Search Results

Search found 92562 results on 3703 pages for 'object file'.

Page 34/3703 | < Previous Page | 30 31 32 33 34 35 36 37 38 39 40 41  | Next Page >

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • Where should I put contextual data related to an Object that is not really a property of the object?

    - by RenderIn
    I have a Car class. It has three properties: id, color and model. In a particular query I want to return all the cars and their properties, and I also want to return a true/false field called "searcherKnowsOwner" which is a field I calculate in my database query based on whether or not the individual conducting the search knows the owner. I have a database function that takes the ID of the searcher and the ID of the car and returns a boolean. My car class looks like this (pseudocode): class Car{ int id; Color color; Model model; } I have a screen where I want to display all the cars, but I also want to display a flag next to each car if the person viewing the page knows the owner of that car. Should I add a field to the Car class, a boolean searcherKnowsOwner? It's not a property of the car, but is actually a property of the user conducting the search. But this seems like the most efficient place to put this information.

    Read the article

  • Designing a database file format

    - by RoliSoft
    I would like to design my own database engine for educational purposes, for the time being. Designing a binary file format is not hard nor the question, I've done it in the past, but while designing a database file format, I have come across a very important question: How to handle the deletion of an item? So far, I've thought of the following two options: Each item will have a "deleted" bit which is set to 1 upon deletion. Pro: relatively fast. Con: potentially sensitive data will remain in the file. 0x00 out the whole item upon deletion. Pro: potentially sensitive data will be removed from the file. Con: relatively slow. Recreating the whole database. Pro: no empty blocks which makes the follow-up question void. Con: it's a really good idea to overwrite the whole 4 GB database file because a user corrected a typo. I will sell this method to Twitter ASAP! Now let's say you already have a few empty blocks in your database (deleted items). The follow-up question is how to handle the insertion of a new item? Append the item to the end of the file. Pro: fastest possible. Con: file will get huge because of all the empty blocks that remain because deleted items aren't actually deleted. Search for an empty block exactly the size of the one you're inserting. Pro: may get rid of some blocks. Con: you may end up scanning the whole file at each insert only to find out it's very unlikely to come across a perfectly fitting empty block. Find the first empty block which is equal or larger than the item you're inserting. Pro: you probably won't end up scanning the whole file, as you will find an empty block somewhere mid-way; this will keep the file size relatively low. Con: there will still be lots of leftover 0x00 bytes at the end of items which were inserted into bigger empty blocks than they are. Rigth now, I think the first deletion method and the last insertion method are probably the "best" mix, but they would still have their own small issues. Alternatively, the first insertion method and scheduled full database recreation. (Probably not a good idea when working with really large databases. Also, each small update in that method will clone the whole item to the end of the file, thus accelerating file growth at a potentially insane rate.) Unless there is a way of deleting/inserting blocks from/to the middle of the file in a file-system approved way, what's the best way to do this? More importantly, how do databases currently used in production usually handle this?

    Read the article

  • Locating file path from a <InMemoryUploadedFile> Djnago object

    - by PirosB3
    Hi all I have a Django app which, submitting a package, should return values that are inside it.. Submitted the form to a view called "insert": request.FILES['file'] returns the file objects, but it is of kind < InMemoryUploadedFile. What i need is a way to get the absolute path of the uploaded file, so that i can feed it to a method that will return the values needed Anyone know how i can accomplish this? Thanks

    Read the article

  • Insert data in an object to a database.

    - by paul
    I am facing the following design/implementation dilemma. I have a class Customer which is below with getters and setters. I would like to insert the value of the Customer into a "Customer" table of a database. But Customer has an address which is of type "Address". How do I go about inserting this field into the database?(I am using sqlite3). I thought of writing a separate table "Address(customerId,doorNo,city,state,country,pinCode)". But I am having second thoughts about generating the primary key(customerId) which should be same for both the "customer" and "Address" table. Sqlite3 faq states that I can do "Integer Primary Key" to use the field to generate an auto number. But if I do that in customer table, I would have to retrieve the same Id to be used in Address table. This kinda looks wrong to me :-?. There should be an elegant method to solve this. Any ideas would be much appreciated. Thanks in advance. import java.io.*; import java.sql.*; class Customer { private String id; private String name; private Address address; private Connection connection; private ResultSet resultSet; private PreparedStatement preparedStatement; public void insertToDatabase(){ } } class Address{ private String doorNumber; private String streetName; private String cityName; private String districtName; private String stateName; private String countryName; private long pinCode; }

    Read the article

  • How do I call functions of an object inside the same object?

    - by Roly
    I have the following Javascript code add_num = { f: function(html, num) { alert(this.page); }, page : function() { return parseInt(this.gup('page')); }, gup : function(name) { name = name.replace(/[\[]/,'\\\[').replace(/[\]]/,'\\\]'); var regex = new RegExp('[\\?&]'+name+'=([^&#]*)'); var results = regex.exec(window.location.href); if(results == null) return ''; else return results[1]; } } But when I call add_num.f() what I get from alert() is the actual code of page. That is, it returns function() { return parseInt(this.gup('page')); } I was expecting a numeric value and not any code at all.

    Read the article

  • Object Oriented Perl interface to read from and write to a socket

    - by user654967
    I need a perl client-server implementation as a wrapper for a server in C#. A perl script passes the server address and port number and an input string to a module, this module has to create the socket and send the input string to the server. The data sent has to follow ISO-8859-1 encoding. On receiving the information, the client has to first receive 3 byte, then the next 8 bytes, this has the length of the data that has to be received next.. so based on the length the client has to read the next data. each of the data that is read has to be stored in a variable and sent another module for further processing. Currently this is what my perl client looks like..which I'm sure isn't right..could someone tell me how to do this..and set me on the right direction.. sub WriteInfo { my ($addr, $port, $Input) = @_; $socket = IO::Socket::INET->new( Proto => "tcp", PeerAddr => $addr, PeerPort => $port, ); unless ($socket) { die "cannot connect to remote" } while (1) { $socket->send($Input); } } sub ReadData { while (1) { my $ExecutionResult = $socket->recv( $recv_data, 3); my $DataLength = $socket->recv( $recv_data, 8); $DataLength =~ s/^0+// ; my $decval = hex($DataLength); my $Data = $socket->recv( $recv_data, $decval); return($Data); } thanks a lot.. Archer

    Read the article

  • Accessing variables of an object of a particular class through a different class within the construc

    - by Haxed
    class Student { private String name; public Student(String name){ this.name = name; } public String getName(){ return name; } } class StudentServer { public StudentServer(){ Student[] s = new Student[30]; s[0] = new Student("Nick"); System.out.println(s[0]); // LINE 01:But this compiles, although prints junk System.out.println(s[0].getName()); // LINE 02:I get a error called cannot find symbol } public static void main(){ new StudentServer(); } } Hey, there are two lines, I want the reader to focus on, the first line prints junk as usual, but suprizingly the second one gives me an error. Do you know why ? Many Thanks

    Read the article

  • Another Call to a member function get_segment() on a non-object question

    - by hogofwar
    I get the above error when calling this code: <? class Test1 extends Core { function home(){ ?> This is the INDEX of test1 <? } function test2(){ echo $this->uri->get_segment(1); //this is where the error comes from ?> This is the test2 of test1 testing URI <? } } ?> I get the error where commentated. This class extends this class: <?php class Core { public function start() { require("funk/funks/libraries/uri.php"); $this->uri = new uri(); require("funk/core/loader.php"); $this->load = new loader(); if($this->uri->get_segment(1) != "" and file_exists("funk/pages/".$this->uri->get_segment(1).".php")){ include("funk/pages/". $this->uri->get_segment(1).".php"); $var = $this->uri->get_segment(2); if ($var != ""){ $home= $this->uri->get_segment(1); $Index= new $home(); $Index->$var(); }else{ $home= $this->uri->get_segment(1); $Index = new $home(); $Index->home(); } }elseif($this->uri->get_segment(1) and ! file_exists("funk/pages/".$this->uri->get_segment(1).".php")){ echo "404 Error"; }else{ include("funk/pages/index.php"); $Index = new Index(); $Index->home(); //$this->Index->index(); echo "<!--This page was created with FunkyPHP!-->"; } } } ?> And here is the contents of uri.php: <?php class uri { private $server_path_info = ''; private $segment = array(); private $segments = 0; public function __construct() { $segment_temp = array(); $this->server_path_info = preg_replace("/\?/", "", $_SERVER["PATH_INFO"]); $segment_temp = explode("/", $this->server_path_info); foreach ($segment_temp as $key => $seg) { if (!preg_match("/([a-zA-Z0-9\.\_\-]+)/", $seg) || empty($seg)) unset($segment_temp[$key]); } foreach ($segment_temp as $k => $value) { $this->segment[] = $value; } unset($segment_temp); $this->segments = count($this->segment); } public function segment_exists($id = 0) { $id = (int)$id; if (isset($this->segment[$id])) return true; else return false; } public function get_segment($id = 0) { $id--; $id = (int)$id; if ($this->segment_exists($id) === true) return $this->segment[$id]; else return false; } } ?> i have asked a similar question to this before but the answer does not apply here. I have rewritten my code 3 times to KILL and Delimb this godforsaken error! but nooooooo....

    Read the article

  • Load random swf object with jquery

    - by Eggnog
    I'm working on a site that utilizes full screen background video. I have three flash videos I'd like to load into the page which would be displayed randomly on page refresh. I know you can achieve this through action script loading the movies into one main .swf, but I'm rubbish with Flash and am looking for an alternative solution. My search so far has uncovered a method using jquery. Unfortunately my attempts to implement it have failed. I'm hoping someone more knowledgeable than myself can tell me if this technique is valid or what I'm doing wrong. Here's my code to date: <script type="text/javascript" src="files/js/swfobject.js"></script> <script type="text/javascript"> $(document).ready(function() { var sPath; var i = Math.floor(Math.random()*2); switch(i) { case 0: sPath = "flash/homepage_video.swf"; break; case 1: sPath = "flash/homepage_video.swf"; break; } // load the flash version of the image var so = new SWFObject(sPath, "flash-background", "100%", "100%"); so.addParam("scale", "exactFit"); so.addParam("movie", sPath); // NOTE: the sPath variable is also used here so.addParam("quality", "high"); so.addParam("wmode", "transparent"); so.write("homeBackground"); // NOTE: The value in this call to write() MUST match the name of the // HTML element (<div>) you're expecting the swf to show up in }); </script> <body> <div id="homeBackground"> <p>This is alternative content</p> </div> </body> I'm open to other suggestions that don't involve jquery (php perhaps). Thanks.

    Read the article

  • Storing object as a column in LINQ

    - by Alex
    Hello, i have some class which constructs itself from string, like this: CurrencyVector v = new CurrencyVector("10 WMR / 20 WMZ"); it's actually a class which holds multiple currency values, but it does not matter much. I need to change type of column in my LINQ table (in vs 2010 designer) from String to that class, CurrencyVector. If i do it - i get runtime error when LINQ runtime tries to cast String as CurrencyVector (when populating the table from database). Adding IConvertible did not help. I wrapped these columns in properties, but it's ugly and slow solution. Searching internet gave no results.

    Read the article

  • How do I copy an object in Java?

    - by Veera
    Consider the below code: DummyBean dum = new DummyBean(); dum.setDummy("foo"); System.out.println(dum.getDummy()); // prints 'foo' DummyBean dumtwo = dum; System.out.println(dumtwo.getDummy()); // prints 'foo' dum.setDummy("bar"); System.out.println(dumtwo.getDummy()); // prints 'bar' but it should print 'foo' So, I want to copy the 'dum' to dumtwo' and I want to change 'dum' without affecting the 'dumtwo'. But the above code is not doing that. When I change something in 'dum', the same change is happening in 'dumtwo' also. I guess, when I say dumtwo = dum, Java copies the reference only. So, is there any way to create a fresh copy of 'dum' and assign it to 'dumtwo' ?

    Read the article

  • <object> for PDF is blocking drop-down menu

    - by Tumharyyaaden
    URL: http://hartford.uconn.edu/director/academic_plan.html It is an HTML page, and using to display PDF document. Which is blocking the jQuery drop down menu. I have tried using CSS z-index property with positioning specified. Also tried setting wmode="transparent" / wmode="opaque" / and other variations but nothing seems to work.

    Read the article

  • Reading data from text file in C

    - by themake
    I have a text file which contains words separated by space. I want to take each word from the file and store it. So i have opened the file but am unsure how to assign the word to a char. FILE *fp; fp = fopen("file.txt", "r"); //then i want char one = the first word in the file char two = the second word in the file

    Read the article

  • PHP Object Oriented Web Application

    - by Sev
    I have a class called "Layout" for the layout of the page, another class called "User" for the user. Every page I create, I instantiate a new Layout. When a user logs in, there is a new User instantiated. How do I get an instance of the layout class to know about the instantiated user? I could also save the entire instance of the User in a session variable. I assume that's a bad idea though. What are the best practices for this?

    Read the article

  • Getting ORACLE programming object definitions

    - by Yaakov Davis
    Let's say I have an ORACLE schema with contains a package. That package defines types, functions, procedures, etc: CREATE PACKAGE... DECLARE FUNCTION ... PROCEDURE ... END; Is there a query I can execute to get the definitions of those individual objects, without the wrapping package?

    Read the article

  • Order object simplexml_load_file by field of this.

    - by ronsandova
    Hi i have a problems with simplexml_load_file, i'm not pretty sure how to do to order my array by a $item-padre. I need to do foreach and order by $item-padre.=, i don't know how to do this. function create_sitemap($sitemap){ $xml = file_exists('sitemap.xml') ? $xml = simplexml_load_file('sitemap.xml'): exit('Failed to open sitemal.xml.'); $xml = uasort($xml, function($a,$b){ return strcmp($a-padre, $b-padre); }); foreach ($xml-url as $item) { echo "" . $item-loc. ""; echo "" . $item-padre . ""; } } Thanks in advance.

    Read the article

  • opening and viewing a file in php

    - by Christian Burgos
    how do i open/view for editing an uploaded file in php? i have tried this but it doesn't open the file. $my_file = 'file.txt'; $handle = fopen($my_file, 'r'); $data = fread($handle,filesize($my_file)); i've also tried this but it wont work. $my_file = 'file.txt'; $handle = fopen($my_file, 'w') or die('Cannot open file: '.$my_file); $data = 'This is the data'; fwrite($handle, $data); what i have in mind is like when you want to view an uploaded resume,documents or any other ms office files like .docx,.xls,.pptx and be able to edit them, save and close the said file. edit: latest tried code... <?php // Connects to your Database include "configdb.php"; //Retrieves data from MySQL $data = mysql_query("SELECT * FROM employees") or die(mysql_error()); //Puts it into an array while($info = mysql_fetch_array( $data )) { //Outputs the image and other data //Echo "<img src=localhost/uploadfile/images".$info['photo'] ."> <br>"; Echo "<b>Name:</b> ".$info['name'] . "<br> "; Echo "<b>Email:</b> ".$info['email'] . " <br>"; Echo "<b>Phone:</b> ".$info['phone'] . " <hr>"; //$file=fopen("uploadfile/images/".$info['photo'],"r+"); $file=fopen("Applications/XAMPP/xamppfiles/htdocs/uploadfile/images/file.odt","r") or exit("unable to open file");; } ?> i am getting the error: Warning: fopen(Applications/XAMPP/xamppfiles/htdocs/uploadfile/images/file.odt): failed to open stream: No such file or directory in /Applications/XAMPP/xamppfiles/htdocs/uploadfile/view.php on line 17 unable to open file the file is in that folder, i don't know it wont find it.

    Read the article

  • empty() returning TRUE on object's non-empty property

    - by Michal M
    I've got a very weird and unexpected problem. empty() is returning TRUE on a non-empty property for a reason unknown to me. class MyObject { private $_property; public function __construct($property) { $this->_property = $property; } public function __get($name) { $priv_name = "_{$name}"; if (isset($this->$priv_name)) { return $this->$priv_name; } else { return NULL; } } } $obj = new MyObject('string value'); echo $obj->property; // Output 'string value' echo empty($obj->property); // Output 1 (means, that property is empty) Would this mean, that the __get() magic function is not called when using empty()? btw. I'm running PHP version 5.0.4

    Read the article

  • accessing php javascript object in asp.net user control

    - by Khushi
    Hi, I have a website in php which is using 4 frames(top, left, middle and right). The middle frame contains the web user control coded in asp.net. Now, in the right frame( which is coded in php ) some javascript contains the id of the items selected in right frame. I need to get those ids to the middle frame on asp.net user control. How can i do this?

    Read the article

< Previous Page | 30 31 32 33 34 35 36 37 38 39 40 41  | Next Page >