Search Results

Search found 78715 results on 3149 pages for 'file browser'.

Page 34/3149 | < Previous Page | 30 31 32 33 34 35 36 37 38 39 40 41  | Next Page >

  • File mkdirs() method not working in android/java

    - by Leif Andersen
    I've been pulling out my hair on this for a while now. The following method is supposed to download a file, and save it to the location specified on the hard drive. private static void saveImage(Context context, boolean backgroundUpdate, URL url, File file) { if (!Tools.checkNetworkState(context, backgroundUpdate)) return; // Get the image try { // Make the file file.getParentFile().mkdirs(); // Set up the connection URLConnection uCon = url.openConnection(); InputStream is = uCon.getInputStream(); BufferedInputStream bis = new BufferedInputStream(is); // Download the data ByteArrayBuffer baf = new ByteArrayBuffer(50); int current = 0; while ((current = bis.read()) != -1) { baf.append((byte) current); } // Write the bits to the file OutputStream os = new FileOutputStream(file); os.write(baf.toByteArray()); os.close(); } catch (Exception e) { // Any exception is probably a newtork faiilure, bail return; } } Also, if the file doesn't exist, it is supposed to make the directory for the file. (And if there is another file already in that spot, it should just not do anything). However, for some reason, the mkdirs() method never makes the directory. I've tried everything from explicit parentheses, to explicitly making the parent file class, and nothing seems to work. I'm fairly certain that the drive is writable, as it's only called after that has already been determined, also that is true after running through it while debugging. So the method fails because the parent directories aren't made. Can anyone tell me if there is anything wrong with the way I'm calling it? Also, if it helps, here is the source for the file I'm calling it in: https://github.com/LeifAndersen/NetCatch/blob/master/src/net/leifandersen/mobile/android/netcatch/services/RSSService.java Thank you

    Read the article

  • Unset the system immutable bit in Mac OS X

    - by skylarking
    In theory I believe you can unlock and remove the system immutable bit with: chflags noschg /Path/To/File But how can you do this when you've set the bit as root? I have a file that is locked, and even running this command as root will not work as the operation is not permitted. I tried logging in as Single-User mode to no avail. I seem to remember that even though you are in as root you are in at level '1'. And to be able to remove the system-immutable flag you need to be logged in at level '0'. Does this have something to do with this issue?

    Read the article

  • Reliable file copy (move) process - mostly Unix/Linux

    - by mfinni
    Short story : We have a need for a rock-solid reliable file mover process. We have source directories that are often being written to that we need to move files from. The files come in pairs - a big binary, and a small XML index. We get a CTL file that defines these file bundles. There is a process that operates on the files once they are in the destination directory; that gets rid of them when it's done. Would rsync do the best job, or do we need to get more complex? Long story as follows : We have multiple sources to pull from : one set of directories are on a Windows machine (that does have Cygwin and an SSH daemon), and a whole pile of directories are on a set of SFTP servers (Most of these are also Windows.) Our destinations are a list of directories on AIX servers. We used to use a very reliable Perl script on the Windows/Cygwin machine when it was our only source. However, we're working on getting rid of that machine, and there are other sources now, the SFTP servers, that we cannot presently run our own scripts on. For security reasons, we can't run the copy jobs on our AIX servers - they have no access to the source servers. We currently have a homegrown Java program on a Linux machine that uses SFTP to pull from the various new SFTP source directories, copies to a local tmp directory, verifies that everything is present, then copies that to the AIX machines, and then deletes the files from the source. However, we're finding any number of bugs or poorly-handled error checking. None of us are Java experts, so fixing/improving this may be difficult. Concerns for us are: With a remote source (SFTP), will rsync leave alone any file still being written? Some of these files are large. From reading the docs, it seems like rysnc will be very good about not removing the source until the destination is reliably written. Does anyone have experience confirming or disproving this? Additional info We will be concerned about the ingestion process that operates on the files once they are in the destination directory. We don't want it operating on files while we are in the process of copying them; it waits until the small XML index file is present. Our current copy job are supposed to copy the XML file last. Sometimes the network has problems, sometimes the SFTP source servers crap out on us. Sometimes we typo the config files and a destination directory doesn't exist. We never want to lose a file due to this sort of error. We need good logs If you were presented with this, would you just script up some rsync? Or would you build or buy a tool, and if so, what would it be (or what technologies would it use?) I (and others on my team) are decent with Perl.

    Read the article

  • How does browser know when to prompt user to save password?

    - by Eric
    This is related to the question I asked here: http://stackoverflow.com/questions/2382329/how-can-i-get-browser-to-prompt-to-save-password This is the problem: I CAN'T get my browser to prompt me to save the password for the site I'm developing. (I'm talking about the bar that appears sometimes when you submit a form on Firefox, that says "Remember the password for yoursite.com? Yes / Not now / Never") This is super frustrating because this feature of Firefox (and most other modern browsers, which I hope work in a similar fashion) seems to be a mystery. It's like a magic trick the browser does, where it looks at your code, or what you submit, or something, and if it "looks" like a login form with a username (or email address) field and a password field, it offers to save. Except in this case, where it's not offering my users that option after they use my login form, and it's making me nuts. :-) (I checked my Firefox settings-- I have NOT told the browser "never" for this site. It should be prompting.) My question: exactly what the heuristics are that Firefox (or any other modern browser) uses to know when it should prompt the user to save? This shouldn't be too difficult to answer, since it's right there in the Mozilla source (I don't know where to look or else I'd try to dig it out myself). You'd think there would be a blog post or some other similar developer note from the Mozilla developers about this but I can't find that either. (* Note that if your answer to me has anything to do with cookies, encryption or anything else that is about how I'm storing the user's passwords in the database, you've probably misread my question. :-)

    Read the article

  • Server crash = How does a TCP/IP (and the browser-client) behave after this?

    - by jens
    Hello Experts, i would be thankfull for an explanation what happens with HTTP(TCP/IP) transmissions when the server crashes unexpectedly, how does the client Browser (Firefox / IE) handle this event. What happens in the following two standard cases: Clients-actively sends data: The TCP/IP Connection has been estableshed and the Client (Web-Browser) is Sending a POST Request with some data and in the middle of the process of sending the server crashes. What does this mean for the client? As far as I know TCP/IP does not "acknowledge" a send data-package so the client does not know that the server crashed. How will the client behave? (Firefox and Internet Explorer)? The Server is actively sending data: As above the tcp/ip connection has been established and the Server is sending a large website to the client (browser). In the middle of the sending-process the server crashes, so no futher packets are sent. How does the client browser react to this event (Firefox and Interne Expolrer) Thank you very much!! Jens

    Read the article

  • Copy mdf file and use it in run time

    - by Anibas
    After I copy mdf file (and his log file) I tries to Insert data. I receive the following message: "An attempt to attach an auto-named database for file [fileName].mdf failed. A database with the same name exists, or specified file cannot be opened, or it is located on UNC share. When I copied the file manual everything worked normally. Is it correct the order File.Copy leaves the file engaged?

    Read the article

  • Silverlight 4 launch a trusted application into the browser ?

    - by Niklaos
    Hi guys, I just lost 5 hours looking for a answer which i haven't been able to find :p First, I'd like to force a trusted application (i need to access the file system) to display into the browser. Based on what i found on google a trusted application must be installed and launched as a desktop application (also called out-of-browser application). So, i want to have an installed application on the client side but meanwhile, the user must also be able to start this same application into a browser window when he goes on my web site. Is this possible ? Second, I'd like to give to the user the possibility to start the application from the browser. To be clear be the application is installed on the client computer but i want a button on my web site which starts the desktop application. How can i do that ? Thanks

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • Python/Sqlite program, write as browser app or desktop app?

    - by ChrisC
    I am in the planning stages of rewriting an Access db I wrote several years ago in a full fledged program. I have very slight experience coding, but not enough to call myself a programmer by far. I'll definitely be learning as I go, so I'd like to keep everything as simple as possible. I've decided on Python and SQLite for my program, but I need help on my next decision. Here is my situation 1) It'll be a desktop program, run locally on each machine, all Windows 2) I would really like a nice looking GUI with colors, nice screens, menus, lists, etc, 3) I'm thinking about using a browser interface because (a) from what I've read, browser apps can look really great, and (b) I understand there are lots of free tools to assist in setting up the GUI/GUI code with drag and drop tools, so that helps my "keep it simple" goal. 4) I want the program to be totally portable so it runs completely from one single folder on a user's PC, with no installation(s) needed for it to run (If I did it as a browser app, isn't there the possibility that a user's browser settings could affect or break the app. How likely is this?) For my situation, should I make it a desktop app or browser app?

    Read the article

  • Designing a database file format

    - by RoliSoft
    I would like to design my own database engine for educational purposes, for the time being. Designing a binary file format is not hard nor the question, I've done it in the past, but while designing a database file format, I have come across a very important question: How to handle the deletion of an item? So far, I've thought of the following two options: Each item will have a "deleted" bit which is set to 1 upon deletion. Pro: relatively fast. Con: potentially sensitive data will remain in the file. 0x00 out the whole item upon deletion. Pro: potentially sensitive data will be removed from the file. Con: relatively slow. Recreating the whole database. Pro: no empty blocks which makes the follow-up question void. Con: it's a really good idea to overwrite the whole 4 GB database file because a user corrected a typo. I will sell this method to Twitter ASAP! Now let's say you already have a few empty blocks in your database (deleted items). The follow-up question is how to handle the insertion of a new item? Append the item to the end of the file. Pro: fastest possible. Con: file will get huge because of all the empty blocks that remain because deleted items aren't actually deleted. Search for an empty block exactly the size of the one you're inserting. Pro: may get rid of some blocks. Con: you may end up scanning the whole file at each insert only to find out it's very unlikely to come across a perfectly fitting empty block. Find the first empty block which is equal or larger than the item you're inserting. Pro: you probably won't end up scanning the whole file, as you will find an empty block somewhere mid-way; this will keep the file size relatively low. Con: there will still be lots of leftover 0x00 bytes at the end of items which were inserted into bigger empty blocks than they are. Rigth now, I think the first deletion method and the last insertion method are probably the "best" mix, but they would still have their own small issues. Alternatively, the first insertion method and scheduled full database recreation. (Probably not a good idea when working with really large databases. Also, each small update in that method will clone the whole item to the end of the file, thus accelerating file growth at a potentially insane rate.) Unless there is a way of deleting/inserting blocks from/to the middle of the file in a file-system approved way, what's the best way to do this? More importantly, how do databases currently used in production usually handle this?

    Read the article

  • Why is png file looks different in firefox?

    - by ablmf
    If you take screen shot this web page in different browser, you'd see that it displays slightly different in firefox. (7.01, ubuntu) At first I thought it was because of color profile, but even if I turned on color management in firefox, the problem is still there. Although it's not a very noticeable problem, I got a perfectionist boss who asked to make it look exactly the same in every browser. Does any one know what might have caused the problem? Thanks!

    Read the article

  • Why would my Silverlight 4 Out-of-Browser application just display white?

    - by Edward Tanguay
    My Silverlight application works fine when running in a browser. But when I install it as an out-of-browser application, the Window frame comes up with an appropriate icon and title, but the content of the window is just white. It is in the start menu but when I close it and open again, it is still blank. I reproduced this on Windows 7 and Windows XP. What could be causing my silverlight application to show only white when running out-of-browser? Here are the settings I used:

    Read the article

  • Displaying the website's content (html) through the specific browser - is it possible to realize?

    - by ilnur777
    I'm interested is there a possibility that could allow to display website's content or to say exactly an HTML through a specific browser installed on the web server? I mean something like a module for a web server may be, that can display the website's content through the built-in browser, ignoring the clients browser? If this possibility really exists, so I don't need to adopt my HTML to different browsers.

    Read the article

  • Why do browser vendors make their own css properties?

    - by jitendra
    Why do browser vendors make their own css properties, even they know these will not pass the w3c validation? What is the purpose? Is for their own testing, or for web developers, or to demonstrate browser capabilities to the world and to the W3C organizations and to CSS development team of W3C? is it like a beta version of demonstration? if i use any browser specific for now can they remove that property's support from future versions.will i have to edit my css in future For example: https://developer.mozilla.org/en/CSS_Reference/Mozilla_Extensions

    Read the article

  • How does browser work with expiration headers, cache-control headers, last-modified-header ?

    - by Umair
    I am a web developer, have worked with PHP and .NET both. having over a year of experience working on web I haven't been able to understand the browser caching features thoroughly, I hope Web Gurus here can help me with it. Questions I have in my mind are : How does browser actually caches stuff, does it request for to see if the cached file has changed on the server or not, What is the Ideal way for a developer to make use of browser chaching to its full, but also to be able to push new changes on the site with no hassle at all. I think if browser somehow chaches my CSS and JS and Images, and then just makes a checks for their modification to the server everytime, this can sort the issue. but I am not sure how to do it, waiting for interesting answers :)

    Read the article

  • Reading data from text file in C

    - by themake
    I have a text file which contains words separated by space. I want to take each word from the file and store it. So i have opened the file but am unsure how to assign the word to a char. FILE *fp; fp = fopen("file.txt", "r"); //then i want char one = the first word in the file char two = the second word in the file

    Read the article

  • Real time location tracking - windows program or browser based?

    - by mawg
    I want to track a few hundred, maybe a few thousand people in real time. Let's say that the hardware aspects are sorted out and I can get the data into a database. Now, I want to get it out and show it, in real-time. Weeeell ... "real-enough" time. Let's say that I want to draw a floorplan of a building and plot everyone every 1 to 5 seconds. (I might want to show only certain "kinds" of people at the click of a button; I will need datamining, etc, but let's stick with the worse case scenario). I am comfortable enough with PHP, though not this sort of thing. I personally would be happier with a windows app coded in Delphi, but the trend seems to be to make everything browser based. So, the question, I guess is whether a browser can handle this and whether there are compelling arguments for a windows-based or browser-based solution. If browser-based can handle this (displaying a few thousand data-points a second), and there are no overwhelming arguments for windows then I guess I will go for browser-based and learn a few new tricks. The obvious advantage being that I could also re-use a large part of my code for (vehicle) tracking on Google maps.

    Read the article

  • opening and viewing a file in php

    - by Christian Burgos
    how do i open/view for editing an uploaded file in php? i have tried this but it doesn't open the file. $my_file = 'file.txt'; $handle = fopen($my_file, 'r'); $data = fread($handle,filesize($my_file)); i've also tried this but it wont work. $my_file = 'file.txt'; $handle = fopen($my_file, 'w') or die('Cannot open file: '.$my_file); $data = 'This is the data'; fwrite($handle, $data); what i have in mind is like when you want to view an uploaded resume,documents or any other ms office files like .docx,.xls,.pptx and be able to edit them, save and close the said file. edit: latest tried code... <?php // Connects to your Database include "configdb.php"; //Retrieves data from MySQL $data = mysql_query("SELECT * FROM employees") or die(mysql_error()); //Puts it into an array while($info = mysql_fetch_array( $data )) { //Outputs the image and other data //Echo "<img src=localhost/uploadfile/images".$info['photo'] ."> <br>"; Echo "<b>Name:</b> ".$info['name'] . "<br> "; Echo "<b>Email:</b> ".$info['email'] . " <br>"; Echo "<b>Phone:</b> ".$info['phone'] . " <hr>"; //$file=fopen("uploadfile/images/".$info['photo'],"r+"); $file=fopen("Applications/XAMPP/xamppfiles/htdocs/uploadfile/images/file.odt","r") or exit("unable to open file");; } ?> i am getting the error: Warning: fopen(Applications/XAMPP/xamppfiles/htdocs/uploadfile/images/file.odt): failed to open stream: No such file or directory in /Applications/XAMPP/xamppfiles/htdocs/uploadfile/view.php on line 17 unable to open file the file is in that folder, i don't know it wont find it.

    Read the article

  • Copied a file with winscp; only winscp can see it

    - by nilbus
    I recently copied a 25.5GB file from another machine using WinSCP. I copied it to C:\beth.tar.gz, and WinSCP can still see the file. However no other app (including Explorer) can see the file. What might cause this, and how can I fix it? The details that might or might not matter WinSCP shows the size of the file (C:\beth.tar.gz) correctly as 27,460,124,080 bytes, which matches the filesize on the remote host Neither explorer, cmd (command line prompt w/ dir C:\), the 7Zip archive program, nor any other File Open dialog can see the beth.tar.gz file under C:\ I have configured Explorer to show hidden files I can move the file to other directories using WinSCP If I try to move the file to Users/, UAC prompts me for administrative rights, which I grant, and I get this error: Could not find this item The item is no longer located in C:\ When I try to transfer the file back to the remote host in a new directory, the transfer starts successfully and transfers data The transfer had about 30 minutes remaining when I left it for the night The morning after the file transfer, I was greeted with a message saying that the connection to the server had been lost. I don't think this is relevant, since I did not tell it to disconnect after the file was done transferring, and it likely disconnected after the file transfer finished. I'm using an old version of WinSCP - v4.1.8 from 2008 I can view the file properties in WinSCP: Type of file: 7zip (.gz) Location: C:\ Attributes: none (Ready-only, Hidden, Archive, or Ready for indexing) Security: SYSTEM, my user, and Administrators group have full permissions - everything other than "special permissions" is checked under Allow for all 3 users/groups (my user, Administrators, SYSTEM) What's going on?!

    Read the article

  • C++, Ifstream opens local file but not file on HTTP Server

    - by fammi
    Hi, I am using ifstream to open a file and then read from it. My program works fine when i give location of the local file on my system. for eg /root/Desktop/abc.xxx works fine But once the location is on the http server the file fails to open. for eg http://192.168.0.10/abc.xxx fails to open. Is there any alternate for ifstream when using a URL address? thanks. part of the code where having problem: bool readTillEof = (endIndex == -1) ? true : false; // Open the file in binary mode and seek to the end to determine file size ifstream file ( fileName.c_str ( ), ios::in|ios::ate|ios::binary ); if ( file.is_open ( ) ) { long size = (long) file.tellg ( ); long numBytesRead; if ( readTillEof ) { numBytesRead = size - startIndex; } else { numBytesRead = endIndex - startIndex + 1; } // Allocate a new buffer ptr to read in the file data BufferSptr buf (new Buffer ( numBytesRead ) ); mpStreamingClientEngine->SetResponseBuffer ( nextRequest, buf ); // Seek to the start index of the byte range // and read the data file.seekg ( startIndex, ios::beg ); file.read ( (char *)buf->GetData(), numBytesRead ); // Pass on the data to the SCE // and signal completion of request mpStreamingClientEngine->HandleDataReceived( nextRequest, numBytesRead); mpStreamingClientEngine->MarkRequestCompleted( nextRequest ); // Close the file file.close ( ); } else { // Report error to the Streaming Client Engine // as unable to open file AHS_ERROR ( ConnectionManager, " Error while opening file \"%s\"\n", fileName.c_str ( ) ); mpStreamingClientEngine->HandleRequestFailed( nextRequest, CONNECTION_FAILED ); } }

    Read the article

  • Can you use Win32 GUI in a browser plugin?

    - by John
    Of course it would mean you're plugin is not cross-platform but let's focus on the technical side... Is a browser plugin (like done in NPAPI) restricted in what it can do? Or do you get fairly free reign to access the PC and the render-window you're given? For instance can you create Win32/MFC controls in your browser this way? A side question - is your browser plugin conceptually akin to a .DLL, which is therefore just arbitrary compiled code implementing a specific interface for browser control/communication?

    Read the article

  • How do I open a file in such a way that if the file doesn't exist it will be created and opened automatically?

    - by snakile
    Here's how I open a file for writing+ : if( fopen_s( &f, fileName, "w+" ) !=0 ) { printf("Open file failed\n"); return; } fprintf_s(f, "content"); If the file doesn't exist the open operation fails. What's the right way to fopen if I want to create the file automatically if the file doesn't already exist? EDIT: If the file does exist, I would like fprintf to overwrite the file, not to append to it.

    Read the article

  • Problem with File uplolad in javascript.

    - by Nikhil
    I have used javascript to upload more than one file. when user clicks on 'add more' javascript appends new object to older div using innerHTML. Now the problem is if I select a file and then click on "add more" then new file button exist but older selected file removes and two blank file buttons display. I want this old file must be selected when user add new file button. If anybody can, Help Plz!!! tnX.

    Read the article

< Previous Page | 30 31 32 33 34 35 36 37 38 39 40 41  | Next Page >