Search Results

Search found 12287 results on 492 pages for 'column oriented'.

Page 343/492 | < Previous Page | 339 340 341 342 343 344 345 346 347 348 349 350  | Next Page >

• Hardware for multipurpose home server

  - by Michael Dmitry Azarkevich

  Hi guys, I'm looking to set up a multipurpose home server and hoped you could help me with the hardware selection. First of all, the services it will provide: Hosting a MySQL database (for training and testing purposes) FTP server Personal Mail Server Home media server So with this in mind I've done some research, and found some viable solutions: A standard PC with the appropriate software (Either second hand or new) A non-solid state mini-ITX system A solid state, fanless mini-ITX system I've also noted the pros and cons of each system: A standard second hand PC with old hardware would be the cheapest option. It could also have lacking processing power, not enough RAM and generally faulty hardware. Also, huge power consumption heat generation and noise levels. A standard new PC would have top-notch hardware and will stay that way for quite some time, so it's a good investment. But again, the main problem is power consumption, heat generation and noise levels. A non-solid state mini-ITX system would have the advantages of lower power consumption, lower cost (as far as I can see) and long lasting hardware. But it will generate noise and heat which will be even worse because of the size. A solid state, fanless mini-ITX system would have all the advantages of a non-solid state mini-ITX but with minimal noise and heat. The main disadvantage is the read\write problems of flash memory. All in all I'm leaning towards a non-solid state mini-ITX because of the read\write issues of flash memory. So, after this overview of what I do know, my questions are: Are all these services even providable from a single server? To my best understanding they are, but then again, I might be wrong. Is any of these solutions viable? If yes, which one is the best for my purposes? If not, what would you suggest? Also, on a more software oriented note: OS wise, I'm planning to run Linux. I'm currently thinking of four options I've been recommended: CentOS, Gentoo, DSL (Damn Small Linux) and LFS (Linux From Scratch). Any thoughts on this? Any other distro you would recomend? Regarding FTP services, I've herd good things about FileZila. Anyone has any experience with that? Do you recommend it? Do you recommend something else? Regarding the Mail service, I know nothing about this except that it exists. Any software you recommend for this task? Home media, same as mail service. Any recommended software? Thank you very much.

  Read the article

• PostgreSQL, update existing rows with pg_restore

  - by woky

  Hello. I need to sync two PostgreSQL databases (some tables from development db to production db) sometimes. So I came up with this script: [...] pg_dump -a -F tar -t table1 -t table2 -U user1 dbname1 | \ pg_restore -a -U user2 -d dbname2 [...] The problem is that this works just for newly added rows. When I edit non-PK column I get constraint error and row isn't updated. For each dumped row I need to check if it exists in destination database (by PK) and if so delete it before INSERT/COPY. Thanks for your advice. (Previously posted on stackoverflow.com, but IMHO this is better place for this question).

  Read the article

• How does the "Full Control" permission differ from manually giving all other permissions?

  - by Lord Torgamus

  On Windows Server 2003, and some other versions of Windows, the Properties > Security tab of a folder's or file's context menu provides "Allow" and "Deny" options for "Full Control," "Modify," "Read" and other permissions (graphic provided). After clicking "Full Control," all boxes in the column — except for "Special Permissions" — get automatically checked. What's the difference between checking "Full Control" and just checking all the other boxes individually? Are there hidden/advanced permissions toggled by "Full Control" that aren't listed in the main permissions window? Is "Full Control" just a convenience shortcut?

  Read the article

• Dangers of the pyton eval() statement

  - by LukeP

  I am creating a game. Specifically it is a pokemon battle simulator. I have an sqlite database of moves in which a row looks something like: name | type | Power | Accuracy | PP | Description However, there are some special moves. For said special moves, their damage (and other attributes not shown above, like status effects) may be dependant on certian factors. Rather than create a huge if/else in one of my classes covering the formulas for every one of these moves. I'd rather include another column in the DB that contains a formula in string form, like 'self.health/2'(simplified example). I could then just plug that into eval. I always see people saying to stay away from eval, but from what I can tell, this would be considered an acceptable use, as the dangers of eval only come into play when accepting user input. Am I correct in this assumption, or is there somthing i'm not seeing.

  Read the article

• Set an Excel cell's color based on multiple other cells' colors

  - by Lord Torgamus

  I have an Excel 2007 spreadsheet for a list of products and a bunch of factors to rate each one on, and I'm using Conditional Formatting to set the color of the cells in the individual attribute columns. It looks something like this: I want to fill in the rating column for each item with a color, based on the color ratings of its individual attributes. Examples of ways to determine this: the color of the category in which the item scored worst the statistical mode of the category colors the average of the category ratings, where each color is assigned a numerical value How can I implement any or all of the above rules? (I'm really just asking for a quick overview of the relevant Excel feature; I don't need step-by-step instructions for each rule.)

  Read the article

• Is it possible to use images in an Excel IF statement?

  - by dunc

  Quite a simple one here, but I guess the answer will be a resounding no! I have a few symbols, basic clip-art, which I'd like to display depending on certain information. At the moment, I'm using this statement to display Y or N: =IF(B2>0,VLOOKUP(B2,'Student Data'!$A$2:$L$36,8),"") It's a simple lookup which checks another worksheet to see if someone has entered "Y" or "N" into the relevant column. What I'm wondering is this: would it be possible to display these clip-art images (I have them in .PNG format) instead of simple text? I.e. IF VALUE_OF_CELL=7, DISPLAY IMAGE1. Thanks in advance,

  Read the article

• Convert text to table

  - by Quattro

  I would like convert text into a table. Here is a link to the text http://www.tcdb.org/public/tcdb Short example: >gnl|TC-DB|A0CIB0|1.A.17.3.1 Chromosome undetermined scaffold_19, whole genome shotgun sequence OS=Paramecium tetraurelia GN=GSPATT00007662001 PE=4 SV=1 MDDQNQPILQEQPKPKQKKPLLNTKMVKKQKMQNKKEENLREILNFYTNQVDARKFLQKM KAVVDSNQQEKKYQDDFLNPNEYNEMQDIYEDYNMGDLVIVFPNPDADGVKNPPITYKEA PLTKTNFYSKIGNVSYENDIDELCVDEMEYLRNMRNVDGEHMDQDHVKEEI >gnl|TC-DB|A0CS82|9.B.82.1.5 Chromosome undetermined scaffold_26, whole genome shotgun sequence - Paramecium tetraurelia. MIIEEQIEEKMIYKAIHRVKVNYQKKIDRYILYKKSRWFFNLLLMLLYAYRIQNIGGFYI VTYIYCVYQLQLLIDYFTPLGLPPVNLEDEEEDDDQFQNDFSELPTTLSNKNELNDKEFR PLLRTTSEFKVWQKSVFSVIFAYFCTYIPIWDIPVYWPFLFCYFFVIVGMSIRKYIKHMK KYGYTILDFTKKK I wanted to have columns for example delimited with pipe | or ; |>gnl|TC-DB|A0CIB0|1.A.17.3.1| Chromosome undetermined scaffold_19, whole genome shotgun sequence OS=Paramecium tetraurelia GN=GSPATT00007662001 PE=4 SV=1| MDDQNQPILQEQPKPKQKKPLLNTKMVKKQKMQNKKEENLREILNFYTNQVDARKFLQKM KAVVDSNQQEKKYQDDFLNPNEYNEMQDIYEDYNMGDLVIVFPNPDADGVKNPPITYKEA PLTKTNFYSKIGNVSYENDIDELCVDEMEYLRNMRNVDGEHMDQDHVKEEI I am working with Windows and I don't know how to do it I just know every row starts with > I want to substitute the first whitespace in a row with a delimiter like | or ; after the first regular expression new line in a row, I want also a delimiter everything between the regular expression first new line and > should go into a new column (it's a sequence of a protein)

  Read the article

• Vim Misbehaving

  - by zchtodd

  I'm not sure what changed, but lately Vim has been driving me nuts. Whenever I try to do a column mode insert, vim takes my current character and adds to the last character I inserted. For example, the first time I do a block comment by inserting # on multiple lines, it works fine. The next time, however, I end up with ## inserted on every line, and the problem just compounds from there. To do this, I'm hitting Ctrl-V, down or up arrow, Shift-I, #, and then Esc. This worked for months, but now it seems to be pasting extra stuff in. I've tried disabling all .vimrc files, but the behavior remains the same. Any ideas?

  Read the article

• Emacs org-mode: how to avoid duplicate lines in agenda, when items is scheduled AND has deadline

  - by Martin

  Many of my TODO items in Emacs org-mode have a DEADLINE defined in the future (e. g. Friday) and are at the same time SCHEDULED today so that I already know I have to start working on this task. Then, this task will appear twice in my agenda. That's not nice but not necessarily a problem yet, but if then the task has assigned a time estimate for its duration and I go to column view with C-C C-X C-C to see how much time my tasks today will need, the time estimate for this task is counted twice, so e. g. if the time effort estimate is 2 hours, I'll have 4 hours in my daily agenda, as the item appears as well as scheduled today (or in the past) as also with its deadline in 3 days. How can I avoid counting an item twice?

  Read the article

• How do I combine data from multiple rows in excel to one cell?

  - by Steve

  I have a list of product skus in one column in excel. I have thousands of these skus that need to be combined in one cell separated by commas with no spaces. There are too many rows of data to use the concatenate function. Not sure how to get this done. Here's an example of what I'm working with but with 6,000+ more rows. I'm using Excel 2003. A 140-12 1074-156 903-78 876-65 349-09 986-43 237-12 342-11 450-187 677-133

  Read the article

• Backup all plesk MySQL Databases to individual files

  - by Michael

  Hy, Because I'm new to shell scripting I need a hand. I currently backup all mydatabases to a single file, thing that makes the restore preaty hard. The second problem that my MySQL password dosen't work because of a Plesk bug and i get the password from "/etc/psa/.psa.shadow". Here is the code that I use to backup all my databases to a single file. mysqldump -uadmin -p`cat /etc/psa/.psa.shadow` --all-databases | bzip2 -c > /root/21.10.2013.sql.bz2 I found some scripts on the web that backup each database to individual files but I don't know how to make them work for my situation. Here is a example script: for db in $(mysql -e 'show databases' -s --skip-column-names); do mysqldump $db | gzip > "/backups/mysqldump-$(hostname)-$db-$(date +%Y-%m-%d-%H.%M.%S).gz"; done Can someone help me make the script above work for my situation? Requirements: Backup each database to individual file using plesk password location.

  Read the article

• Sharepoint managed Properties

  - by paulie

  Originally posted on StackOverflow, and edited for clarity I have a custom Content Type inside a list that has over 30 items (Which were uploaded via DockIt), and I have added several "managed properties" to the "crawled properties", in the SSP. All of them work except 1. The column "Synopsis" is a multiline field with no limit on it's length. It appears as a crawled property "Synopsis", and is mapped to a managed property 'asynop'. On the 'Advanced Search Page', it is added as a property and searchable, however it only returns a some matching records (if any). I manually created an entry, ran the crawl and was able to search for it. I edited an existing entry, ran the crawl (full and incremental), and it still only returned the manually entered entry. If I entered the search term in the Search box directly "asynop:fatigue", then all the correct results appear. Why is this happening? And could it please stop?

  Read the article

• How can i lock images to a cell in excel 2010

  - by Jamie

  Ok, so i am using microsoft excel 2010 and have a set up currently where i have 2 views expanded and deflated using the Group or +/- function. My problem is that ui have images on the workbook too. The images are over the cells which are to be "hidden" when the - button is pressed and i would like the images to disappear with them. This is not curently happening instead they are moving to the next visible cell. I have included an example below incase i wasn't clear. I wish to hide Columns M:AU and the images are in various cells suchas N5 and O5. When i colapse (hide) the column range all of the images move to "AV5" the next row along that isn't hidden. This means the workbooks is looking messy when colapsed which is the oposite of what i was trying to do. Can anyone advise on a way around this?

  Read the article

• Formula in table header cells

  - by Cylindric

  I have a table in Excel 2007 that I want to summarise, in a similar fashion to a Pivot Table, but for various reasons I can't use a pivot table. I like the "Format as table" features of sort and filter buttons, automatic formatting etc, so have used that to create a simple table: A B C N +-----------+------------+------------+-------+------------+ 1 | | 01/01/2010 | 01/02/2010 | ... | 01/12/2010 | +-----------+------------+------------+-------+------------+ 2 | CategoryA | 15 | 545 | | 634 | 3 | CategoryB | 32 | 332 | | 231 | 4 | CategoryC | 5 | 234 | | 644 | | ... | | | | | 27 | CategoryZ | 2 | 123 | | 64 | +-----------+------------+------------+-------+------------+ The numbers are retrieved from a "back-end" pivot table using GETPIVOTDATA(). All that works fine. Now, the problem is that I can't seem to use formulas for my column headings in these new "smart" tables - they are converted to text or just broken. For example if in B1 I put NOW(), I don't get the date, I get 00/01/1900. Is there any way of getting a formula to work in the auto tables? Or do I have to use standard tables and manually alternate-colour my rows etc?

  Read the article

• In Excel, how to group data by date, and then do operations on the data?

  - by Bicou

  Hi, I have Excel 2003. My data is like this: 01/10/2010 0.99 02/10/2010 1.49 02/10/2010 0.99 02/10/2010 0.99 02/10/2010 0.99 03/10/2010 1.49 03/10/2010 1.49 03/10/2010 0.99 etc. In fact it is a list of sales every day. I want to have something like this: 01/10/2010 0.99 02/10/2010 4.46 03/10/2010 3.97 I want to group by date, and sum the column B. I'd like to see the evolution of the sales over time, and display a nice graph about that. I have managed to create pivot tables that almost do the job: they list the number of 0.99 and 1.49 each day, but I can't find a way to simply sum everything and group by date. Thanks for reading.

  Read the article

• Custom CSV (.csv) filter for OpenOffice.org or LibreOffice?

  - by anon

  Is it possible to create a some kind of 'custom CSV filter' for OpenOffice.org or LibreOffice spreadsheet program. What I need is to have the program to use predefined CSV settings for loading and saving when I open, let's say file named 'somefile.myext'. Also I would need the loaded data to be placed in a prestyled spreadsheet. In this particular case, I would need the CSV settings to have tab as a field delimiter and no text delimiter at all. Prestyled spreadsheet would contain Blue gray coloring for every odd row (achieved with conditional formatting formula), some font styling and probably some column width definitions.

  Read the article

• Excel - Dynamic row reference based on the row I paste a formula into?

  - by michaelmichael

  I have a simple, oft-used formula that I paste as plain text into spreadsheets I receive. It looks something like this: =IF(D8="FOO", "BAR", "BAZ") It looks in D8 for the word "FOO". If it finds it it will show "BAR". If it doesn't it will show "BAZ" It works great. The problem is I have to paste this formula as plain text into many spreadsheets. It should ALWAYS look in column D for "FOO", however I don't always want it to look in row 8. I'd like it to look at whatever row I'm pasting it into. For example, if I pasted the above formula into row 25, say, I would like it to automatically change to this: =IF(D25="FOO", "BAR", "BAZ") Is there any way to achieve this?

  Read the article

• Cant Add Columns to a AD Task pad except for the top level of the domain

  - by Darktux

  We are working on Active Directory taskpads application for user management in our organization and facing stange issue. When we create a taskpad, and when we are at top level of the domain, i can click view - Add/Remove Columns and add "Pre Windows Name" (and lots of other properties) to the taskpad as columns, but when i just go 1 level down , i can only see "Operating System" and "Service Pack" ; why is it happening , isnt "Domain Admins" supposed to god access to all the things in AD domain , atleast of objects they own? It is important to have "Pre Windows 2000" Name as a column begause with out that our "Shell Command" task wont show up in taskpads, since its bound to parameter "Col<9" (which is pre qindows name). Please do let me know if any additions questions to clarify my problem.

  Read the article

• Windows 7 Enterprise, Service Pack 1. Software MS Office Excel 2010

  - by user327560

  In Excel I understand there is no mechanism to customise & re-label the Rows & Columns (i.e. Renaming Col. A to some text like "Item Number" and so on. My question is regarding if it's possible to start Row Numbering at zero, or to determine a pre-allocated number of rows which contain my Headers, and then the first Row with the detail is infact seen as Row 1? Reason for question is I work multiple INternational Projects and we use Excel to trsack alot of activities & issues. Oddly, many people will refer to, for example "Point 7"... Some people mean the ID 7 (which I have the first Column dedicated to ID Number), some mean Excel Row 7, which infact could be really ID 3, or 4 from Col. A.... Any easy way or workaround to just use the Excel Row Numbers but select from when Row 1 is counted?

  Read the article

• How can I turn off calculated columns in an Excel table from a macro using VBA?

  - by user41293

  I am working on a macro that inserts formulas into a cell in an Excel table. The Excel table does the automatic filling of columns and fills all the cells in that column with the formula, but all I want is one cell to have the formula. I cannot just turn off automatic formula for tables as I need to have other people use this worksheet on their systems. Is there a way to turn off the automatic filling of formulas in a table using VBA in a macro? It just needs to be temporary: I just want to turn it off, put in my formulas, then turn it back on.

  Read the article

• Average Difference and Direction Between Values in Excel with Blanks

  - by 114

  I have a sheet that looks something like this: Sheet 1 1 2 3 4 5 6 7 8 9 10 11 1 6 2 3 5 3 4 2 4 9 4 5 6 4 6 6 7 5 3 3 3 10 8 4 8 8 9 4 11 12 12 6 10 11 8 5 5 4 9 4 7 6 What I would like to be able to do is find the average difference and direction between values in each column. For example, the first 4 rows would look like: Average Difference # + Movements # -Movements 1 2 2 1 0 3 4 (2+5+5)/3 2 1 Blanks represent N/A values due to insufficient information, and differences are calculated successively i.e. col2-col1, col3-col2, col4-col3 If I just take the differences and make a duplicate table with the formula =C2-B2 copied across issues arise whenever there is a blank space between two values or at the beginning of the row. Is there an easy way to fix this or another way to do this that I might be missing?

  Read the article

• Create a term-document matrix from files

  - by Joe

  I have a set of files from example001.txt to example100.txt. Each file contains a list of keywords from a superset (the superset is available if we want it). So example001.txt might contain apple banana ... otherfruit I'd like to be able to process these files and produce something akin to a matrix so there is the list of examples* on the top row, the fruit down the side, and a '1' in a column if the fruit is in the file. An example might be... x example1 example2 example3 Apple 1 1 0 Babana 0 1 0 Coconut 0 1 1 Any idea how I might build some sort of command-line magic to put this together? I'm on OSX and happy with perl or python...

  Read the article

• Wireshark Display Filter protocol==TLSV1? (and PacketLength)

  - by NealWalters

  What would the filter expression be to just select the protocols where the protocol = TLSV1? Something obvious like protocol == "TLSV1" or TCP.protocol == "TLSV1" is apparently not the right way. ip.proto == "TLSV1" says "ip.proto cannot accept strings as values" Update - additional tips: Another great but hidden search is on PacketLength: You can add packet length to your display by clicking "Edit Preferences" (menu or icon), and adding the PacketLength as a new column, but to filter on it you have to use the more cryptic: frame.len == ### where ### is your desired number. We were using this to determine how many packets had been sent and/or received, when you filter, the status-bar at the bottom of the screen shows the number of items matching the filter.

  Read the article

• Hide/Unhide rows based on more than one cell value

  - by Mike

  Please help me I am using the following code to hide rows if cell values are 0: Private Sub Worksheet_Calculate() Dim LastRow As Long, c As Range Application.EnableEvents = False LastRow = Cells(Cells.Rows.Count, "I").End(xlUp).Row On Error Resume Next For Each c In Range("I9:I48") If c.Value = 0 Then c.EntireRow.Hidden = True ElseIf c.Value > 0 Then c.EntireRow.Hidden = False End If Next On Error GoTo 0 Application.EnableEvents = True End Sub It works perfectly, but I would like for the code to also check column K (the same range K9:K48) if both cells in a row are 0 then the row must be hidden. How can I change the code to do this?

  Read the article

• Thunderbird 3.0 - how to prevent new message indicator from clearing?

  - by Joe Casadonte

  I just installed Thunderbird 3.0 and there are a few things driving me batty. When new email is delivered it has a faint star to the left of the subject (this is different than the new star column thing). In the old days (i.e. last week) the new message indicator wouldn't go away until I read the message or left the folder and returned. Now, as soon as I do anything with any email message, all new message indicators are cleared. How can I go back to the old behavior?

  Read the article

< Previous Page | 339 340 341 342 343 344 345 346 347 348 349 350  | Next Page >