I've included all my relations with my criteria in the model's search function and I've tried CDbCriteria's together ... public function search() { $criteria=new CDbCriteria; $criteria->compare('id', $this->id); $criteria->compare( ... ... $criteria->with = array('relation1','relation2','relation3'); $criteria->together = true; return new CActiveDataProvider( get_class($this), array( 'criteria'=>$criteria, 'pagination' => array('pageSize' => 50) ));} But I still get errors like this... CDbCommand failed to execute the SQL statement: SQLSTATE[42S22]: Column not found: 1054 Unknown column 't.relation3' in 'where clause'. The SQL statement executed was: SELECT COUNT(DISTINCT `t`.`id`) FROM `table` `t` LEFT OUTER JOIN `relation_table` `relation0` ON (`t`.`id`=`relation0`.`id`) LEFT OUTER JOIN `relation_table` `relation1` ON (`t`.`id`=`relation1`.`id`) WHERE (`t`.`relation3` < 1234567890) Where relation0 and relation1 are BELONGS_TO relations, but any STAT relations are missing. Furthermore, why is the query a SELECT COUNT(DISTINCT 't'.'id') ?

    Read the article

  • why cant I more than two values from 3 different tables in one query

    - by zurna
    This is strange. In the news details page, I want to take a few different values from different tables with one query. However, for some strange reason, I only get two values back. So the outcome is like: <rows> <row id="4"> <FullName>Efe Tuncel</FullName> <CategoryName/> <Title>Runway Report</Title> <ShortDesc/> <Desc></Desc> <Date/> </row> </rows> If I disable fullname, then I get shortdesc but not others. Same things happens with others. NewsID = Request.QueryString("NEWSID") SQL = "SELECT N.NewsID, N.MembersID, N.CategoriesID, N.ImagesID, N.NewsTitle, N.NewsShortDesc, N.NewsDesc, N.NewsActive, N.NewsDateEntered, C.CategoriesID, C.CategoriesName, M.MembersID, M.MembersFullName" SQL = SQL & " FROM News N, Categories C, Members M" SQL = SQL & " WHERE N.NewsID = "& NewsID &" AND N.NewsActive = 1 AND N.MembersID = M.MembersID AND N.CategoriesID = C.CategoriesID" Set objViewNews = objConn.Execute(SQL) With Response .Write "<?xml version='1.0' encoding='windows-1254' ?>" .Write "<rows>" End With With Response .Write "<row id='"& objViewNews("NewsID") &"'>" .Write "<FullName>"& objViewNews("MembersFullName") &"</FullName>" .Write "<CategoryName>"& objViewNews("CategoriesName") &"</CategoryName>" .Write "<Title>"& objViewNews("NewsTitle") &"</Title>" .Write "<ShortDesc>"& objViewNews("NewsShortDesc") &"</ShortDesc>" .Write "<Desc><![CDATA["& objViewNews("NewsDesc") &"]]></Desc>" .Write "<Date>"& objViewNews("NewsDateEntered") &"</Date>" .Write "</row>" End With With Response .Write "</rows>" End With objViewNews.Close Set objViewNews = Nothing

    Read the article

  • Copying 6000 tables and data from sqlserver to oracle ==> fastest method?

    - by nazer555
    i need to copy the tables and data (about 5 yrs data, 6200 tables) stored in sqlserver, i am using datastage and odbc connection to connect and datstage automatically creates the table with data, but its taking 2-3 hours per table as tables are very large(0.5 gig, 300+columns and about 400k rows). How can i achieve this the fastes as at this rate i am able to only copy 5 tables per day but within 30 days i need move over these 6000 tables.

    Read the article

  • Oracle SQL Developer Data Modeler: What Tables Aren’t In At Least One SubView?

    - by thatjeffsmith
    Organizing your data model makes the information easier to consume. One of the organizational tools provided by Oracle SQL Developer Data Modeler is the ‘SubView.’ In a nutshell, a SubView is a subset of your model. The Challenge: I’ve just created a model which represents my entire ____________ application. We’ll call it ‘residential lending.’ Instead of having all 100+ tables in a single model diagram, I want to break out the tables by module, e.g. appraisals, credit reports, work histories, customers, etc. I’ve spent several hours breaking out the tables to one or more SubViews, but I think i may have missed a few. Is there an easy way to see what tables aren’t in at least ONE subview? The Answer Yes, mostly. The mostly comes about from the way I’m going to accomplish this task. It involves querying the SQL Developer Data Modeler Reporting Schema. So if you don’t have the Reporting Schema setup, you’ll need to do so. Got it? Good, let’s proceed. Before you start querying your Reporting Schema, you might need a data model for the actual reporting schema…meta-meta data! You could reverse engineer the data modeler reporting schema to a new data model, or you could just reference the PDFs in \datamodeler\reports\Reporting Schema diagrams directory. Here’s a hint, it’s THIS one The Query Well, it’s actually going to be at least 2 queries. We need to get a list of distinct designs stored in your repository. For giggles, I’m going to get a listing including each version of the model. So I can query based on design and version, or in this case, timestamp of when it was added to the repository. We’ll get that from the DMRS_DESIGNS table: SELECT DISTINCT design_name, design_ovid, date_published FROM DMRS_designs Then I’m going to feed the design_ovid, down to a subquery for my child report. select name, count(distinct diagram_id) from DMRS_DIAGRAM_ELEMENTS where design_ovid = :dESIGN_OVID and type = 'Table' group by name having count(distinct diagram_id) < 2 order by count(distinct diagram_id) desc Each diagram element has an entry in this table, so I need to filter on type=’Table.’ Each design has AT LEAST one diagram, the master diagram. So any relational table in this table, only having one listing means it’s not in any SubViews. If you have overloaded object names, which is VERY possible, you’ll want to do the report off of ‘OBJECT_ID’, but then you’ll need to correlate that to the NAME, as I doubt you’re so intimate with your designs that you recognize the GUIDs So I’m going to cheat and just stick with names, but I think you get the gist. My Model Of my almost 90 tables, how many of those have I not added to at least one SubView? Now let’s run my report! Voila! My ‘BEER2′ table isn’t in any SubView! It says ’1′ because the main model diagram counts as a view. So if the count came back as ’2′, that would mean the table was in the main model diagram and in 1 SubView diagram. And I know what you’re thinking, what kind of residential lending program would have a table called ‘BEER2?’ Let’s just say, that my business model has some kinks to work out!

    Read the article

  • Database structure for ecommerce site

    - by imanc
    Hey Guys, I have been tasked with designing an ecommerce solution. The aspect that is causing me the most problems is the database. Currently the site consists of 10+ country based shops each with their own database (all residing on the same mysql instance). For the new site I'd rather all these shop databases be merged into one database so that all tables (products, orders, customers etc.) have a shop_id field. From a programming perspective this seems to make the most sense as we won't have to manage data across multiple databases. Currently the entire site generates about 120k orders a year, but is experiencing fairly heavy growth and we need to design a solution that will scale. In 5 years there may be more than a million orders per year and a database that contains 5 years order history (archiving maybe a solution here). The question is - do we use a single database, or do we keep the database-per-shop structure? I am currently trying to find supporting evidence for either avenue. The company I am designing the solution for prefer the per-shop database structure because they believe it will allow the sites to scale. But my argument is that the shop's database probably won't get that busy over the next few years that they exceed the capacity of a mysql database and a "no expenses spared" hardware set-up. I am wondering if anyone has any advice either way? Does anyone have experience with websites / ecommerce sites that have tables containing millions of records? I know there is probably not a clear answer here, but at what stage do we have too many records or too large table files to have a fast loading site? Also, if anyone has any advice on sources of information - books, websites, etc. where I can do further research, it would be highly appreciated! Cheers, imanc

    Read the article

  • How can I create a custom OpenOffice / LibreOffice Writer table AutoFormat scheme?

    - by Merlyn Morgan-Graham
    None of the basic table AutoFormat schemes in LibreOffice Writer have both an alternation style defined and no sum column/row style defined. If they have alternation, they always seem to have sums. Because of this I'd like to define my own table scheme. What is the easiest way to accomplish this? A WYSIWYG isn't totally necessary. I am not scared of editing simple XML files as long as I have examples to work from, and if I don't have to edit base install files. If I can place them in a custom area or my user profile directory then that would be best. If there is a way to get the GUI Add functionality to properly recognize an alternation then that would also be helpful.

    Read the article

  • Interactive console based CSV editor

    - by Penguin Nurse
    Although spreadsheet applications for editing CSV files on the console used to be one of the earliest killer applications for personal computers, only few of them and even less documentation about them is still actively maintained. After having done extensive search on the web, manpages and source code, I ended up with the following three applications that all have fundamental drawbacks: sc: abbrev. for spreadsheet calculator; nice tool with vi keybings, but it does not put strings containing the delimiter into quotas when exporting to delimiter separated format and can't import csv files correctly, i.e. all numbers are interpreted as strings GNU oleo: doesn't seem to be actively maintained any longer since 2001 and there are therefore no packages for major linux distributions teapot: offers packages for various operating systems, but uses for example counter-intuitive naming for cells (numbers for row and column, i.e. 11 seems to be intended to be row 1, column 1) and superfluous code for FLTK GUI Various Emacs modes also do not quote strings containing the delimiter well or are require much more typing for entering the scaffold of a table. Therefore I would be very grateful for overcoming one of theses drawbacks or any hints towards another console based CSV editor. It actually needn't do any calculations just editing cells or column- and rowise.

    Read the article

  • Creating Routes using the second NIC in the box

    - by Aditya Sehgal
    OS: Linux I need some advice on how to set up the routing table. I have a box with two physical NIC cards eth0 & eth1 with two associated IPs IP1 & IP2 (both of the same subnet). I need to setup a route which will force all messages from IP1 towards IP3 (of the same subnet) to go via IP2. I have a raw socket capture program listening on IP2 (This is not for malicious use). I have set up the routing table as Destination Gateway Genmask Flags Metric Ref Use Iface IP3 IP2 255.255.255.255 UGH 0 0 0 eth1 If I try to specify eth0 while adding the above rule, I get an error "SIOCADDRT: Network is unreachable". I understand from the manpage of route that if the GW specified is a local interface, then that would be use as the outgoing interface. After setting up this rule, if i do a traceroute (-i eth0), the packet goes first to the default gateway and then to IP3. How do I force the packet originating from eth0 towards IP3 to first come to IP2. I cannot make changes to the routing table of the gateway. Please suggest.

    Read the article

  • What can cause peaks in pagetables in /proc/meminfo ?

    - by Fuzzy76
    I have a gameserver running Debian Lenny on a VPS host. Even when experiencing a fairly low load, the players start experiencing major lag (ping times rise from 50 ms to 150-500 ms) in bursts of 3 - 10 seconds. I have installed Munin server monitoring, but when looking at the graphs it looks like the server has plenty of CPU, RAM and bandwidth available. The only weird thing I noticed is some peaks in the memory graph attributed to "page_tables" which maps to PageTables in /proc/meminfo but I can't find any good information on what this might mean. Any ideas what might be causing this? If you need any more graps, just let me know. The interrupts/second count is at roughly 400-600 during this period (nearly all from eth0). The drop in committed was caused by me trying to lower the allocated memory for the server from 512MB to 256MB, but that didn't seem to help.

    Read the article

  • How can I change my mysql user that has all privileges on a database to only have select privileges on one specific table?

    - by Glenn
    I gave my mysql user the "GRANT ALL PRIVILEGES ON database_name.* to my_user@localhost" treatment. Now I would like to be more granular, starting with lowering privileges on a specific table. I am hoping mysql has or can be set to follow a "least amount of privileges" policy, so I can keep the current setup and lower it for the one table. But I have not seen anything like this in the docs or online. Other than removing the DB level grant and re-granting on a table level, is there a way to get the same result by adding another rule?

    Read the article

  • Cumulative average using data from multiple rows in an excel table

    - by Aaron E
    I am trying to calculate a cumulative average column on a table I'm making in excel. I use the totals row for the ending cumulative average, but I would like to add a column that gives a cumulative average for each row up to that point. So, if I have 3 rows I want each row to have a column giving the average up to that row and then the ending cumulative average in the totals row. Right now I can't figure this out because I'd be having to reference in a formula rows above and below the current row and I'm unsure about how to go about it because it's a table and not just cells. If it was just cells then I know how to do the formula and copy it down each row, but being that the formula I need depends on whether or not a new row in the table is added or not I keep thinking that my formula would be something like: (Completion rate row 1/n) where n is the number of rows up to that point, here row 1, then ((Completion rate row 1 + Completion rate row 2)/n) for row 2 so n=2, and so on for each new row added. Please advise.

    Read the article

  • How to add a footer to a table in Microsoft Word?

    - by dewalla
    I have a table that is longer than one page. I have found the option to make the header of the table to be added to the second portion of the table after the page break. Is there a way to do the same thing but with a footer on the table? I want to add a footer so that if my table was 1000 entries long (12 pages), that the first and last row of each page would be consistant; a header and footer for the table. If I edit the rest of the document (above the table) the table will shift up/down and I want to header and footer of the table to remain at the pagge breaks. Any Ideas? PAGE BREAK HEADER OF TABLE TBL TBL TBL TBL TBL TBL TBL TBL TBL TBL TBL TBL FOOTER OF TABLE PAGE BREAK HEADER OF TABLE TBL TBL TBL TBL TBL TBL FOOTER OF TABLE TEXT TEXT TEXT TEXT TEXT TEXT PAGE BREAK

    Read the article

  • Excel or OpenOffice Table Summary: how to reconstruct a table from another, with "missing" values

    - by Gilberto
    I have a table of values (partial) with 3 columns: month (from 1 to 12), code and value. E.g., MONTH | CODE | VALUE 1 | aaa | 111 1 | bbb | 222 1 | ccc | 333 2 | aaa | 1111 2 | ccc | 2222 The codes are clients and the values are sales volumes. Each row represents the sales for one month for one client. So I have three clients, namely aaa, bbb, and ccc. For month=1 their sales volumes are: aaa-111, bbb-222, and ccc-333. A client may or may not have sales for every month; for example, for the month 2, the client bbb has no sales. I have to construct a completed summary table for all the MONTH / CODE pairs with their corresponding VALUE (using the value from the "partial" table, if present, otherwise print a string "missing"). MONTH | CODE | VALUE 1 | aaa | 111 1 | bbb | 222 1 | ccc | 333 2 | aaa | 1111 2 | bbb | missing 2 | ccc | 2222 Or, to put it another way, the table is a linear representation of a matrix:                                 and I want to identify the cells for which no value was provided. How can I do that?

    Read the article

  • How to edit a table in the email reply (in Gmail)?

    - by imz
    I've received an email with an embedded table. I want to put some marks inside that table (i.e., edit the contentof the table) and send it back. Unfortunately, the Gmail interface doesn't seem to have table editing capabilities: after I hit reply, I see the table in the quoted text of the original message, but is not editable... If this is not possible in Gmail, how do I export the HTML source of this messsage and edit in another installed word processor?

    Read the article

  • Use Excel Table Column in ComboBox Input Range property

    - by V7L
    I asked this in StackOverflow and was redirected here. Apologies for redundancy. I have an Excel worksheet with a combo box on Sheet1 that is populated via its Input Range property from a Dynamic Named Range on Sheet2. It works fine and no VBA is required. My data on Sheet2 is actually in an Excel Table (all data is in the XLS file, no external data sources). For clarity, I wanted to use a structured table reference for the combo box's Input Range, but cannot seem to find a syntax that works, e.g. myTable[[#Data],[myColumn3]] I cannot find any indications that the combo box WILL accept structured table references, though I cannot see why it wouldn't. So, two part question: 1. Is is possible to use a table column reference in the combo box input range property (not using VBA) and 2. HOW?

    Read the article

  • OpenVPN + iptables / NAT routing

    - by Mikeage
    Hi, I'm trying to set up an OpenVPN VPN, which will carry some (but not all) traffic from the clients to the internet via the OpenVPN server. My OpenVPN server has a public IP on eth0, and is using tap0 to create a local network, 192.168.2.x. I have a client which connects from local IP 192.168.1.101 and gets VPN IP 192.168.2.3. On the server, I ran: iptables -A INPUT -i tap+ -j ACCEPT iptables -A FORWARD -i tap+ -j ACCEPT iptables -t nat -A POSTROUTING -s 192.168.2.0/24 -o eth0 -j MASQUERADE On the client, the default remains to route via 192.168.1.1. In order to point it to 192.168.2.1 for HTTP, I ran ip rule add fwmark 0x50 table 200 ip route add table 200 default via 192.168.2.1 iptables -t mangle -A OUTPUT -j MARK -p tcp --dport 80 --set-mark 80 Now, if I try accessing a website on the client (say, wget google.com), it just hangs there. On the server, I can see $ sudo tcpdump -n -i tap0 tcpdump: verbose output suppressed, use -v or -vv for full protocol decode listening on tap0, link-type EN10MB (Ethernet), capture size 96 bytes 05:39:07.928358 IP 192.168.1.101.34941 > 74.125.67.100.80: S 4254520618:4254520618(0) win 5840 <mss 1334,sackOK,timestamp 558838 0,nop,wscale 5> 05:39:10.751921 IP 192.168.1.101.34941 > 74.125.67.100.80: S 4254520618:4254520618(0) win 5840 <mss 1334,sackOK,timestamp 559588 0,nop,wscale 5> Where 74.125.67.100 is the IP it gets for google.com . Why isn't the MASQUERADE working? More precisely, I see that the source showing up as 192.168.1.101 -- shouldn't there be something to indicate that it came from the VPN? Edit: Some routes [from the client] $ ip route show table main 192.168.2.0/24 dev tap0 proto kernel scope link src 192.168.2.4 192.168.1.0/24 dev wlan0 proto kernel scope link src 192.168.1.101 metric 2 169.254.0.0/16 dev wlan0 scope link metric 1000 default via 192.168.1.1 dev wlan0 proto static $ ip route show table 200 default via 192.168.2.1 dev tap0

    Read the article

  • Dates not recognized as dates in pivot table pulling directly from SQL Server

    - by Michael K
    My pivot pulls from an external data source with a date column. Excel doesn't see this column as a date and the 'Format Cells' option panel doesn't change how the dates are displayed. The cell data is left-aligned, suggesting a string rather than a date. I have tried cast(myvar as date) and convert(varchar, myvar, 101) and convert(varchar, myvar, 1) in the base table, but none of these have been picked up by Excel as dates. If the column is recognized as a date, I can group by week and month. I understand that if I can't fix this, the next step is to add columns with weeks and months for each date to the table, but I'd like to give formatting the column one more shot before doing that.

    Read the article

  • Split a table in Word without losing row title

    - by Shane Hsu
    Word has the feature to repeat title row of a table when a table is so long that it spans a bunch of pages. I need to categorize my data into several pages, and I did that by splitting the table and insert page split to put them all in a page of itself. So now I got several page of data, but only the first page has title row. Is there anyway else to do this beside manually adding the title row to all the other pages? Original data: _________________ | Cat. Data | | 1 * | | 1 * | | 1 * | | 1 * | | 1 * | | 1 * | | 2 * | | 2 * | | 2 * | | 2 * | | 3 * | |___3______*______| And then turn it into: _________________ | Cat. Data | | 1 * | | 1 * | | 1 * | | 1 * | | 1 * | |___1______*______| Next page _________________ | Cat. Data | | 2 * | | 2 * | | 2 * | |___2______*______| Next Page _________________ | Cat. Data | | 3 * | |___3______*______|

    Read the article

  • Problems creating a functioning table

    - by Hoser
    This is a pretty simple SQL query I would assume, but I'm having problems getting it to work. if (object_id('#InfoTable')is not null) Begin Drop Table #InfoTable End create table #InfoTable (NameOfObject varchar(50), NameOfCounter varchar(50), SampledValue float(30), DayStamp datetime) insert into #InfoTable(NameOfObject, NameOfCounter, SampledValue, DayStamp) select vPerformanceRule.ObjectName AS NameOfObject, vPerformanceRule.CounterName AS NameOfCounter, Perf.vPerfRaw.SampleValue AS SampledValue, Perf.vPerfHourly.DateTime AS DayStamp from vPerformanceRule, vPerformanceRuleInstance, Perf.vPerfHourly, Perf.vPerfRaw where (ObjectName like 'Logical Disk' and CounterName like '% Free Space' AND SampleValue > 95 AND SampleValue < 100) order by DayStamp desc select NameOfObject, NameOfCounter, SampledValue, DayStamp from #InfoTable Drop Table #InfoTable I've tried various other forms of syntax, but no matter what I do, I get these error messages. Msg 207, Level 16, State 1, Line 10 Invalid column name 'NameOfObject'. Msg 207, Level 16, State 1, Line 10 Invalid column name 'NameOfCounter'. Msg 207, Level 16, State 1, Line 10 Invalid column name 'SampledValue'. Msg 207, Level 16, State 1, Line 10 Invalid column name 'DayStamp'. Msg 207, Level 16, State 1, Line 22 Invalid column name 'NameOfObject'. Msg 207, Level 16, State 1, Line 22 Invalid column name 'NameOfCounter'. Msg 207, Level 16, State 1, Line 22 Invalid column name 'SampledValue'. Msg 207, Level 16, State 1, Line 22 Invalid column name 'DayStamp'. Line 10 is the first 'insert into' line, and line 22 is the second select line. Any ideas?

    Read the article

  • Convert text to table

    - by Quattro
    I would like convert text into a table. Here is a link to the text http://www.tcdb.org/public/tcdb Short example: >gnl|TC-DB|A0CIB0|1.A.17.3.1 Chromosome undetermined scaffold_19, whole genome shotgun sequence OS=Paramecium tetraurelia GN=GSPATT00007662001 PE=4 SV=1 MDDQNQPILQEQPKPKQKKPLLNTKMVKKQKMQNKKEENLREILNFYTNQVDARKFLQKM KAVVDSNQQEKKYQDDFLNPNEYNEMQDIYEDYNMGDLVIVFPNPDADGVKNPPITYKEA PLTKTNFYSKIGNVSYENDIDELCVDEMEYLRNMRNVDGEHMDQDHVKEEI >gnl|TC-DB|A0CS82|9.B.82.1.5 Chromosome undetermined scaffold_26, whole genome shotgun sequence - Paramecium tetraurelia. MIIEEQIEEKMIYKAIHRVKVNYQKKIDRYILYKKSRWFFNLLLMLLYAYRIQNIGGFYI VTYIYCVYQLQLLIDYFTPLGLPPVNLEDEEEDDDQFQNDFSELPTTLSNKNELNDKEFR PLLRTTSEFKVWQKSVFSVIFAYFCTYIPIWDIPVYWPFLFCYFFVIVGMSIRKYIKHMK KYGYTILDFTKKK I wanted to have columns for example delimited with pipe | or ; |>gnl|TC-DB|A0CIB0|1.A.17.3.1| Chromosome undetermined scaffold_19, whole genome shotgun sequence OS=Paramecium tetraurelia GN=GSPATT00007662001 PE=4 SV=1| MDDQNQPILQEQPKPKQKKPLLNTKMVKKQKMQNKKEENLREILNFYTNQVDARKFLQKM KAVVDSNQQEKKYQDDFLNPNEYNEMQDIYEDYNMGDLVIVFPNPDADGVKNPPITYKEA PLTKTNFYSKIGNVSYENDIDELCVDEMEYLRNMRNVDGEHMDQDHVKEEI I am working with Windows and I don't know how to do it I just know every row starts with > I want to substitute the first whitespace in a row with a delimiter like | or ; after the first regular expression new line in a row, I want also a delimiter everything between the regular expression first new line and > should go into a new column (it's a sequence of a protein)

    Read the article

< Previous Page | 30 31 32 33 34 35 36 37 38 39 40 41  | Next Page >